CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP043820	Achromobacter xylosoxidans strain AX1 chromosome, complete genome	4 crisprs	DEDDh,cas3,DinG,csa3,PD-DExK,WYL,RT	1	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043820_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043820_1

978469-978563

Orphan

Consensus_repeat	Method
GCCGTGGGGGCCGGCATCGGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043820_1

>merge|NZ_CP043820|1|978469-978563|CRISPRCasFinder
GCCGTGGGGACCGGGGCCGGCGCCGCCGTGGGGGCCGGCATCGGCGCCCTGATCGGCCATGGCACCGGCGCGGCCGTGGGCGCCGGCATCGGCGC

>NZ_CP043820|1|1|978469-978563|CRISPRCasFinder
GCCGTGGGGACCGGGGCCGGCGC	CGCCGTGGGGGCCGGCATCGGCGCCCTGATCGGCCATGGCACCGGCGCG
GCCGTGGGCGCCGGCATCGGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043820.1\|WP_006388842.1\|979869_980091_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388830.1\|973492_974137_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP043820.1\|WP_026382373.1\|966924_967566_+\|DNA-3-methyladenine-glycosylase-I	unknown	unknown	gnl\|CDD\|377025
NZ_CP043820.1\|WP_006388832.1\|975571_976516_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|277358
NZ_CP043820.1\|WP_020925109.1\|969806_971879_+\|AsmA-family-protein	unknown	unknown	gnl\|CDD\|225529
NZ_CP043820.1\|WP_006388831.1\|974254_975001_+\|3-oxoacyl-ACP-reductase-FabG	unknown	unknown	gnl\|CDD\|235500
NZ_CP043820.1\|WP_006388825.1\|966232_966706_-\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|223799
NZ_CP043820.1\|WP_006388841.1\|979417_979873_-\|winged-helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224759
NZ_CP043820.1\|WP_006388847.1\|984610_987004_+\|LPS-assembly-protein-LptD	unknown	unknown	gnl\|CDD\|224369
NZ_CP043820.1\|WP_006388829.1\|971885_973481_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP043820.1\|WP_006388840.1\|979034_979361_+\|4a-hydroxytetrahydrobiopterin-dehydratase	unknown	unknown	gnl\|CDD\|234845
NZ_CP043820.1\|WP_149894835.1\|977607_978291_+\|HAD-IA-family-hydrolase	unknown	unknown	gnl\|CDD\|319787
NZ_CP043820.1\|WP_006388846.1\|983401_984442_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|225719
NZ_CP043820.1\|WP_149894833.1\|967582_969511_-\|sulfatase-like-hydrolase/transferase	unknown	unknown	gnl\|CDD\|224287
NZ_CP043820.1\|WP_006388844.1\|981857_982556_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_024067780.1\|988587_989379_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	unknown	unknown	gnl\|CDD\|234708
NZ_CP043820.1\|WP_149894834.1\|976641_977265_-\|FMN-dependent-NADH-azoreductase	unknown	unknown	gnl\|CDD\|224103
NZ_CP043820.1\|WP_006388845.1\|982715_983402_-\|nucleotidyltransferase-family-protein	unknown	unknown	gnl\|CDD\|133044
NZ_CP043820.1\|WP_047992622.1\|987000_988569_+\|molecular-chaperone-SurA	unknown	unknown	gnl\|CDD\|236758
NZ_CP043820.1\|WP_006388843.1\|980087_981722_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|236158

Protein	Function_ID	Function_description	E-value
NZ_CP043820.1\|WP_006388830.1\|973492_974137_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.35841e-09
NZ_CP043820.1\|WP_026382373.1\|966924_967566_+\|DNA-3-methyladenine-glycosylase-I	gnl\|CDD\|377025	pfam03352, Adenine_glyco, Methyladenine glycosylase. The DNA-3-methyladenine glycosylase I is constitutively expressed and is specific for the alkylated 3-methyladenine DNA.	2.96274e-107
NZ_CP043820.1\|WP_006388832.1\|975571_976516_+\|hypothetical-protein	gnl\|CDD\|277358	cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain. PA3087 is an uncharacterized protein from Pseudomonas aeruginosa with a metallophosphatase domain that belongs to the phosphoprotein phosphatase (PPP) family. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	1.8882e-60
NZ_CP043820.1\|WP_020925109.1\|969806_971879_+\|AsmA-family-protein	gnl\|CDD\|225529	COG2982, AsmA, Uncharacterized protein involved in outer membrane biogenesis [Cell envelope biogenesis, outer membrane].	3.93388e-152
NZ_CP043820.1\|WP_006388831.1\|974254_975001_+\|3-oxoacyl-ACP-reductase-FabG	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	9.38496e-90
NZ_CP043820.1\|WP_006388825.1\|966232_966706_-\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|223799	COG0727, COG0727, Predicted Fe-S-cluster oxidoreductase [General function prediction only].	4.13024e-15
NZ_CP043820.1\|WP_006388841.1\|979417_979873_-\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|224759	COG1846, MarR, Transcriptional regulators [Transcription].	9.40517e-15
NZ_CP043820.1\|WP_006388847.1\|984610_987004_+\|LPS-assembly-protein-LptD	gnl\|CDD\|224369	COG1452, Imp, Organic solvent tolerance protein OstA [Cell envelope biogenesis, outer membrane].	1.0266e-135
NZ_CP043820.1\|WP_006388829.1\|971885_973481_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	2.77993e-57
NZ_CP043820.1\|WP_006388840.1\|979034_979361_+\|4a-hydroxytetrahydrobiopterin-dehydratase	gnl\|CDD\|234845	PRK00823, phhB, pterin-4-alpha-carbinolamine dehydratase; Validated.	1.19596e-44
NZ_CP043820.1\|WP_149894835.1\|977607_978291_+\|HAD-IA-family-hydrolase	gnl\|CDD\|319787	cd02588, HAD_L2-DEX, L-2-haloacid dehalogenase. L-2-Haloacid dehalogenase catalyzes the hydrolytic dehalogenation of L-2-haloacids to produce the corresponding D-2-hydroxyacids with an inversion of the C2-configuration. 2-haloacid dehalogenases are of interest for their potential to degrade recalcitrant halogenated environmental pollutants and their use in the synthesis of industrial chemicals. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	2.28803e-26
NZ_CP043820.1\|WP_006388846.1\|983401_984442_-\|phosphotransferase	gnl\|CDD\|225719	COG3178, COG3178, Predicted phosphotransferase related to Ser/Thr protein kinases [General function prediction only].	2.29284e-106
NZ_CP043820.1\|WP_149894833.1\|967582_969511_-\|sulfatase-like-hydrolase/transferase	gnl\|CDD\|224287	COG1368, MdoB, Phosphoglycerol transferase and related proteins, alkaline phosphatase superfamily [Cell envelope biogenesis, outer membrane].	9.09462e-83
NZ_CP043820.1\|WP_024067780.1\|988587_989379_+\|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA	gnl\|CDD\|234708	PRK00274, ksgA, 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase RsmA.	4.15353e-134
NZ_CP043820.1\|WP_149894834.1\|976641_977265_-\|FMN-dependent-NADH-azoreductase	gnl\|CDD\|224103	COG1182, AcpD, Acyl carrier protein phosphodiesterase [Lipid metabolism].	6.19041e-32
NZ_CP043820.1\|WP_006388845.1\|982715_983402_-\|nucleotidyltransferase-family-protein	gnl\|CDD\|133044	cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family. This is a subfamily of nucleotidyl transferases. Nucleotidyl transferases transfer nucleotides onto phosphosugars. The activated sugars are precursors for synthesis of lipopolysaccharide, glycolipids and polysaccharides. Other subfamilies of nucleotidyl transferases include Alpha-D-Glucose-1-Phosphate Cytidylyltransferase, Mannose-1-phosphate guanyltransferase, and Glucose-1-phosphate thymidylyltransferase.	2.34496e-82
NZ_CP043820.1\|WP_047992622.1\|987000_988569_+\|molecular-chaperone-SurA	gnl\|CDD\|236758	PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional.	4.08084e-92
NZ_CP043820.1\|WP_006388843.1\|980087_981722_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|236158	PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional.	0

>NZ_CP043820.1|WP_149894835.1|977607_978291_+|HAD-IA-family-hydrolase
MSAVAMSAAYPRVVLFDLLTALLDSWTVWNAAAGSEARGRAWRAEYLRLTYGCGAYQPYEQLVEAAAVAVGLPASAPAALEAGWDQLAAWDGARELLAALRPHCRLGVVTNCSRRLGHRAAALLGVDWDVVVTSEEAGYYKPDPRPYQLALARLETPASQAAFVAGSGYDLFGTSKVGLATYWHNRVGLALPEGAPAPAAQSARLEDALPWLARFGAAGRDGTNCCA
>NZ_CP043820.1|WP_149894834.1|976641_977265_-|FMN-dependent-NADH-azoreductase
MRLLNIESSPRGRRSASISIANAFIDAYGKACPALQVDTLNVWDEDLPEFDGKAIGAKYKGVSKEPLDPAEVSIWTRIGALARRFQQADRIVLGVPMWNFDYPYKLKQLIDLVSQRGMLFGFDGKAYEPLLGIPRALVIHVRGQSHDPSTYAASPGFAHQADYLDFWLRFIGVKEIRRLMVEHTWDGRATETIARGRADAATMAADF
>NZ_CP043820.1|WP_006388832.1|975571_976516_+|hypothetical-protein
MYDIIGDIHGEDLKLEGLLRCLGYVPAGRGYKAPQGHQAIFLGDLVDRGAGQRRVLEIVRAMMDDGQALCIMGNHEFNAIGYVTADPHNPGEFLRPNRGDSEKSRKNRKQHSAFINQIGEGSPEHAAWVAWFRQLPPYMDLGGIRVAHACWDDGAVKALADAGWLPGQPLDDAMLVATHEKGSDLERARKLLTSGAELALPDGRYIEDKEGHRHYEVRLANWRDWASALHEVALVPAGQEAQIHGLALPEGFNRTPTTGAPIFIGHHWFKGQPRIESGKLACLDWSAAAGGPLVAYRWDGEDTLSNEKLVWERA
>NZ_CP043820.1|WP_006388831.1|974254_975001_+|3-oxoacyl-ACP-reductase-FabG
MQNLNGKVAFVTGGSRGIGAAIVRRLAADGADVAFTYVSASSRDSAAALARELEAGGRRARAIQADSADPAQVRQAVEQAIDELGPVDVLVNNAGIFLAGPLGEVTLDDYERTMNINVRAPFVAIQAAQASMPDGGRIINIGSCLAERSGRAGVTLYSASKSALLGMTRGLARDLGARGITANVVHPGPIDTDMNPADGERAGDLVAVLSLPHYGETRDIAGMVAFLAGPDGRYVTGASLAVDGGYAA
>NZ_CP043820.1|WP_006388830.1|973492_974137_-|TetR/AcrR-family-transcriptional-regulator
MAERGRPRNFDRAQALRKAMEVFWSKGYEGASLTDLTAAMGINSPSLYGAFGSKEGLFREAVQLYRDTDGAASRRALAAGATAREGVCGMLLAAAERFTAPGAPPGCLIVLGAPSGAESHDGVGVFLGDNRREMQSRILARLTAAASAGELPAGADLKGLAAFYTTILHGMSIQARDGASRKTLQAVARQAMCAWDALTGSAPQSDPPSGRAHA
>NZ_CP043820.1|WP_006388829.1|971885_973481_-|diguanylate-cyclase
MLRIDLRRLILWISLLSIFLVLAAGLHASYLVQRDLLLHNALESNRVYAAKLAATTEYFLGDLRRHLAYSADVLADMETHPGLMASETRRQEEQLGHFNSSFVVSAQGEVLAVSTSYPQLRGQHMTSDAAKTALTTRRPFISEPFRASNGRWLILYTHPIFSRDYRYLGYIAGTLYLHEDNVLDRLLGQHFNRDDSLLYVLSRDGTLIYHPDRSRLGQASADKAALAAALRGETGEIRFTDASRNAILAGYAPVPSTGWTIIAQRPVASTLLPLNDLLMATARNTLPLLVMSIVLIWLLSRWIARPLGELAGIAKRMQDPDSAERIRKVRSWYFEASQLKRALLMGLTSIQHKIRDLRRASTTDTLTSLLNRRGLNEAMALLQAAETPLAIVALDIDHFKNINDRYGHAAGDRALQILAALLTEGSRGGDTVARSGGEEFVMLMPGASLAAAVGAAERLRLKLERLGTDTGLPAPITLSAGVACYPAHGATLDEVMQRADRALYYAKNHGRNAVCVADNHAADGARMALPR
>NZ_CP043820.1|WP_020925109.1|969806_971879_+|AsmA-family-protein
MTRKTKIAGGIVGGIVLLVAVLVVVVATFDWNRARPMINERVSAAIGRPFAINGDLSVEWSRESDEGGWRAWVPWPRVVANDISVANTEWGKAPQFATLKRGEFSLSPLPLLSQRVVIRRIQLTEPAADLERLADGRANWVFTLPESGEPSPWVLDINEIGFDKGRVGLSDAILQADLTVVVDPLGKPVPFADVAGASFVPEDAAATAPRDYVFGWKAEGKYKGLATKGEGKVGGMLALQDPRQPFPVQADVTIGGTKAAVAGTLTDPVNLGALDLRLKLSGGSMAQLYPLTGVTLPDTPPYSTDGHLVAKLRNAGGAVFDYRDFNGRVGGSDLHGDVSFALSAPRPKLTGKLTSRQLRMEDLGPLIGVPSGKQAPAQDKPKDAPAKRAGGKVLPTQAFRTDRWRDMDADVALEAGRIVHDAKLPLSDLSVHLVLQDGQLTLDPLRFGMAGGSMAATVRLDGSQQTLTGRVDMHARRLRLKQLFPSAQAMQKTLGELNGDLALSGTGNSVAALLGSASGDVKMLVNDGVISRSLMEIAGLNVGNYVVSKLFGDDEVKINCGAADLSMKNGVMTPRVFVFDTENALINITGTTDFKNEKLDLDITPDSKGFRIFSLRSPLYVRGTFGSPDVGVHVGPLAARGAGMVALGVILTPAAGLLALIAPSTTDDNSCGTLLKQMRTPPKAPAPKGK
>NZ_CP043820.1|WP_149894833.1|967582_969511_-|sulfatase-like-hydrolase/transferase
MRHSSLIFVVAAFALLTLSRLALAAWQWQRVRNAGGLLPLLLGGLRIDAHQIGVMAALPAVLSPWFGHLPFAATAAGIWYLVAFILMAFLEVATPPFILEYDTRPNRLFVEYLKHPREVSGMLWRGYKGALLGGFGALGLIGWGAYELFGHAVPDAPLAWWQMPLASLAILAVVILAIRGTLGHRPINPSSVAYSSDGMLNTLALNSLYNVFYAVYSMKNEKSASAVYGGMDDDDMHRRVLAQAGLPYPPANADHPSLHRQPASRKTARPLNLVIILEESLGAQYSAGLGGMDLTPELDALARQAWTFTRAYATGTRSVRGLEAVVTGFLPTPAQAVLKLPRSQRGFFSLADLLGRHGYHSRFIYGGESHFDNMKGFFLGNGFKQIVDREDFVDPAFVGTWGASDEDMFNQLDRLLREDGDQPTFTLAFSVSNHSPWEYPAGRIQTDGNPATVENTVRYADWALGRFFEHAKDAPYWENTVFLIAADHDSRVFGASLVPVRHFHIPAVILGAGIEARRDDRLISQIDLAPTLLSLIGVDTEHPMLGHDLTRSTPGRAIMQYDNTYGYLKENDLLVMAPNKTPVQYRYTAPEDYAPMALDPELAEEALAHALWPSWAYREGRYCIPAAAAPAQTASAPLTATR
>NZ_CP043820.1|WP_026382373.1|966924_967566_+|DNA-3-methyladenine-glycosylase-I
MNANSDFSDGLARCGWVDTSAEYMAYHDTEWGFPQGDDRALFEQLCLEGFQSGLSWRTILNKREAFRRGFAGFDPAKVARFGEAQIQALLADAGIVRHRGKIEAVINNAQRALEMIEREGSLGAFLWRFEAPAGASSTRGASTSAQSEALSKALKKLGWKFVGPTTVYAFMQSVGMVNDHHPDCHCHAPSERARKAFRRPAQAAADKGGAAGP
>NZ_CP043820.1|WP_006388825.1|966232_966706_-|YkgJ-family-cysteine-cluster-protein
MSLLETAALTLVSPALLAGDNNPATNPCLDCGACCSHFRVSFYIGELAGENGGQVPLDLVTQMSPLRACMKGTEMGGGRCISLRGELGRPGIHCAIYENRPTPCREFDIWQPDGSPNPDCQRLRLALGLPAVPPRPDAENDPQGPSHPNQPDQPAAA
>NZ_CP043820.1|WP_006388840.1|979034_979361_+|4a-hydroxytetrahydrobiopterin-dehydratase
MSMFPPARIGTDTAVAALSGWQAVAMREAIEKRFRFPNFNAAFGFMARVAMFAEKLNHHPEWTNVYNRVDVMLTTHDAGGVTELDVRMAQFMDEAAAQMGATAPKAGL
>NZ_CP043820.1|WP_006388841.1|979417_979873_-|winged-helix-turn-helix-transcriptional-regulator
MTTPALERFLTYRLHVINKITDRDTNRAYLEDCGIPLGEARCLAAIGRYAPLSVNDLARAANLNKGQASRSAQALAGRGLIEKKDSAADGRGVVLSLTPTGQAQYRRIIDLIARRNQDIFGCLSAEEQRQLGDMLDRLIAHQRERPEAPQD
>NZ_CP043820.1|WP_006388842.1|979869_980091_-|hypothetical-protein
MNDDQLDQVYTRMAQALTRVGEARAPLFLSILGLSALARLPDAQAACALLAQAEAACAAPVANYPAATADSPT
>NZ_CP043820.1|WP_006388843.1|980087_981722_-|FAD-dependent-oxidoreductase
MTLPAHVPVLIVGGGPVGLTLAALLAHYGIASLTLEADDGYCDGSRAICISRRSQEILGWIGADAALNATGLPWTGGRSYYRDREVLHFEMPHDPLQRFAPMVNIQQYFVEEYAHQALQRQPGPAALHWSARAVGVRSTADGVQVDVDIAGHRHALRADWLVACDGGRSSVREALGLKLEGMQYEGRYVIVDIEQASHRPVERLAWFDPPSNPGSTLLMHRQPGNVWRVDYQIRDDEDAADAVAPGNVLPRVQSHLDMIGETAPWKPLWISLYNAKCLTLERYRHGRVLFAGDAAHLVPIFGVRGLNSGLDDAGNLAWKLAWVLRGQAPDSLLDSYSDERVHATRQNLAYGAKSTEFMAPPDFGFRLMREAALRLALSDERARPLINPRQSAPISYEGSPLNLADDAAAQPLAAAPGQPAPDLLLADADAVPRYLSACFGQGFVLLACAPDAAMAAGLQRLAAATRQAPCPLVTIVVGGPAPGAWSDPHGHLHERFGAQPGTVWLLRPDGYVMGRWAMLDATALRAALAPYYPMLESSRQETQP
>NZ_CP043820.1|WP_006388844.1|981857_982556_-|hypothetical-protein
MFGRSQRAVFKPSVYQPGQRTRRMPRWLVLLLVGIALGAGGVLFLQTNYGPQRLTVEQSEQLHTELSASKLENQRLQSQLEEATQQRDANKSGHEKLTADLADARAKLDTLNKELVLFQDAMPPDPRGGNLGIRSATFKRQPGLLDYQVLVMREERTGAPFKGTLTFSIDGSYSNGRAATVTPEGPALNVDRYDYALGQLKLPDGFTPKVVVLRVMDGNQKQQAMRIYYVRN
>NZ_CP043820.1|WP_006388845.1|982715_983402_-|nucleotidyltransferase-family-protein
MRAMILAAGRGERMRPLTDRLPKPLLPVGGKPLIAWHLERLAAAGFRDVVINHAWLGHEIERTLADGAAFGLRIRYSPEAAALETAGGIAQALPLLGPDPFLVINGDIWCDWNPAAAPALATALPTGGAWLLMVDNPPQHPLGDFALDRDGRVRADGEPRLTFSGIGVYHPMLFAGVARGTAARLAPLLRQAMEHDHVRGARHTGRWVDVGTPQRLADLDAELGSSPV
>NZ_CP043820.1|WP_006388846.1|983401_984442_-|phosphotransferase
MKNDHDPRLEQIRAWLQGLPAALGLAVDTLRPASADASFRRYFRLDAAGRTLIVMDAPPQHEDCRPFLHVDQLLSDAGLNVPAVIEQDLAQGLLLLSDLGEQTYYQRIQDGVDDASLQSMYRDALAALVRLQQARTTGLAHYDSARLAEELKLFPEWYVQKHHGATLDDKTAQALEKIFALLSASNGNQPTVLVHRDYHSPNLMVCDQPQYGPNPGVIDFQDALAGPITYDLASLVTDARTTWEEPQQLDWAIRYWEMARAAGLPVDADFAEFHRAYEWMGLQRNLRILGVFARLNHRDGKAHYLAHMPRVNGYVRQVAQRYGVFTPLLRLLDRLDDRQVSVGYTF
>NZ_CP043820.1|WP_006388847.1|984610_987004_+|LPS-assembly-protein-LptD
MRKVRWLILSAISVAGAVQAQGSQGSASSATSITAAPELRTSPGLRMHRLPDGNIPAYMEADTIEGDPDSDLTLTGAAQVRRIDGVIKGDRINYRKDTGEVDVQGNARMMRDGTLVTGPNAKFNVDKYSGEVEKPNFWLGATGGFAVADKADIFSKSQMRLHTVTYSGCSCETPSWYIKANTVDIDFDENEGVARNGVLYFKDVPILASPYMTFPVKKERKSGFLMPTYGTTSKGGFDFSLPYYLNIAPNYDATLQPRYFSKRGLQLGGEFRYLGASYAGSVYGAYLPHDNVSGEDRWMYWWRHQQLLGNGFYADWDVAKVSDNDYFRDISQLGLNQASTTYLPQRARVGWSSTYWSAYAQVYKYQTLQDPDALLTPPYDKQPELYLRGARYDWGGFDVDWTSTAVRFSKPLFLGNRNGPNGDRLQTYPTVSYPIVRPGWFVIPKAGVNYTQYQTDWYHGDWLGLNSGTANAGTSFGYPRSQSRTVPIMSLDAGLIFERDTTLFGKDSIQTLEPRLYYLRVPYRDQSKIPVYDTSLSDFSFSQAFDENIYSGGWDRISNANQLTAALTTRWLDASTGFERASVAVAQRLYFADQKVTLPGETPRENVRSDFLVGASAALTDTLTTDVAAQYNPYDNQWSRGLLSARWSPQRLTTVALAYRYQRDPQPGVLYQPQGQNQISLAVQWPFTKRWYGVGRVDYSLRNGPSSTVNGTTDSPRVTQAIAGLEYKGDCCWVGRMVFQRYAVSATDANTALFFQLELTGLGSLGTDPMNLLNRSIPGYSRITPPAPTGTTFERYE
>NZ_CP043820.1|WP_047992622.1|987000_988569_+|molecular-chaperone-SurA
MMRRLHSLRRFSGNALLLAVCAAFSAAHAAEPNGKGTKNAPAATQKSAPAPAGEQFVDGIAAVVDKDVITLRELRDASLRIAAELKTRGIQVPDDKALQHQVLQRLIMERVQRHEADRLGIRVTDAQVDQAITTIAGRNKISVAQLRAEIEKSGVSWDSYRKSLMDEIRSDRLRQRAVDSTIVISDAEVDAFLKDQRRNPAFAAAPQQAQPQPQPEAAPEQAAAPAGPMLYAVAQILVRVPEGSSPEQLAALRKKAEDLLARVKRGDDFASLAAASSDGPEALQGGVMGVRPLDGWPDLFAKAIANLQKGQVSGLLQSGNGFHILKVMDRGTAQPAPSRTARAPVPTPAPQPRPQPQAQAPQGPVEVMQTHARHILIKTSTVMSDEQARQRLEQVRQRLVAGDAKFDDMARQYSQDATAPQGGDLGWLNPGETVPPFEAAMNALKPGEISQPIQTPFGWHLIQVEERRQHDATDDLARMKARQTLFERRAQPAFEDWLDQLRAQAYIDNRLEKQDRINQNNR
>NZ_CP043820.1|WP_024067780.1|988587_989379_+|16S-rRNA-(adenine(1518)-N(6)/adenine(1519)-N(6))--dimethyltransferase-RsmA
MSQHQARKRFGQNFLTDESVVESIVRAVNPARGDTVVEIGPGLSALTRPLLERLDHLTAVEIDRDLAARLRKQFEEGRLTVVEADALTVDFSQFGAGLRVVGNLPYNISSPLLFHLMAWADHVRDQHFMLQREVIDRMVAQPGSGDFSRLSVMLQSRYRMHKLFDVPPEAFDPPPKVVSAIVRMVPLPAERLRPVSARAFETVVARAFSQRRKMLRRVLADWAPQVPWEALDIAPTARAEDISVDRYIRLSDALVEAGVLQGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043820_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043820_2

1807282-1807405

Orphan

Consensus_repeat	Method
CCCCCCGAGGGGGGGCGTTTTCATCTTGAGGCGGCTCGGCGATGAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043820_2

>merge|NZ_CP043820|2|1807282-1807405|CRISPRCasFinder
CCCCCCGAGGGGGGGCGTTTTCATCTTGAGGCGGCTCGGCGATGAAAGAAGCCCCCACGCCGCGCCTTCGGCTTGCTGCCCCCCGAGGGGGGCGTTTTCATCTTGAGGCGGCTCGGCGATGAAA

>NZ_CP043820|2|2|1807282-1807405|CRISPRCasFinder
CCCCCCGAGGGGGGGCGTTTTCATCTTGAGGCGGCTCGGCGATGAAA	GAAGCCCCCACGCCGCGCCTTCGGCTTGCT
GCCCCCCGAGGGGGGCGTTTTCATCTTGAGGCGGCTCGGCGATGAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043820.1\|WP_026383136.1\|1809142_1810819_-\|MHS-family-MFS-transporter	unknown	unknown	gnl\|CDD\|340927
NZ_CP043820.1\|WP_006388385.1\|1802216_1802618_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388393.1\|1808504_1808714_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388386.1\|1802681_1803041_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388404.1\|1816754_1819052_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|235367
NZ_CP043820.1\|WP_020924512.1\|1803499_1803925_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388398.1\|1812620_1813310_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP043820.1\|WP_006388387.1\|1803209_1803341_+\|entericidin-A/B-family-lipoprotein	unknown	unknown	gnl\|CDD\|227797
NZ_CP043820.1\|WP_006388392.1\|1807453_1808353_-\|recombination-associated-protein-RdgC	unknown	unknown	gnl\|CDD\|234726
NZ_CP043820.1\|WP_006388400.1\|1814854_1815595_+\|recombination-regulator-RecX	unknown	unknown	gnl\|CDD\|234646
NZ_CP043820.1\|WP_006388383.1\|1800357_1800702_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388402.1\|1815641_1816559_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176132
NZ_CP043820.1\|WP_020924511.1\|1803927_1804341_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388390.1\|1804441_1805734_+\|aspartate-carbamoyltransferase	unknown	unknown	gnl\|CDD\|183362
NZ_CP043820.1\|WP_110134624.1\|1819218_1823193_+\|non-ribosomal-peptide-synthetase	unknown	unknown	gnl\|CDD\|274093
NZ_CP043820.1\|WP_006388399.1\|1813688_1814753_+\|recombinase-RecA	unknown	unknown	gnl\|CDD\|236476
NZ_CP043820.1\|WP_024068229.1\|1800959_1802210_+\|TIGR03862-family-flavoprotein	unknown	unknown	gnl\|CDD\|274820
NZ_CP043820.1\|WP_085941802.1\|1811128_1812505_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|182388
NZ_CP043820.1\|WP_024068228.1\|1799656_1800037_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_006388391.1\|1805864_1807277_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635

Protein	Function_ID	Function_description	E-value
NZ_CP043820.1\|WP_026383136.1\|1809142_1810819_-\|MHS-family-MFS-transporter	gnl\|CDD\|340927	cd17369, MFS_ShiA_like, Shikimate transporter and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli shikimate transporter (ShiA), inner membrane metabolite transport protein YhjE, and other putative metabolite transporters. ShiA is involved in the uptake of shikimate, an aromatic compound involved in siderophore biosynthesis. It has been suggested that YhjE may mediate the uptake of osmoprotectants. The ShiA-like subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.81009e-131
NZ_CP043820.1\|WP_006388390.1\|1804441_1805734_+\|aspartate-carbamoyltransferase	gnl\|CDD\|183362	PRK11891, PRK11891, aspartate carbamoyltransferase; Provisional.	0
NZ_CP043820.1\|WP_006388404.1\|1816754_1819052_+\|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase	gnl\|CDD\|235367	PRK05222, PRK05222, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase; Provisional.	0
NZ_CP043820.1\|WP_006388398.1\|1812620_1813310_-\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.43694e-74
NZ_CP043820.1\|WP_006388387.1\|1803209_1803341_+\|entericidin-A/B-family-lipoprotein	gnl\|CDD\|227797	COG5510, COG5510, Predicted small secreted protein [Function unknown].	3.27164e-06
NZ_CP043820.1\|WP_006388392.1\|1807453_1808353_-\|recombination-associated-protein-RdgC	gnl\|CDD\|234726	PRK00321, rdgC, recombination associated protein; Reviewed.	2.10541e-163
NZ_CP043820.1\|WP_006388399.1\|1813688_1814753_+\|recombinase-RecA	gnl\|CDD\|236476	PRK09354, recA, recombinase A; Provisional.	0
NZ_CP043820.1\|WP_110134624.1\|1819218_1823193_+\|non-ribosomal-peptide-synthetase	gnl\|CDD\|274093	TIGR02353, NON-RIBOSOMAL_PEPTIDE_SYNTHETASE, non-ribosomal peptide synthetase terminal domain of unknown function. This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide. This domain is roughly 700 amino acids in size and is found in polypeptides roughly twice that size.	0
NZ_CP043820.1\|WP_006388402.1\|1815641_1816559_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176132	cd08441, PBP2_MetR, The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold. MetR, a member of the LysR family, is a positive regulator for the metA, metE, metF, and metH genes. The sulfur-containing amino acid methionine is the universal initiator of protein synthesis in all known organisms and its derivative S-adenosylmethionine (SAM) and autoinducer-2 (AI-2) are involved in various cellular processes. SAM plays a central role as methyl donor in methylation reactions, which are essential for the biosynthesis of phospholipids, proteins, DNA and RNA. The interspecies signaling molecule AI-2 is involved in cell-cell communication process (quorum sensing) and gene regulation in bacteria. Although methionine biosynthetic enzymes and metabolic pathways are well conserved in bacteria, the regulation of methionine biosynthesis involves various regulatory mechanisms. In Escherichia coli and Salmonella enterica serovar Typhimurium, MetJ and MetR regulate the expression of methionine biosynthetic genes. The MetJ repressor negatively regulates the E. coli met genes, except for metH. Several of these genes are also under the positive control of MetR with homocysteine as a co-inducer. In Bacillus subtilis, the met genes are controlled by S-box termination-antitermination system. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.70113e-109
NZ_CP043820.1\|WP_006388400.1\|1814854_1815595_+\|recombination-regulator-RecX	gnl\|CDD\|234646	PRK00117, recX, recombination regulator RecX; Reviewed.	8.58534e-45
NZ_CP043820.1\|WP_024068229.1\|1800959_1802210_+\|TIGR03862-family-flavoprotein	gnl\|CDD\|274820	TIGR03862, flavo_PP4765, uncharacterized flavoprotein, PP_4765 family. This model describes a sharply distinctive clade of proteins within the larger family of flavoproteins described by pfam03486 and TIGRFAMs model TIGR00275. The function is unknown.	1.71636e-164
NZ_CP043820.1\|WP_085941802.1\|1811128_1812505_-\|sensor-histidine-kinase	gnl\|CDD\|182388	PRK10337, PRK10337, sensor protein QseC; Provisional.	1.09144e-69
NZ_CP043820.1\|WP_006388391.1\|1805864_1807277_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.24826e-58

>NZ_CP043820.1|WP_006388391.1|1805864_1807277_+|diguanylate-cyclase
MSSSSRAVPSSPDPAGQACYLSASNAQAWQAVYSSVDAYTRGQVAAVVSDSANELVDAFYSTLLADAEAGPRLSHEIVSTRLHKGMKGWLKGLLCVREQGDIAALMATQKKVGEVHARVHIPIHLVMAGARILKNEIAQRLRASDLDGMAASIATQYVCNLFDLAIEQMSRAFMRDINRGARNDEAYRLFALGQNISTERERQRAALLEWSQAVLIGLHYRAPEQVLPRLAASEFGLWLQHKGGVLFESAPALGQIIEAVARLDDVVLPRLLQGSPESLPDQVRELQELVARIKHLLNGLFDMVAEIESGSDPLTNVLNRRFLPSVIGREILIATREHSTFSVLLLDIDHFKAINDSHGHAGGDQVLRQFAEVVHQSCRSSDFVFRYGGEEFLVVLVDTAREAALAAAEKLGGEIRRHAFAIPEAGSLRITASIGVATFDGHPDYAYLIDRADKALYQAKQAGRDRSVAG
>NZ_CP043820.1|WP_006388390.1|1804441_1805734_+|aspartate-carbamoyltransferase
MTISQQAFLRDAMRRLNLTRDVFATRIGVKRRALDTWLLPEGSQEFRAMPEVVQRFVSEIVQNGVLLEKYTQSVQEGPLRERIAVEGKHQLLSVDQFTRESVEDLFRVADMMQPIARRQKVSRVLEGAVLGNLFFEASTRTRVSFGSAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVMSGYVDAMVIRHPDQGSVAEFARATNIPVVNGGDGPGEHPSQALLDLYTILTEFSRLGKLLDGAHIAMVGDLKYGRTVHSLIKLMALYKNVKFSLVSPKGLEMPSYIVEQASRNGNIIEQKSSLAEGLAGADVIYATRVQKERFANEENEGYTPDFQINRAIIDAYCGPDTIVMHPLPRDSRPGANDLSVDLNHDPRLAIFRQTDNGIPIRMAIFAVLLGVEGLVQHSLRDVTWQHPSHIGPDDSVFHGLE
>NZ_CP043820.1|WP_020924511.1|1803927_1804341_+|hypothetical-protein
MDPRAQQIRAAGLPFALLTGAFRLLGWLNGGAALGLVAFVLGMVGGDIAAPDLQLPLFFLLAGLLVACLGVLFAYLAQVSLLRQGYTGRLGRGHLPAQILAMLCYVASALAFCAACWLAAGQGATDAASQMTTYATL
>NZ_CP043820.1|WP_020924512.1|1803499_1803925_+|hypothetical-protein
MRKSVWVGVTLMALLGGCASTGVYESETTLKETFSVDTNYQAAFRRAGEYVRTCHVNVQHPYNVAYAWKHVIGEKGAPDEVQVYKVGETAKILELVSAESDGPAKAKVTVTVLGEGRWDAAEIAAARASIQSATPVCRKGD
>NZ_CP043820.1|WP_006388387.1|1803209_1803341_+|entericidin-A/B-family-lipoprotein
MKNKVILVMLLSIAAMSAGCNTVAGAGKDIQRGGEKIEGAATK
>NZ_CP043820.1|WP_006388386.1|1802681_1803041_-|hypothetical-protein
MTTKHLSENTGGGPQAWGWEQPQCRGQAALALFIDDLHRILQAHAAGQLAASSTLADAQEQVDQLLVRYNDIAAAPEIFLGQSVQLKEGVDRSGVSHTVPIFSSRLKQSLVAMLGQAPG
>NZ_CP043820.1|WP_006388385.1|1802216_1802618_-|hypothetical-protein
MNTDNVVEFLRLLSLDVSLGAAAQHAASQADAPLALARLATAHGLPCSASDWSVFARSCLDAPDSTETDGFSGDARIWQLVQDPGQGTSMPASAITRVIGIVTQPEGPAVVGHVVNDLAPRPAQSAAPYPNGS
>NZ_CP043820.1|WP_024068229.1|1800959_1802210_+|TIGR03862-family-flavoprotein
MSASSWRVAVIGGGPAGLMAAEGLAARGIQVDVYDAMPSVGRKFLMAGRGGLNLTHSEAAAPFLARYGARAAQIEPWLRALDGDGLRAWARQLGIETFVGSSGRVFPAEMKAAPLLRAWLARLRASGVRFHMRHRWLGWPPAERPDAASLRFDTPDGVRTQAADAVVLALGGGSWAKLGSDGAWLPGLAAHGIAMAPLRAANCGFEVAWSSHFRQRHAGQPVKSVTLRCVGDAGPGPARQGEFVVTESGIEGSLVYALSALLRDRIEAAGQAVALLDLAPDWSDEKVLAAIRHPRGARSMSSHLQSRLGLTGVKAGLLRECAGADDYRDPARLGRLIKALPLVLQRTRPIDEAISTAGGVCFDALAPGLMLRQAPGVFCAGEMLDWEAPTGGYLLTACMASGVIAAEGVARFLASR
>NZ_CP043820.1|WP_006388383.1|1800357_1800702_+|hypothetical-protein
MGTAKYDHPGYVADTGAEGKYHVGIWCPHGYPAHIHIGRPAERGDPQALLRLRIPDGVFQSLPDDPETLCRRALGQALGAGLLRAVAVDGEYQELRFQLDAEPWSGPMQAAGNA
>NZ_CP043820.1|WP_024068228.1|1799656_1800037_+|hypothetical-protein
MALFSAPEPQSLRFDLPAGASRQVRLRAGAAVVCVSGRLIAIDPSYRPDLPPGARLAPSPPLNAGETYCLAEGGWLALSAVTSAQVICLDPPGMAARAVAVLARLLHLGRGNGAPARLGAMHKISK
>NZ_CP043820.1|WP_006388392.1|1807453_1808353_-|recombination-associated-protein-RdgC
MWFKNLKIYRLSSPWTLTGEQLEETLARHAYQAGNNLEMQSLGWVPPRENGGLAHVVGGQILLNLRAEKKLLPSTVVNQVAKARAQEIEEQQGYKPGRKQMKEIKERVTDELLPRAFSVYRDTRVWIDPQNHWLVIDAAASAKADEVIGLLAKCVDPFPLENLYVAQSPASAMTGWLAEDEAPSNFSIDQDTELRSSGESGAAIRYVKHSIDADDVRRHIQSGKQCTRLAMTWADRISFVLTEGLDVKRVAPLDVLKEGNDTVATNDDEKFDSDMMLMTGELAKMLAELVEALGGEKKI
>NZ_CP043820.1|WP_006388393.1|1808504_1808714_+|hypothetical-protein
MKIVGAILIVLGIAALAYKGFSYKSEETVLQVGSVKATAETEKSVPIPMWAGIAAIVAGVLVIGVGMRR
>NZ_CP043820.1|WP_026383136.1|1809142_1810819_-|MHS-family-MFS-transporter
MSTTTMAGRGPSANPRPMTKDERRVIFASSLGTVFEWYDFYLYGSLAAIIAQHFFSGVNPTAGFIFALLAFAAGFAVRPFGALVFGRLGDLVGRKYTFLVTIVIMGLSTFLVGVLPSYASIGLAAPAILIVLRLLQGLALGGEYGGAATYVAEHAPHGRRGFYTSWIQTTATLGLFLSLLVILGIRTFMGEDDFKAWGWRIPFLISVVLLGISVWIRLQLNESPTFQRMKDEGKGSKAPIAESFGQWKNLKVVLLALLGLTAGQAVVWYTGQFYALFFLTQTLKVDANTANIMIAIALLIGTPFFVIFGALSDKIGRKPIIMAGCLIAAATYFPIFQGLTHFANPALEKAQASAPVTVIADPSTCSFQFNPVGTASFTSSCDVVKSFMARNSVNYKNEAAPAGSVAKVKIGSDEFASFDGKGMAPADFKAKAAELDKALTTAIRSHGYPAKADPAQSNNVMVVVLLTILVIYVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGFLPPVAFAVVAATGNIYDGLWYPIIIAVMTLVIGTLFVRESKDNDINA
>NZ_CP043820.1|WP_085941802.1|1811128_1812505_-|sensor-histidine-kinase
MLAPLFLLWPMSVAITYVVAQNIANVPYDRALANNLHVLTRQVHAQDGRAVLRMTDPAREVLRADETDSVFWLALGSRGEYLGGDRALPLPASVGQPRPGEVQYEDDTLRGFGVRLAFTWVDLNLPNTQPALLIVAETVEKRTQLANDIIKGVIIPQFVVLPIAVLLVWFGLSRGVAPLNALQQRLRARRPDDLSPIDERAAPSEIAPLVAAMNDLLDRLSANVQAQRRFVADAAHQLKTPLAGLRTQAELALRDASPEEMQASLRQLVTGSERATRLVNQLLLLARAENPSAIGLAATDLNAIAYEQAMHWVPQALSLGTDLGFEGSETPVEINGNPLLLAELLNNLVDNALRYTPRGGHITVRVQALDGQAVLEVEDSGPGIALEERERVFDRFYRVLGTLSDGSGLGLAIVREIAQKHQATVLISDHPTPHSDLPGTRIRVVFPLYAEPVEDLGD
>NZ_CP043820.1|WP_006388398.1|1812620_1813310_-|response-regulator-transcription-factor
MRILIAEDDSILADGLSRSLRHNGYAVDAVRDGLAADSALAAQAFDLLILDLGLPQLAGLEVLRRLRARNSALPVLILTAADSIEQRVKGLDLGADDYMAKPFALSELEARVRALTRRGAGGGATLLKHGRLVFDQTGRVATVDDQTLDLSAREVSLLEILLTRSGRMVSKTQLVDHLCEWGEEVSTNAIEVYVHRLRKKLEPSGVKIVTVRGLGYCLERDQGAAYLAS
>NZ_CP043820.1|WP_006388399.1|1813688_1814753_+|recombinase-RecA
MDDKTTKAAAAEKAKALAAALSQIEKQFGKGSIMRYGDNEVSHDIQVVSTGSLGLDIALGVGGLPRGRVVEIYGPESSGKTTLTLQVVAEMQKLGGTCAFVDAEHALDVQYASKLGVNLSDLLISQPDTGEQALEITDALVRSGSVDLIVVDSVAALVPKAEIEGEMGDSLPGLQARLMSQALRKLTATIKKTNCMVIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKKGDEVVGNETRVKVVKNKVAPPFKQAEFDIMYGAGISREGEIIDLGVAANVVDKSGAWYSYNGNRIGQGKDNVREYLKEHKELAIEIENRVRENQGIVSRAAEFVPTAEDDSEE
>NZ_CP043820.1|WP_006388400.1|1814854_1815595_+|recombination-regulator-RecX
MSWKPPVTSADRLRARLDDEFETVAKPEGLRRTSDLRRAAESTGASGQEPEGAGAPASQWQRSSERRAAGGRGRRGKGGDDGDGAGEGAQPSEDKSRPRPKGPSLKMRAVGYLSRREHARDELARKLAPHAEDPDEVERVLDALEKEGWLSTERFAQSLVHRRASRQGAARIVQELRQHGVDDAQVSELREQLRATEYERALEVWQKRFGAKPEDRAAYAKQARFLASRGFAHDVIRRILGAGDDD
>NZ_CP043820.1|WP_006388402.1|1815641_1816559_-|LysR-family-transcriptional-regulator
MLEIRHLETLTAIREGGSLQEAAERLHLTQSALSHQLRDLETRLGTPLLNRRTRPARLTTAGLRVLALADEVLPRMRATERELQRLAAGRTGRLHLAIDCHSCFQWLMPALDAFRAQWPDVALDLSAAFSFAPLPALVRGDLDLVITSDPQPLDAVEYLPLFKYELVLAVSESNPLAGSKFVMPDQLADQTLITYPVDKQRLDIFTAFLDPADVEPAAIRKAELTPIIAQLVASNRGVAALPNWALTEYMNQGWLRQCRLGPQGVWRTLYATVRSEDTDASYIDEFLTLTRDVCFKTLSGIKSAK
>NZ_CP043820.1|WP_006388404.1|1816754_1819052_+|5-methyltetrahydropteroyltriglutamate---homocysteine-S-methyltransferase
MTTIHNLGFPRIGAQRELKRAVEAYWAGKQTGETLEQTGRELRARHWQAQAAAGVKFVPVGDFAWYDQILEWTTLLGAVPARFGQKDNEPVSLDTLFRMGRGRAPSGKPAAACEMTKWFDTNYHYIVPELVPGQAFRIARESLFEQIREAQALGHAVKPVIPGPLTWLFLGKGDAFAGGAADAAKLQLLANLLPVYQEVLARFAKLGVEWVQIDEPILVLDLPQAWRDAFRQVYATFSASPVKLLVATYFDGLKDNLGTALALPVAGLHVDLVRAPEQLGDVLAGLGADKVLSAGVINGRNIWRTDLDAAIATLAPVKQQLGERLWLAPSCSLLHVPVDLANETELDAELKSWLSFAAQKLDELSLLGRALDSATEASVQDGLARQRAALAARRSSARIHNPAVAQRMAASAAVSRDRAPFAGRIARQQEELGLPAFPTTTIGSFPQTAEIRALRRDWKAGALTDSAYESAIRKEIEEVIRFQEKVGLDVLVHGEPERNDMVEYFGELLAGFAFTRNGWVQSYGSRCVKPPIIFGDVARPAPMTVGWSSYAQSLTDKPVKGMLTGPVTILQWSFVRDDQPREQTCRQLALALRDEVVDLEAAGISVIQIDEPAIREGLPLRRADWQAYLDWAVDCFRLSTAGVRDETQIHTHMCYSEFNDIIESIAAMDADVITIETSRSNMELLKAFEDFRYPNDIGPGVYDIHSPNVPEVDWMVGLMQKAAARLPKERLWVNPDCGLKTRAWPETEAALIGMVQAARALREAA
>NZ_CP043820.1|WP_110134624.1|1819218_1823193_+|non-ribosomal-peptide-synthetase
MILQGPRRPDLLQAETLPDILEATILRHPAAIAIHWLDQSLTYDELGRRADLAAHHLIEAGVRPGDIVGLCLPRGDELLVMQAAIAKAGAAWLPFESDTPPERMLVCLQDAGAHGLVAGGEVRLDGMATWTPWELAAAVDAPLRRRDGLLPEHPAYVIYTSGSTGKPKGVPISQASICHFLRSENEVLGVRHGDKVYQGFSVAFDMSFEEIWISYLVGATLWVAPKMLTTDPEALPDALAREGVTVLHAVPTLLALFARDVPGLRIVNLGGEMCPEFLVQRWATPGRRLFNTYGPTETTVSASLAELLPGQPVTIGTPLPNYGMLIRGEDGAVLPQGQTGELCITGPGVAGGYLGRPELTAEKFLANPRPSGEHDTRMYRSGDLARIDENGQIQCLGRSDDQVKVRGFRVELGEIEAALYRQAGVGAAAVVLRDLAGIDQLVAFLTPEGDVRLDPHALRAALAAELPAYMIPARFELVAEVSRLTSGKIDRKALKARELATASEPSGEDDVPVSAGEQALFEALRPLFPGQPLRLASDFFRDLGGHSLLAARLVSSLRTHPQFSALTMHELYQHSVLGALAARLDALALASDEVQAPAAEAAEVERAPQWRRWACGLAQLAVLPLLIGVRMLIWLTPFFTYHYFTGDEGDSVWRAVALSIASYLACNLLSFGVAVVCKWGILGRLKAGRYPLYGWTFYRWWLVDRILDIPPAHLLAGSPLQAWYLRALGARIGRDTAISRISVRAPDLLTVADGASIGAAVNLENFEVRGAHWEVAPIALGANAYVGSYAVVQGDVVIEDDGRLEGLSSLPAGARIPAGQIWTGAPARHDSQARAPELPARPAREGRWARLDVLAYAAGGTLIAALFFMPVFPSFVLIDWIDARWLDLMGSRVSWPYAFLVYLLLALPASALLLLLTVLVSALLRWTLLPRLASGRWPVYGQIYLRRWLTNQIQESSLSVLHGLYASIYAGTWYRLLGARVGRGTEISTAMGIVPDMLTLGRDSFIADGVMLGDEEIDRGWMTMRPTVIGNRSFVGNGAYVPDGSVLPDDVLIGVQSRAPANARMASGQTWLGNPPLALPAREQAAGFPEHLTFRPSLGRKVARGAVELMRMILPLAVVIAVGYLTVMKVIPIAAREGFLAAFDELMLAGVLYGVGTFLFLVLLKWLLVGRYRPRAEPMWTPFVWKSEAVTSLYESIAVPNFFNFLRATPWLPLALRCMGARIGKRVFMDTTDVTEYDCVSIGDDAVMHAWSGPQTHLFEDRVMKIGPVRIGHGVNVGPRSTILYDTRVEDGARLGPLTLVLKGESIPAGQSWMGSPATPWTRQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043820_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043820_3

4497408-4497510

Orphan

Consensus_repeat	Method
TTTTCATCGCCGAGCCGCCTCAAGAT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043820_3

>merge|NZ_CP043820|3|4497408-4497510|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGATGAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCCTTTTCATCGCCGAGCCGCCTCAAGAT

>NZ_CP043820|3|3|4497408-4497510|CRISPRCasFinder
TTTTCATCGCCGAGCCGCCTCAAGAT	GAAAAATGCCCCCTCGGGGGGCAGCAAGCCGAAGGCGCGGCGTGGGGGCCC
TTTTCATCGCCGAGCCGCCTCAAGAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043820.1\|WP_112957829.1\|4497527_4498493_-\|DUF4892-domain-containing-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP043820.1\|WP_006387144.1\|4489863_4490847_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP043820.1\|WP_006384576.1\|4504573_4505464_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP043820.1\|WP_104413216.1\|4498645_4499557_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176149
NZ_CP043820.1\|WP_006387149.1\|4483544_4484540_+\|NAD(P)H-quinone-oxidoreductase	unknown	unknown	gnl\|CDD\|176180
NZ_CP043820.1\|WP_026383342.1\|4506522_4507725_+\|DUF2863-family-protein	unknown	unknown	gnl\|CDD\|371362
NZ_CP043820.1\|WP_006387139.1\|4494651_4497357_+\|aconitate-hydratase-AcnA	unknown	unknown	gnl\|CDD\|236445
NZ_CP043820.1\|WP_081247790.1\|4501186_4502269_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|185090
NZ_CP043820.1\|WP_006387141.1\|4492412_4493300_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187627
NZ_CP043820.1\|WP_006387148.1\|4484536_4485304_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235546
NZ_CP043820.1\|WP_020928792.1\|4502268_4503798_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP043820.1\|WP_006387140.1\|4493417_4494347_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP043820.1\|WP_149895684.1\|4505504_4506335_-\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_CP043820.1\|WP_049051246.1\|4487851_4488826_-\|pirin-family-protein	unknown	unknown	gnl\|CDD\|224655
NZ_CP043820.1\|WP_024069797.1\|4503833_4504538_+\|siderophore-interacting-protein	unknown	unknown	gnl\|CDD\|99790
NZ_CP043820.1\|WP_053497037.1\|4507734_4508850_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	unknown	unknown	gnl\|CDD\|378385
NZ_CP043820.1\|WP_080747578.1\|4490904_4492416_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|236215
NZ_CP043820.1\|WP_149895347.1\|4499606_4501136_+\|efflux-transporter-outer-membrane-subunit	unknown	unknown	gnl\|CDD\|273830
NZ_CP043820.1\|WP_006387147.1\|4485365_4487567_-\|TonB-dependent-receptor	unknown	unknown	gnl\|CDD\|238657
NZ_CP043820.1\|WP_006387145.1\|4488944_4489853_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|184959

Protein	Function_ID	Function_description	E-value
NZ_CP043820.1\|WP_112957829.1\|4497527_4498493_-\|DUF4892-domain-containing-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	5.00717e-40
NZ_CP043820.1\|WP_006387144.1\|4489863_4490847_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	3.3317e-127
NZ_CP043820.1\|WP_006384576.1\|4504573_4505464_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.94943e-47
NZ_CP043820.1\|WP_104413216.1\|4498645_4499557_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176149	cd08460, PBP2_DntR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.28355e-69
NZ_CP043820.1\|WP_006387149.1\|4483544_4484540_+\|NAD(P)H-quinone-oxidoreductase	gnl\|CDD\|176180	cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase. PIG3 p53-inducible quinone oxidoreductase, a medium chain dehydrogenase/reductase family member, acts in the apoptotic pathway. PIG3 reduces ortho-quinones, but its apoptotic activity has been attributed to oxidative stress generation, since overexpression of PIG3 accumulates reactive oxygen species. PIG3 resembles the MDR family member quinone reductases, which catalyze the reduction of quinone to hydroxyquinone. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP043820.1\|WP_026383342.1\|4506522_4507725_+\|DUF2863-family-protein	gnl\|CDD\|371362	pfam11062, DUF2863, Protein of unknown function (DUF2863). This bacterial family of proteins have no known function.	0
NZ_CP043820.1\|WP_006387139.1\|4494651_4497357_+\|aconitate-hydratase-AcnA	gnl\|CDD\|236445	PRK09277, PRK09277, aconitate hydratase AcnA.	0
NZ_CP043820.1\|WP_081247790.1\|4501186_4502269_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|185090	PRK15136, PRK15136, multidrug efflux MFS transporter periplasmic adaptor subunit EmrA.	7.10952e-104
NZ_CP043820.1\|WP_006387141.1\|4492412_4493300_-\|SDR-family-oxidoreductase	gnl\|CDD\|187627	cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR. TTER is a peroxisomal protein with a proposed role in fatty acid elongation. Fatty acid synthesis is known to occur in the both endoplasmic reticulum and mitochondria; peroxisomal TER has been proposed as an additional fatty acid elongation system, it reduces the double bond at C-2 as the last step of elongation. This system resembles the mitochondrial system in that acetyl-CoA is used as a carbon donor. TER may also function in phytol metabolism, reducting phytenoyl-CoA to phytanoyl-CoA in peroxisomes. DECR processes double bonds in fatty acids to increase their utility in fatty acid metabolism; it reduces 2,4-dienoyl-CoA to an enoyl-CoA. DECR is active in mitochondria and peroxisomes. This subgroup has the Gly-rich NAD-binding motif of the classical SDR family, but does not display strong identity to the canonical active site tetrad, and lacks the characteristic Tyr at the usual position. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.14208e-110
NZ_CP043820.1\|WP_006387148.1\|4484536_4485304_+\|SDR-family-oxidoreductase	gnl\|CDD\|235546	PRK05653, fabG, 3-oxoacyl-ACP reductase FabG.	4.98682e-91
NZ_CP043820.1\|WP_020928792.1\|4502268_4503798_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.39588e-126
NZ_CP043820.1\|WP_006387140.1\|4493417_4494347_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.03799e-56
NZ_CP043820.1\|WP_149895684.1\|4505504_4506335_-\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	4.76128e-119
NZ_CP043820.1\|WP_049051246.1\|4487851_4488826_-\|pirin-family-protein	gnl\|CDD\|224655	COG1741, COG1741, Pirin-related protein [General function prediction only].	2.4993e-36
NZ_CP043820.1\|WP_024069797.1\|4503833_4504538_+\|siderophore-interacting-protein	gnl\|CDD\|99790	cd06193, siderophore_interacting, Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Because flavins such as FAD can exist in oxidized, semiquinone (one-electron reduced), or fully reduced hydroquinone forms, FNR can interact with one and two electron carriers. FNR has a strong preference for NADP(H) vs NAD(H).	7.80577e-39
NZ_CP043820.1\|WP_053497037.1\|4507734_4508850_+\|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP	gnl\|CDD\|378385	pfam10093, EarP, Elongation-Factor P (EF-P) rhamnosyltransferase EarP. This entry includes family members such as EarP enzymes which are essential for post-translational activation of elongation factor P(EF-P). It was identified as EF-P arginine R32 specific rhamnosyl transferase in Shewanella oneidensis using dTDP-beta-L-rhamnose as donor substrate. This was further confirmed for Pseudomonas aeruginosa, Pseudomonas putida, and Neisseria meningitidis. As for S. oneidensis and P. aeruginosa, EarP enzyme acts as an inverting glycosyltransferase, thus mediating the formation of an alpha-L-rhamnosidic linkage. Structural analysis show that EarP is composed of two opposing domains with Rossmann folds, thus constituting a B pattern-type glycosyltransferase (GT-B) and provide basis for arginine glycosylation by EarP. Mutational analysis of efp and earP genes, resulted in a substantial decrease in the production of rhamnolipids and pyocyanin (important factors for colonization and invasion during infection) of P. aeruginosa. Collectively this indicates that EarP and EF-P are essential for P. aeruginosa pathogenicity.The protein family is also annotated in the CaZy Database as GT104.	3.69795e-176
NZ_CP043820.1\|WP_080747578.1\|4490904_4492416_-\|AMP-binding-protein	gnl\|CDD\|236215	PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP043820.1\|WP_149895347.1\|4499606_4501136_+\|efflux-transporter-outer-membrane-subunit	gnl\|CDD\|273830	TIGR01845, Outer_membrane_protein_OprM, efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family. Members of this model comprise a subfamily of the Outer Membrane Factor (TCDB 1.B.17) porins. OMF proteins operate in conjunction with a primary transporter of the RND, MFS, ABC, or PET systems, and a MFP (membrane fusion protein) to tranport substrates across membranes. The complex thus formed allows transport (export) of various solutes (heavy metal cations; drugs, oligosaccharides, proteins, etc.) across the two envelopes of the Gram-negative bacterial cell envelope in a single energy-coupled step. Current data suggest that the OMF (and not the MFP) is largely responsible for the formation of both the trans-outer membrane and trans-periplasmic channels. The roles played by the MFP have yet to be determined. [Cellular processes, Detoxification, Transport and binding proteins, Porins].	2.43746e-65
NZ_CP043820.1\|WP_006387147.1\|4485365_4487567_-\|TonB-dependent-receptor	gnl\|CDD\|238657	cd01347, ligand_gated_channel, TonB dependent/Ligand-Gated channels are created by a monomeric 22 strand (22,24) anti-parallel beta-barrel. Ligands apparently bind to the large extracellular loops. The N-terminal 150-200 residues form a plug from the periplasmic end of barrel. Energy (proton-motive force) and TonB-dependent conformational alteration of channel (parts of plug, and loops 7 and 8) allow passage of ligand. FepA residues 12-18 form the TonB box, which mediates the interaction with the TonB-containing inner membrane complex. TonB preferentially interacts with ligand-bound receptors. Transport thru the channel may resemble passage thru an air lock. In this model, ligand binding leads to closure of the extracellular end of pore, then a TonB-mediated signal facillitates opening of the interior side of pore, deforming the N-terminal plug and allowing passage of the ligand to the periplasm. Such a mechanism would prevent the free diffusion of small molecules thru the pore.	3.73232e-108
NZ_CP043820.1\|WP_006387145.1\|4488944_4489853_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|184959	PRK14997, PRK14997, LysR family transcriptional regulator; Provisional.	1.1118e-62

>NZ_CP043820.1|WP_006387139.1|4494651_4497357_+|aconitate-hydratase-AcnA
MPHNTLDTLKNFKIGNKSCQYYSLPALGKALGIDVQRLPVSIRIVLESVLRNCDGKKVTEEHVRQLANWQANAKREDEIPFVVARVVLQDFTGVPLLADIAAMRSVADKMGKSPKSIEPLVPVDLVVDHSVMIDYFGTKNALDLNMKLEFKRNQERYQFMKWGMQAFDTFGVVPPGFGIVHQVNLEYLARGVHQDKKNNVYYPDSLVGTDSHTTMINGIGVVGWGVGGIEAEAGMLGQPVYFLTPDVVGVELKGKLRGGVTATDLVLTITEMLRREKVVGKFVEFCGEGTASLSVAERATIGNMAPEYGATMGFFPVDGRTIDYFRGTGRTEDEIAAFEAYFKAQDMFGVPAAQDISYTKLLTLDLSTVAPSLAGPKRPQDRIEIGNVKSTFIDLFSKPVAENGFNQPAEKLQQTFTTSTGTKVKNGDILIAAITSCTNTSNPSVLLAAGLLAKKAVEAGLKVPKHIKTSLAPGSRVVTEYLTKTGLLPYLEKLGFDVAAYGCTTCIGNAGDLTPDLNEVITSNDLVCSAVLSGNRNFEARIHPNIKANFLASPPLVVAYALAGTVTRDLMTEPVGRGKNGDIWLGDIWPTTEEVEALLKYALDPKAFEANYGQVKSNPGKLWENIKGVTGETYNWPDSTYIAEPPFFEGFGMTPGAMPTVKNARALGVFGDSVTTDHISPAGSIKETSPAGKWLKENGVMKADFNSYGSRRGNHEIMMRGTFANVRIKNLMIPARPDGSRFEGGETLFQPTGEQMSIYDAAMKYVAAGTPTVVFGGEEYGTGSSRDWAAKGTQLLGVKAVITRSFERIHRSNLVGMGVLPLQFKGSDSVQSLGITGEETYDISGLENGIKPMQDVTLTITRKDGSKQDVTLLLRIDTPIEVDYYQHGGILPFVLRQLLAA
>NZ_CP043820.1|WP_006387140.1|4493417_4494347_+|LysR-family-transcriptional-regulator
MTTPPVLDLNLIQLFVTIVEAGTLSEAALRQGVTRSHVSRNLQKLERAFGAQLIRRTTRRLELTHEGSVLYDHGARMAREVESARHALQKLGAEPTGHVRLSLPTGLGELDMLRPLLVRFALEHPSLSLRVLFSNRVSDLISSEIDVALRAISVPPQDYVARELGRIKWHLCAAPEYLARMGMPAHPRDLGRFDFLGPPGPRPQATLRLRGKGQPHEVKLATRLQSEYFPFLAQAAREGAGVALLPAYIVRPDLEAGRLLQVLPAYQAEGPGDKLYILTSPTPYPSSAQRALVDFLKRELEPLLRTFLA
>NZ_CP043820.1|WP_006387141.1|4492412_4493300_-|SDR-family-oxidoreductase
MFRADLFQGQRILITGGGTGLGYAMARQLAALGATVHLCGRRLAVLEQAAQALRGESGGQVHVHPVDIRDAGAVDAMVARIWDQHGGLDALVNNAAGNFISPTEKLSERGFNAIADTVFRGTFYMTQAVGKRWIGSGASGAVVSIVVTWVWTGSPFVVPSAMSKAGIDAMTKSLAVEWGRRGIRLNAIAPGVIPTEGASARLRPNDSGTDALVKQNPMQRLGQGQDIGELAAFLLAPGNDWINGQTIALDGGDYLANGAYFKQYFDWSDDDWAAARAAIEARTAADKAQRSAGQA
>NZ_CP043820.1|WP_080747578.1|4490904_4492416_-|AMP-binding-protein
MSASVTQGAGRIIAGDCQLDRAALMRRGEQVAAGLAAMGIGQGDVVAVLLRNGMPYLEIIQACKRLGCYYCPINWHYTPDEVAYLVRDSGARLLIAEEDLWQAARAALPADLPSRRVGAAAVSEDYASWREAQAPYDGPVVAPRGHMAYTSGTTGRPKGVVRAPFPLDQLAQRLAAVEAVVEQAYGLRSGCRALLPAPVYHSAPSVFAQVALRVCETLVLAPRFDPLEVLRLIERHRIDTVYLVPIMYVRLLKLDPAQRAAFDLSSLRFVASTGAPCAPALKRAMIDWLGPVIHETYASSEAGMVTVIDSHEALARPGSAGRPIGGAQIRIYGDDGALCAPGQIGRIHVRQPAYADFTYRNNPEARSRIERDGLIGLGDLGYLDDDGYLFVCDRESDMVISGGVNIYPAEIEHHLTQYPGVADCAVFGVPDDEFGERLLALVQPAADTALAPEEVLRWLSTRVARYKVPRELRLRQTLPRDDNGKIAKRRLRDAFWAERDRKV
>NZ_CP043820.1|WP_006387144.1|4489863_4490847_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MFMKNSGIGRAAAALLLCMAAASPALAAFPERPVKLVVPYTPGGAADLLSRVLAERLSQELAQPVVVENKPGANTMIAATQVARAQPDGYTLFLASNASMVLNPMLYRKISYDAQRDFRVLSVVAELPLVVVANNSVPASTLAQFVDYARARPGKLNYASVGIGNPLQLATELLKSRTGIDVAHVPYNGSAPALSSLMANDTQLMVDVISTSLPLVRENKIKALAVTGAQRLPVLPDVPTVAESGFAGFRAATWFGVAVPRGTPPAEADRLREAVAAVMRQADFRDRFQAQGLVIQAPRGQAEVDAYLAEDRERWNGVIQANHIRLD
>NZ_CP043820.1|WP_006387145.1|4488944_4489853_+|LysR-family-transcriptional-regulator
MHSYIHHLDDLLLFTEVVEKGGFSAAARVLNMQRSKLSRRVAELEARLGLRLLQRNTRRVSLTPMGEQIYVHALAMAREARSAFDLAAAMGDTPSGLLRMTAPSALAVTLLGELVARFCLQHPGVRVLLDTRDQVIDLVGEGYDLAFRAQGASLTDSRLVARELAPVPLILVAAPAMARAAPRHPRDLNALPLLAHATQDSPQSWHFVGPAGEAESIEFRPRCLSSNLAALREMARAGLGVALLPHYLCAGSLAKGDLAQLLPAWRAAPARIYAVMPARRGAPLALRRFLDFAAAEMPALLA
>NZ_CP043820.1|WP_049051246.1|4487851_4488826_-|pirin-family-protein
MTIRLSPPVARPFEPEGDICSYRHFRHSDFPQGMSPLVLVDHFIMTGPAVAPHPHAGISTVTLLLEDTQGGLRIRDSLDNEHEARAGDLHWTVAGRGIVHGHDLVGAARLNGLRLYVNLPARLKSMPPSATLVRGWEMPVLQSDAGRVRVVSGRYDGWDAPLATPEPLLILDGWLRPGASRLVPLPAGWNAWLYAAQGELGVRARHETTPPPRPPVEAAPVIPAARFRPAGRAATTGRRAADPDFAVLPPGAALTATADRDGFLQLLAAGAPAHFILVAGAAIDEPVIQRGPFVMTDARALAQAVAAYEAGDFGQLRQESGVPG
>NZ_CP043820.1|WP_006387147.1|4485365_4487567_-|TonB-dependent-receptor
MKIRTLACVVAALPYTAIVHAQSAAPAADGSVVSMEAIKVEASADASAGGLAQPYAGGQVARGGRVGVLGTQDIMSTPFSVTSYTNELIQDKQARSVGDVLQNDAGVRVARGFGNFQESYFIRGFILSSDDVAYNGLYSLLPRQYIATELFERVEVLRGASAFLTGAAPSGGGIGGVINLVPKRAPNEPLTRFTTGVSSGGQFSVSTDIARRFGPDDSTGIRLNVANRSGDTGIDDEHSRTSLVSLGLDWRSADTRLSADIGWQENKLKRARPNVTLRGVTSVPDAPDASSNYAQPWSYSNERDVFGTVRAEHDFSDKLTGWAAFGMRRSDEANSLGNVTVTNGSTGDGNFYRFDNTREDSVNTGELGLRAKVRTGPVGHEFVASASFFDLKKKNAYVMDYLNTFPTNIYDPVSYDRPAYGSKALFGNDLDDPALQGRTRLSSYAFGDTMSFLDDKVLLTLGIRHQRLSQRDYAYNTGKEQSAYDASRNSPAAGIVFKVAPSVSLYANYIEALVAGDTAPQTANGKPVPNAGQSLQPYVSKQKEIGVKYDGGGLGAGLALFSTDKPRAAYNASNAFTASGKDRHQGIELTVFGEPVNRVRVLGGMTFLDAKQRSTGNSAIDGNRVIGVPRFQANLGAEWDIPGVQGLTVDGRVVYTGASYADDANTLKVPGWTRFDAGLRYMMDVDGHVVTLRARVENIANRNYWSSVGGYPGNGYLVLGGPRTFSLSASMDF
>NZ_CP043820.1|WP_006387148.1|4484536_4485304_+|SDR-family-oxidoreductase
MSARFQDQVIIVTGAVGGIGSAIVEGFLAEGGKVGLIDFNSQGGQAYEKELKKRGHAVSFVHADVSHFDQCQAAYERITRDLGPATILVNNVGISPKTDGRALKVWEMTPGEWDKVVAVNLNSVFYMTHLATPHMVRQRQGRVINMSSVAGKAYCDIVAAHYAATKAALLGLTRHWAAELGEHDVTVNGLAPGRISTPLLKSVPKEINDAVAEVTALRRLGTPEEVADACLFFASDQARFVTGQVLDVAGGWLMT
>NZ_CP043820.1|WP_006387149.1|4483544_4484540_+|NAD(P)H-quinone-oxidoreductase
MSLRCTFIDHGTGGAPDCLRLAEREMAAPAGRQVLIEVVYAGVNRPDVLQRSGSYPPPPGASPYLGLEVAGTIVAVGPDATRWQVGDRVCALTPGGGYAQYCLADERHCLPVPRGLDLLSAAAIPENYFTVWTNVFERARLAAGEKFLVHGGSSGIGLTAIQLARAFGAEVWTTVGNQEKAEACLKAGAHHAVLYRDTDFEADIRQATGGQGVDVILDMVGGAYINKNIRLLAVNGRLVQIAFLEGSKAEIDALPIMTKRLSFTGSTLRPRSDEDKGAIAQALADKVLPLMEQGRCLPLIHQVFPLEQAAQAHALMESSKHIGKIMLKVRA
>NZ_CP043820.1|WP_112957829.1|4497527_4498493_-|DUF4892-domain-containing-protein
MKAHIVKVASLAIVAATLTAASSAWAGDVEGSRDHPALTRFEGAEIRAYEHKDYDEALMPDRPVARESEAKGLTLEGKLTRIAYRIDGKKSALEVYRNYQGALQAGGFKTVFECKGDEQCGGDFQSFVLNSGKVSQPGQGDAAFGGKYYVVLAKKEAPTGDIYVFLDVMEDSSNNITPVFQQVIETKPMQTGQVKVLDMAAMQKSLAESGRVAVYGVYFDTDKAEVKAESKAALDEMGKLLNANPKLKVYVVGHTDNQGTLAGNLELSQKRADAVVKALEADYKIPAARLSARGVASLAPVAANDAEAGRAKNRRVELVAQ
>NZ_CP043820.1|WP_104413216.1|4498645_4499557_-|LysR-family-transcriptional-regulator
MRLVQLMDLNLLVALDALLAEGSVTGAAERLQLSVPAMSRTLERIRRMMGDPLFVRAGRGLVPTPRAEALREPVRALVEQARELLAQDAAFDLKTLRRVFTIRADDGAVSTLGPALLDTLAKEAPRVTVRFISQGKQDVLSLREGAIDLDIGVIEDMGPEIVRQRLFPDRFVAVFRPANPLARHRKLTPERFARARHATVSRRGVLSGPVDIELGKVGLARHISAVTHSFAEALAITRKSDLVATVPDLLTLHLRDDLQMRALPFDTPAVTISQAWHPRFNEDPAHRAIRQMVHRISLAISGR
>NZ_CP043820.1|WP_149895347.1|4499606_4501136_+|efflux-transporter-outer-membrane-subunit
MAASSTRKHAMIHSTRYRPDARPARRMRLRHAPLAAALAALVAVAGCASHDGLRPAGKPLDLAALDAGQDIAAAVRDTADDAAPWWRAWGDDQLDRLMADALRQAPGVRAAQARLGQAEAVFGSVDAKRQPTLDGSATITADRYPGHYTYGAPYADNTGGSGSLLASLRLRLDIWGKWRALADAARLDAEGAALAHADAQLALQQGIAAAYLRLDAAFRLHELARQQRERQRQALELHQTRRQAGLGSDAPVADARGRLARMDAEVERLDREIARQRHALAALAGQAPGYGDALRRPRLALRADPALPAALPARLLGLRPDVLAQRKRLDAADRRIEAAKAEFYPDIDLKAFAGLQSLGLSHLLQGNSLAAGIGPALTLPIFDGGRLRAGLRDRIAGYDLAVADYDAAVVRALQEVADGLAGMAQARARRDAARVSLREAGTLARLQAVRASRGLSARQDEIDTDLERLRADSELAAADLDLGLARTALAGALGGRWSPSQSSDNEALK
>NZ_CP043820.1|WP_081247790.1|4501186_4502269_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MLAGGATLLAGAGWAAWTFLAGAATQTTDNAYVNGHVVAITPQVGGAVSAIWADNADRIRAGQTLVEVDPADTQIALAGARADLARARRRVQALFASRDQAGAEVARRQAELDRAQADVSARRGIAAQGAITSEEARHAADALNAARAALAVAQAAERAAQAQVDGVTPDTHPDVTLAQARLRAAALDAQRTTIRAPVGGMVAQRSVQLGKHVAIGDKLMAVVPLDQMWIDANFKEIQLAGICPGQPAVVTVDAHGAKVRYRGRVGDVMAGSGSAFALLPSQNATGNWIKVVQRVPVRINLDPKELADHPLRIGLSAEVTVDTARCDPAQAGAARGETTDIYRQQRQAADTLAQAGQGLQ
>NZ_CP043820.1|WP_020928792.1|4502268_4503798_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MSAAPRPIEPMTGLPRVVAAVAISLASFMAVVDITIANVSVPTISGNLGVSPEIGEWAITFFAIANSICIPLTGWLSRRLGQVRLFVLSVAAFTLASVLCGVAQNFESLLAFRVLQGMVSGPIVPLSQALLVAIFPPDKRTLALSMWAMTNMAGPVAGPVLGGWLTDDFSWPWIFLVNAPVGIAVVAVTATMFRGRDTPSTRLPVDLRGLILLAVAIGCLQLTLDRGRTLDWFASPFIVTTALLSALGFVFLVIWELGEAHPIVDLSLFRHRNFAMGTLAVAVGFGLYFAALVLIPLWLQTDMRYTATWAGLATAPMGVFGILLAPLLGRWVQRGDARVFASLAFVAWSLVAWWRASMTTDVGVGLISLACLLQGIGIGLFLTPLVSLSLAGLPPERIAAASGLQTAIRMMAGSLVASLASTYWDERSRYYQNVLVDSATPARPAVQDTLNALAGAGLDEPQSWGVIWNGLKTQADMLALNDFFLWSSLAFALSIALVWLARHPRAAKA
>NZ_CP043820.1|WP_024069797.1|4503833_4504538_+|siderophore-interacting-protein
MQPFSLPRRDVPCIVLRARDVARDMRRLTLGGPELSAWLARPGVDQPGAWVKVFPPGVPGRAYTLRGIDFEASSVEIDFVVHGDAPGTVSEWARRARPGDAVSIAGPRDGGFSLLADTRWVWLGADASAWPAASRIIESLPGGIQVLGVRHPAGDDDWPAIASARAPQWAARSLPPGGDEPSAPAPDGPGQVWLAGQAAWVKAWRAHWLQRLRFDPARLSAKGYWKAGEQDYKE
>NZ_CP043820.1|WP_006384576.1|4504573_4505464_+|LysR-family-transcriptional-regulator
MKKELDRMRDMALFVQVAALGSLTRAAESTGVPASTLSRRISEFESQIGVKLLHRSTRRLALTDIGQRYLERITDVVDRARAISGELEEEMGRPTGHLRVCAPVDFNAYFPEAALADYCASHPGVRFELHCSAQLPDLATEPYDICIATTEPPQASRMVRRRIGMAEYQLYAAPAYLRAYGVPAHPAELARHRCVVMPDSESGLALTDGNASAQVALAPLLVLNNQLAVENLLRDGLGIGPLTRGRADALVREGALAPVLPGWTLPPRPILALTASRALPARVRGFIDLLVARVVT
>NZ_CP043820.1|WP_149895684.1|4505504_4506335_-|dioxygenase
MADWNRPTIKASIFPGGAAMRWPTLFVSHGSPMLAVEPGATGPALAAWSRSLGRKPGAILVVSPHWMGHGLALSTRDRQVAWHDFGGFPPELYTLQYAAPGSPELAACVQALLAEGGIAADRDPRRPLDHGAWVPLRYLYPEVDVPVVQLSLDMGRDAAGQLELGRALAPLRDEDVLIIGSGSLTHNLRDVRMPQDAPPAPYVPAFQAWYADRLAAHDVPALLDWQARAPGAAQAHPHDDHLMPLYVALGAGGARATRLTDEISYGALAMDAYAFD
>NZ_CP043820.1|WP_026383342.1|4506522_4507725_+|DUF2863-family-protein
MARSRSQSAPRLTRDATRLITLAQSLNRSGSRVEDVYWENQLGEAIPKLLKAGQDAPLEAALDHLAQGDVGAYEVLIEQAETLSESMKIDKNGVRYDILLIVAPVVAWTRYAIPTGPVPAGAQQALLAQLHGHVLSSQARSALMPHLVSVDQMPRTFSETWQWLQRLGSQALGAETTKPALNTEVETANMLADTRYIVAAVAVPEFAPVFRWQEQIGEADASRDACLAQWAAQAQPTLAGLLPGCGFEALLPDAYYVSNREADRRVRPLSLRAAISWLEGAVSLDASQLRAVIAGCGESRVDEYRVSFTARNSNDVYYGCVWPLYGREEDLPADEGQPDVVDEIAALLKEYGVSDVRRIPGVLPPEYCEDCGAPYFPNPLGELVHAELPEDAEAAPAKFH
>NZ_CP043820.1|WP_053497037.1|4507734_4508850_+|elongation-factor-P-maturation-arginine-rhamnosyltransferase-EarP
MQADIFCRVVDNYGDIGVCWRLARRLAHGHGWEVRLWVDDLASFARIQPGIDAGLARQTFNGVDIVRWSDAPDPALGARDVVIEAFACDPPEPFLDSMRQRHPAWINLEYLSAEAWVESCHGLPSQRPDGLVKHFYFPGFTPATGGLLREPGLSAERDAFQADTAAQDTFLRGLGVAEAHLSLRHNGARTMSLFCYPDAPVDGLARALAADPRPALLLAPEGVAPGLEAACAMPGGPAVARLPFVAQPDFDRVLWCADLNFVRGEDSFVRAAWAARPLVWQIYPQDENIHLEKLDAWLARYPAPETATALMRAWNQPGAGAATAAALAAALAPPAWQAWARAARDWDAAQAARPDLAENLAGFCAELAKKR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043820_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043820_4

5906407-5906494

Orphan

Consensus_repeat	Method
AGGGGGCGACACCTGCAGACCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043820_4

>merge|NZ_CP043820|4|5906407-5906494|CRISPRCasFinder
AGGGGGCGACACCTGCAGACCGGAGAACGAGATCCACCCCGTACGCGCTCGCGCGCGCCCCCTCAAGGGGGCGACACCTGCAGACCGG

>NZ_CP043820|4|4|5906407-5906494|CRISPRCasFinder
AGGGGGCGACACCTGCAGACCGG	AGAACGAGATCCACCCCGTACGCGCTCGCGCGCGCCCCCTCA
AGGGGGCGACACCTGCAGACCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043820.1\|WP_020926101.1\|5907374_5908157_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|131484
NZ_CP043820.1\|WP_006390043.1\|5905030_5906371_+\|short-chain-fatty-acid-transporter	unknown	unknown	gnl\|CDD\|224942
NZ_CP043820.1\|WP_020926099.1\|5909013_5909658_+\|CoA-transferase-subunit-B	unknown	unknown	gnl\|CDD\|188219
NZ_CP043820.1\|WP_053499537.1\|5892904_5893732_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP043820.1\|WP_006390033.1\|5910350_5911130_+\|3-oxoadipate-enol-lactonase	unknown	unknown	gnl\|CDD\|131480
NZ_CP043820.1\|WP_024070579.1\|5909998_5910295_+\|YciI-family-protein	unknown	unknown	gnl\|CDD\|183800
NZ_CP043820.1\|WP_070541598.1\|5895160_5896051_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176112
NZ_CP043820.1\|WP_070541595.1\|5900720_5903567_+\|phosphoenolpyruvate-carboxylase	unknown	unknown	gnl\|CDD\|234570
NZ_CP043820.1\|WP_006390045.1\|5903912_5904848_+\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|235707
NZ_CP043820.1\|WP_006390050.1\|5897876_5899535_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP043820.1\|WP_047992014.1\|5896717_5897899_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_CP043820.1\|WP_149895571.1\|5912354_5912723_-\|PsiF-repeat-family-protein	unknown	unknown	gnl\|CDD\|183165
NZ_CP043820.1\|WP_006390029.1\|5913101_5913437_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043820.1\|WP_049053005.1\|5896175_5896721_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP043820.1\|WP_006384641.1\|5894175_5895213_+\|2-isopropylmalate-synthase	unknown	unknown	gnl\|CDD\|235154
NZ_CP043820.1\|WP_024070581.1\|5911133_5912174_+\|cyclase	unknown	unknown	gnl\|CDD\|377240
NZ_CP043820.1\|WP_024070575.1\|5906595_5907324_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NZ_CP043820.1\|WP_006390049.1\|5899835_5900549_-\|7-cyano-7-deazaguanine-synthase-QueC	unknown	unknown	gnl\|CDD\|284031
NZ_CP043820.1\|WP_149895570.1\|5908327_5909017_+\|3-oxoacid-CoA-transferase-subunit-A	unknown	unknown	gnl\|CDD\|131482
NZ_CP043820.1\|WP_006390036.1\|5909710_5909986_+\|muconolactone-Delta-isomerase	unknown	unknown	gnl\|CDD\|213786

Protein	Function_ID	Function_description	E-value
NZ_CP043820.1\|WP_020926101.1\|5907374_5908157_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|131484	TIGR02431, p-hydroxybenzoate_hydroxylase_transcriptional, beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions].	6.91897e-126
NZ_CP043820.1\|WP_006390043.1\|5905030_5906371_+\|short-chain-fatty-acid-transporter	gnl\|CDD\|224942	COG2031, AtoE, Short chain fatty acids transporter [Lipid metabolism].	6.48511e-138
NZ_CP043820.1\|WP_020926099.1\|5909013_5909658_+\|CoA-transferase-subunit-B	gnl\|CDD\|188219	TIGR02428, 3-oxoadipate_CoA-transferase_subunit_B, 3-oxoacid CoA-transferase, B subunit. Various members of this family are characterized as the B subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The A subunit represents a different clade in pfam01144.	1.4236e-113
NZ_CP043820.1\|WP_053499537.1\|5892904_5893732_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	1.46893e-40
NZ_CP043820.1\|WP_006390033.1\|5910350_5911130_+\|3-oxoadipate-enol-lactonase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	3.00804e-106
NZ_CP043820.1\|WP_024070579.1\|5909998_5910295_+\|YciI-family-protein	gnl\|CDD\|183800	PRK12863, PRK12863, YciI-like protein; Reviewed.	7.0573e-45
NZ_CP043820.1\|WP_070541598.1\|5895160_5896051_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176112	cd08420, PBP2_CysL_like, C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.38062e-50
NZ_CP043820.1\|WP_070541595.1\|5900720_5903567_+\|phosphoenolpyruvate-carboxylase	gnl\|CDD\|234570	PRK00009, PRK00009, phosphoenolpyruvate carboxylase; Reviewed.	0
NZ_CP043820.1\|WP_006390045.1\|5903912_5904848_+\|3-hydroxyacyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|235707	PRK06130, PRK06130, 3-hydroxybutyryl-CoA dehydrogenase; Validated.	4.81432e-171
NZ_CP043820.1\|WP_006390050.1\|5897876_5899535_-\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.3146e-61
NZ_CP043820.1\|WP_047992014.1\|5896717_5897899_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.39132e-33
NZ_CP043820.1\|WP_149895571.1\|5912354_5912723_-\|PsiF-repeat-family-protein	gnl\|CDD\|183165	PRK11505, PRK11505, phosphate starvation-inducible protein PsiF.	4.98893e-19
NZ_CP043820.1\|WP_049053005.1\|5896175_5896721_+\|N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	2.75759e-61
NZ_CP043820.1\|WP_006384641.1\|5894175_5895213_+\|2-isopropylmalate-synthase	gnl\|CDD\|235154	PRK03739, PRK03739, 2-isopropylmalate synthase; Validated.	0
NZ_CP043820.1\|WP_024070581.1\|5911133_5912174_+\|cyclase	gnl\|CDD\|377240	pfam04199, Cyclase, Putative cyclase. Proteins in this family are thought to be cyclase enzymes. They are found in proteins involved in antibiotic synthesis. However they are also found in organisms that do not make antibiotics pointing to a wider role for these proteins. The proteins contain a conserved motif HXGTHXDXPXH that is likely to form part of the active site.	3.13699e-06
NZ_CP043820.1\|WP_024070575.1\|5906595_5907324_+\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	1.12143e-68
NZ_CP043820.1\|WP_006390049.1\|5899835_5900549_-\|7-cyano-7-deazaguanine-synthase-QueC	gnl\|CDD\|284031	pfam06508, QueC, Queuosine biosynthesis protein QueC. This family of proteins participate in the biosynthesis of 7-carboxy-7-deazaguanine. They catalyze the conversion of 7-deaza-7-carboxyguanine to preQ0.	1.31463e-87
NZ_CP043820.1\|WP_149895570.1\|5908327_5909017_+\|3-oxoacid-CoA-transferase-subunit-A	gnl\|CDD\|131482	TIGR02429, 3-oxoadipate_CoA-transferase_subunit_A, 3-oxoacid CoA-transferase, A subunit. Various members of this family are characterized as the A subunits of succinyl-CoA:3-ketoacid-CoA transferase (EC 2.8.3.5), beta-ketoadipate:succinyl-CoA transferase (EC 2.8.3.6), acetyl-CoA:acetoacetate CoA transferase (EC 2.8.3.8), and butyrate-acetoacetate CoA-transferase (EC 2.8.3.9). This represents a very distinct clade with strong sequence conservation within the larger family defined by pfam01144. The B subunit represents a different clade in pfam01144, described by TIGR02428. The two are found in general as tandem genes and occasionally as a fusion.	1.53204e-129
NZ_CP043820.1\|WP_006390036.1\|5909710_5909986_+\|muconolactone-Delta-isomerase	gnl\|CDD\|213786	TIGR03221, muco_delta, muconolactone delta-isomerase. Members of this protein family are muconolactone delta-isomerase (EC 5.3.3.4), the CatC protein of the ortho cleavage pathway for metabolizing aromatic compounds by way of catechol. [Energy metabolism, Other].	1.34487e-55

>NZ_CP043820.1|WP_006390043.1|5905030_5906371_+|short-chain-fatty-acid-transporter
MNKLASFFTELMRKYLPDPFVFAIALTLLTVLLAMGIEGQGIGDVTRAWGKGFWSLLAFTTQMAVILAMGYVLATAPLTDRLLNRIVSHVHKPHTAIIVATLVGGIGSYLNWGFGLVIGGIVAKKLALKVKGVHYPLIIAAAYSGFTMYGLGLSASIPVLVATPGHPTAKQMGIIPLTETIFSVPMLITSLVIIVTLPLLNAWLHPKKGEKIVEVDPAIDRDANASNAAEDMLEKGTLASKLNNSRILSLLIGALGVAYVAFHFIDGGSLDLNLINFIILFLGIILLGTPAAYVAKLTEGIKTISGIILQYPFYAGIMAIMAASGLVTTISKVFVDVATPATLPFWGLISSFVINFFAPSAGGHWVIQGPFMIDAAREIGSALNQTTMAVMLGNAWNDLVQPFWILPALALSKLKLRDVMGYTVIMMLWVGVIHITAVLAWGYLTH
>NZ_CP043820.1|WP_006390045.1|5903912_5904848_+|3-hydroxyacyl-CoA-dehydrogenase-family-protein
MDTPLQNLAVIGAGAMGSGIAALFASKGLDVVLVDPMDGALDRARAVIERQLNVYAPGQVDAVMQRIRMAPGLDAAASCDLVIEAVPENLELKRGLFAQLDALCKPAAIFATNTSGLSINAIASAVARRDRFVGTHFFTPADVIPLVEVVRNDATSEDTVARVMATLRLGGKRPVLVRQDIPGFIANRIQHALAREAISLLEKGVASAEDIDEVVKWSLGIRLALSGPLEQRDMNGIDVHYAIASYLYKDLENRTEPSELLKSKVENGQLGAKSGQGFYTWSAERRERVLRDKSAALGELAAWLNAKAGDS
>NZ_CP043820.1|WP_070541595.1|5900720_5903567_+|phosphoenolpyruvate-carboxylase
MNASRPQSDSAEPLRHDIRLLGRLLGEVIAECEGKRVFDTIETLRRTAVKFRREGNAADGKLLEQRVKHLQGSDPNSVARAFSYFLHLSNIAEDRDQNRSQRARALAGDAPARGSLRDAVQTLGRQGVTPARIRRLLAEACVMPVLTAHPTEVQRKSTLDVHREIAAALTQRDQPLTPEELAELDAALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLQVIPRVYGDLSKLLNRDAKPFGAPPAPLEPFLRMGSWIGGDRDGNPNVDADTLERALLRQATVLFEHYLQEVHALGAELSITTLLIAVDPALLALAEHSGDDSPHRSDEPYRRALVGVYARLAATALRLTGQNLARRSTVAAQPYDTPQELSADLAIIAASLAAHHGAPIGRLRLAGLQQAVEVFGFHLATVDLRQSSDVHERALAELFSRAGVTHAGQPLDYLALDEDARVALLRAELAQARPLASPWIAYSEDTTRELAVLRAAAAGRQRYGRQAVRQTIVSHTETLSDLLEVMVLQKEAGLIAPAGQDIPPEDGLMVVPLFETIPDLQRGADIMAAWLDLPEIRERVKRAQNGAQEVMLGYSDSNKDGGFLTSNWSLYQAERALVDVFSSRHVRLRLFHGRGGSVGRGGGSSFDAILAQPPGTVAGQIRLTEQGEVIQSKYKDAEVGRWHLELLVAATLESSLAPRAQATSAEDAHMAQHGPAMSFMSEAAQRSYRGLVYDTPRFAEYFFAATPIAEIAGLNIGSRPASRKKGQRIEDLRAIPWGFSWAQCRLMLTGWYGMGSAIEAYLETGAPGAPRSQRGRLAQLREMARDWPAFRTLLSNMEMVLAKSDLAIAARYAQLVPQRALREKIFGMISAEHARTLAMLKLLTRRELLADNPALQASLRERFAYIDPLNYLQVDLIRRHRAAQKSPAAEADERVQRAIHLTINGIAAGLRNSG
>NZ_CP043820.1|WP_006390049.1|5899835_5900549_-|7-cyano-7-deazaguanine-synthase-QueC
MLNHQRRALVLFSGGQDSTTCLAWALDRYAHVETVAFDYGQRHRIELDARLNVLRDIRARFPQWAPRLGEDHLLDLKVLGQVGDTAMTSDRAIEMQANGLPNTFVPGRNLLFLTLAAALGYRRQLDVLVGGMCETDFSGYPDCRDDTIKAQQVALGLGLGSRVTIETPLMWIDKSETWALARSLGGDALVETIVEESHTCYLGERGARHAWGYGCGECPACKLRRAGWDKWQAQGGA
>NZ_CP043820.1|WP_006390050.1|5897876_5899535_-|EAL-domain-containing-protein
MESGFTQGSIIMNRSRIILIFDNEFAKQGISDSLEQIGFVLNPVSLQEPAPACQAGEIQVHLCLPRDLDITIGQLRARFAHSTIIAIRHIESPAVRINALLAGADSCYGANISYSEVAAAIQSAQRKLTLCQPPAAVGPRRPDAPPDPTAAEKSWRLCDNEWTLVSPAGPGVSLTPMERAVLKGMHAHAERLIRRADFAVASLDIPGNGRALDLVISRLKRKGAAAGLSIPIRSLRGKGYSFSAALAQDSAAGDGREPAAPRKEGGPVSPLLAAIQGDRLQFHYQPIVAASDLEIVGAEALLRWRAAGGETLGIDGLLREAGAPEVAQALISWGIRTIASDQARWRQAARGCGPAVNINISPQSFARRDVVGVILRDIAVCGLAPRDIRIELTEEAALHAASADIRCMLEEFTSRGIQVWLDDFGKGYNNLEWLSTLPLAGLKLDKSIVWSAARQADAQKVLASICQLARDLDIVTVAEGVETEAHCRAAREAGCDLLQGFLFFRPGTADELATALNAQCQRRDDVAWARDRGAPATAVCDGGAPFSPVPGQ
>NZ_CP043820.1|WP_047992014.1|5896717_5897899_+|MFS-transporter
MIAARAVVCLGLTQLVGWGVTFYLIGALGPDMAADLGWNPATIYGGFSCAIVVMALVSPLAGRAVDRWGGHRIMPTGAVVAAAGCILLAAAHGPVAYFAAWTLLGLGMRLCLYDAAFASLARAAGPAARRPMSQITLFGGLASTVMWPVGHALSDWLGWRGAVLAYAALALATLPLYLALPRTRYAAPAQAPGQGGAGLARNARERRLAGALYATIAMLTNFLAAGNAAHLIPLLSGLGLAKALAVNVAALWGIGQFASRLADVALGSRLHPLTLTLAVAALLPLGFMLALLSGGHLAALAAYASLYGACNGLLTITRGTLPLALFDFRSYGAVTGALLMPSFLLTAAAPVAYAYVVQRHGAHAAMGMSAGVAGAILAAALALRWRFIARARG
>NZ_CP043820.1|WP_049053005.1|5896175_5896721_+|N-acetyltransferase
MPPSAAPILIRDSVDADLPAIKSIYAHHVQHGTASFELDPPSIQEMRQRRAGVLEKDMPYLVAEIDGEVVGYAYVTPYRPRPAYRHTVEDSVYVKAGRAGQGIGGRLLATLVERCTAAGWRQMLAVVGDSRNAASLAVHARQGFHPVGTLRSVGHKHGEWRDTVLMQRALGEGDGTPPQRP
>NZ_CP043820.1|WP_070541598.1|5895160_5896051_-|LysR-family-transcriptional-regulator
MRGLNLDALRTFAQVIELGSFSAAAERGGITQPAVSLQVRQLERRFGLKLVERVGRRAGPTAAGLELLTHIRAIDAALAQAEQAMTAHASQVTGRVRLGTGATACTYLLPPLLADLRHRFPALDVVASTGNTADMLRGLENNTLDIGLVTLPAPGRMIEATPVLEDEFVAIFPARGPLAIPDAVTPQALAALPLVLFEPGARTRRLVDDWFEEAGVAVKPVMELGSTEAMKEIVAAGLACAVLPRMAVSGAGQRGSLALRSLAPRLARTLAVVVRRDKPLSRGLRHLQEALLALRT
>NZ_CP043820.1|WP_006384641.1|5894175_5895213_+|2-isopropylmalate-synthase
MLDHPQHKYRPVQPFSRDYAERQWPTRRPSAPPIWMSTDMRDGNQALIEPMDAARKLRFFEQLVAVGLKEIEVAFPSASDTDFNFVRKLIEESRIPSDVTIEVLTQSRPDLIARTFESLRGAPRAIVHLYNPIAPQWRRIVFGMSRAEIKEIALAGTRQIRALADAHPETEWIYEYSPETFSLAELDFALEVCDAVSAIWRPSPARKMIINLPSTVECTTANVYADQIEWMHRRLARRDSIVLSVHPHNDRGTAVASAELAVLAGADRVEGCLFGNGERTGNVDLVTLALNLDRQGIASGLDFSDMAAVRDCVQACNQLPVDVFHPYAFTSAAPAMPPAGAAARG
>NZ_CP043820.1|WP_053499537.1|5892904_5893732_-|helix-turn-helix-transcriptional-regulator
MDKPKPPSRLAGSRKPADLDLFPYESSLRPVAALAVDYEDGHRVGRHRHRRSQLVYAISGVMVVDTDAGIWVVPPTRGVWVPAWVSHSIRMSGEPRMRTVFVEPGAASHLPTECCVLSISPLLRELMVAAAEVPLDWKPGTRDGRLMLLLLDELKQEPVLPLHLPQPSEPRLARICRAIVRHPERQAGAADWARELGVDPKTVHRLFLRHTGMTFGRWRQQARLLAAMERLARGERVLDVALDLGYESPSAFAAMFRKALGEPPSAFAARGAASA
>NZ_CP043820.1|WP_024070575.1|5906595_5907324_+|SDR-family-oxidoreductase
MSKPTAYLVTGGSAGIGAAIVRMLLDAGHKVVNIDYRLPEHPPAGLVSYQADLTDEARTKEVAAEVTAAYDIVGLVNNAGATRPGTADTATLADLDYVVNLHLRTALILVQAALPAMRAAGFGRIVNMSSRAALGKPDRVVYSATKAGLVGLTRTLAMELGGDGITVNAIGPGPIATDLFTKSNPAGAPQTERIINSIVVKRLGTPEDVARAAMFFLSPDNGFVTGQMLYVCGGTTLGVAPI
>NZ_CP043820.1|WP_020926101.1|5907374_5908157_-|IclR-family-transcriptional-regulator
MAEQATQQPSDSYVQSFARGLSVIRAFGPDRSQMTLSEVAAVTGLTRAGARRILLTLEHLGYVTVEDRKFALTPRILELGYAYLSGTPLWNLALPYMEEVAEQTRESCSVSVLEGADIVYILRLSTHKVMTINLAVGSRLPAWVTSMGRVLLAGLPAAELDRVLAMSQIQAYTKDTVTDIGALKAILAGVRADGYACVAQELEPGLQSVAVPIVDRSGRVIAAMNVSGHANRFSREEMLATFLPPLRHAADQINHALLRR
>NZ_CP043820.1|WP_149895570.1|5908327_5909017_+|3-oxoacid-CoA-transferase-subunit-A
MISKLVASAAAALADVPDGATVMIGGFGTAGQPMELIDALLEQGAKDLVIINNNAGNGTTGLAALLGANRVRKIICSFPRQVDSQIFDGLYRSGKIELELVPQGNLAERIRAAGAGIGAFFSPTGYGTPLADDKETREINGRQYVLEYPLHADYALIKAERGDRWGNLVYRKTARNFGPIMASAARVAVAQVREVVELGALDPETVVTPGIFVQRVVQIDAAQAAKEQQ
>NZ_CP043820.1|WP_020926099.1|5909013_5909658_+|CoA-transferase-subunit-B
MSTKLTRDQIAARVAQDIPEGAYVNLGIGLPTLVANHLPADREVILHTENGMLGMGPAPAKGEEDYDLINAGKQPVTELPGCSFFHHADSFAMMRGGHLDICVLGAFQVSQHGDLANWHTGAPDAIPAVGGAMDLAIGAKDVFVMMELQTREGQSKLVDACTYPLTGVRCVSRVYTDVAVFDIRADGVTVIDMFGETTADELLRLTGLPLKFSN
>NZ_CP043820.1|WP_006390036.1|5909710_5909986_+|muconolactone-Delta-isomerase
MLFMVQMQVNLPVDMPAAQADKLKADEKALAQQLQRDGKWQSLWRVVGRYANVSIFDVQDNDELHALLSSLPLFPYMDIQVTALARHPSAI
>NZ_CP043820.1|WP_024070579.1|5909998_5910295_+|YciI-family-protein
MPYIIETFDKPDHQAVRQQHRAAHLEYLDANKHLLLACGAKLQDDGKDLGGGLYIVDLDTREAAQQFIDADPFAQAQLFQRVTITRWRKAYVDGTCHL
>NZ_CP043820.1|WP_006390033.1|5910350_5911130_+|3-oxoadipate-enol-lactonase
MSYADLSQARLFYVIDGPADAPVLVLSNSLGTNADMWARQVPALSKHFRVLRYDTRGHGKSSIPDGEYSFAQLGNDVAELLAHLNIERAHFCGLSMGGPTGLWLALNRPELIGKLILCNTAARIGSAEGWSARIAAVAEQTLEKMAPTLVERWLTDGYRAAEPGLSQVLVDMLRRTPDAGYSGNCAALRDADFREQVSAITAPTLVISSTHDLAATPAQGQELAAAINGARYLELNTSHISNWEQPEAFTRAVVDFLTE
>NZ_CP043820.1|WP_024070581.1|5911133_5912174_+|cyclase
MQRWTHRPEGSNWGDFGPDDQLGRLNLITEEQVLKGAREIRAGKTFCLSLPLDLPGGNVLNPRRHPPQLSPTRLADTPYLNFPLRNVNPDAVDVLSDDQVLLSMQYSTQWDALAHVGALFDADGDGQPELRYYNGFQAGVDVIGPADGDHTGCGCNSGGPSAALKLGVENLAQKGMQGRGVLLDLARHYGPGRTLVGHAEIMHVLKTDGIEIEPGDMLVLRTGYAEAVVAMAGKPDAEVLHTYGAALDGTDAALLQWITDSGIAAICADNYAVEAYPAREKTGPRAMLPLHHHCLFKLGLPLAELWYLKDLADWLRANGRHRFMLTAPPLRLPHAIGSPVTPIATV
>NZ_CP043820.1|WP_149895571.1|5912354_5912723_-|PsiF-repeat-family-protein
MLSRTSQLASAIVLSACFLGAVHAQTPAVTPAPAKTPAPAATPAKTPTAQQQRMADCNKSAEGKKGDDRKTYMSACLKGEAPPPAKQLTPQQQKMKDCNAKAGEQKLTGDKRKTFMSTCLKG
>NZ_CP043820.1|WP_006390029.1|5913101_5913437_+|hypothetical-protein
MKTVLASLALLAGLTGAAHAQNLYGVTLGNIQAIRDANENVSTITGSLANQSARAVNYVMLTFVLYDEQGREIGRVRDDDIGPLAPGQIKMIRAITPLQFAKVTALDIRAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP043820_2	2.1\|1807329\|30\|NZ_CP043820\|CRISPRCasFinder	1807329-1807358	30	NZ_CP043820.1	454649-454678	1	0.967

1. spacer 2.1|1807329|30|NZ_CP043820|CRISPRCasFinder matches to position: 454649-454678, mismatch: 1, identity: 0.967

gaagcccccacgccgcgccttcggcttgct	CRISPR spacer
gaggcccccacgccgcgccttcggcttgct	Protospacer
**.***************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP043820_2	2.1\|1807329\|30\|NZ_CP043820\|CRISPRCasFinder	1807329-1807358	30	CP006880	Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence	151685-151714	7	0.767

1. spacer 2.1|1807329|30|NZ_CP043820|CRISPRCasFinder matches to CP006880 (Rhizobium gallicum bv. gallicum R602 plasmid pRgalR602c, complete sequence) position: , mismatch: 7, identity: 0.767

gaagcccccacgccgcgccttcggcttgct	CRISPR spacer
ggcgacggcacgcagcgccttcggcttgcg	Protospacer
*. * *  ***** ***************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1886920 : 1898149

Burkholderia_phage(55.56%)

tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024068262.1\|1886920_1887370_+	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	1.1e-17	36.5
WP_049072536.1\|1887366_1887555_+	hypothetical protein	NA	NA	NA	NA
WP_149894936.1\|1887547_1889221_+\|tail	phage tail protein	NA	NA	NA	NA
WP_054518401.1\|1889213_1889813_+	hypothetical protein	NA	NA	NA	NA
WP_006388474.1\|1889822_1890122_+	hypothetical protein	NA	NA	NA	NA
WP_149894937.1\|1890141_1891152_+	hypothetical protein	A9YX04	Burkholderia_phage	1.1e-76	52.2
WP_054472039.1\|1891186_1891930_+	hypothetical protein	A9YX06	Burkholderia_phage	1.3e-82	63.1
WP_020924456.1\|1891938_1892292_+	hypothetical protein	A9YX11	Burkholderia_phage	6.1e-35	66.7
WP_149894938.1\|1892288_1893470_+	hypothetical protein	A9YX12	Burkholderia_phage	7.5e-130	62.6
WP_149894939.1\|1893471_1894137_+	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	1.6e-73	60.2
WP_149894940.1\|1894151_1895099_+	hypothetical protein	A0A0M3ULD8	Salmonella_phage	1.7e-15	52.9
WP_076468321.1\|1895605_1895956_+\|tail	phage tail protein	NA	NA	NA	NA
WP_102964841.1\|1897188_1897629_+	hypothetical protein	A0A0A7DJS9	Pseudomonas_phage	2.0e-11	37.7
WP_149894941.1\|1897618_1898149_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	1.5e-42	56.8

DBSCAN-SWA_2

2776048 : 2783983

Moraxella_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006388149.1\|2776048_2776636_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.2e-19	36.8
WP_006388150.1\|2776669_2777044_-	thioredoxin family protein	V9SJ74	Achromobacter_phage	1.9e-10	27.8
WP_006388151.1\|2777241_2778264_-	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_006388152.1\|2778642_2778999_+	hypothetical protein	NA	NA	NA	NA
WP_006388153.1\|2779083_2780376_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-65	36.3
WP_006388154.1\|2780484_2781516_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.4e-92	51.6
WP_006388155.1\|2781585_2782227_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_149895043.1\|2782415_2783174_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.8e-68	52.0
WP_085941785.1\|2783293_2783983_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.1e-31	45.2

DBSCAN-SWA_3

5794382 : 5835011

Burkholderia_virus(33.33%)

integrase,tail

attL 5794194:5794248|attR 5812965:5813019

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
5794194:5794248	attL	NA	NA	NA	NA
WP_149895546.1\|5794382_5795510_+\|integrase	tyrosine-type recombinase/integrase	A0A1L7DQ84	Ralstonia_phage	6.9e-48	36.3
WP_108914010.1\|5795841_5796198_+	hypothetical protein	NA	NA	NA	NA
WP_149895547.1\|5796370_5797327_-	DUF2332 family protein	NA	NA	NA	NA
WP_063639474.1\|5797545_5799477_-	AAA family ATPase	NA	NA	NA	NA
WP_088589721.1\|5799779_5801198_-	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_029580638.1\|5801354_5801801_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_149895548.1\|5802092_5802782_-	serine/threonine protein phosphatase	A0A2H4J0P0	uncultured_Caudovirales_phage	7.1e-56	48.9
WP_149895549.1\|5803206_5803476_+	hypothetical protein	NA	NA	NA	NA
WP_149895550.1\|5803472_5804483_+	hypothetical protein	NA	NA	NA	NA
WP_042997010.1\|5804479_5805019_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_149895551.1\|5805015_5806011_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_033451588.1\|5806015_5806294_+	hypothetical protein	NA	NA	NA	NA
WP_149895552.1\|5806551_5807277_+	P-type DNA transfer protein VirB5	NA	NA	NA	NA
WP_149895553.1\|5807287_5807734_+	hypothetical protein	NA	NA	NA	NA
WP_149895554.1\|5807730_5807991_+	EexN family lipoprotein	NA	NA	NA	NA
WP_149895555.1\|5807992_5809045_+	type IV secretion system protein	NA	NA	NA	NA
WP_149895556.1\|5809697_5809931_+	hypothetical protein	NA	NA	NA	NA
WP_149895557.1\|5810225_5811749_+	RNA-directed DNA polymerase	NA	NA	NA	NA
WP_149895558.1\|5811809_5812631_+	hypothetical protein	NA	NA	NA	NA
WP_149895559.1\|5813299_5813623_-	BcpO-related WXXGXW repeat protein	NA	NA	NA	NA
5812965:5813019	attR	NA	NA	NA	NA
WP_006385707.1\|5813914_5814931_+	amino acid ABC transporter substrate-binding protein	A0A1B1IT51	uncultured_Mediterranean_phage	5.0e-66	39.0
WP_006385706.1\|5815130_5815412_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_006385705.1\|5815760_5816696_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_054516402.1\|5816748_5817948_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006385703.1\|5817978_5818797_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.4e-10	49.3
WP_053497395.1\|5818815_5819745_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_026382513.1\|5819886_5820483_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	3.3e-49	53.5
WP_149895560.1\|5820479_5820716_-	hypothetical protein	NA	NA	NA	NA
WP_006385699.1\|5820696_5821062_-	hypothetical protein	NA	NA	NA	NA
WP_149895703.1\|5821066_5824570_-	DUF1983 domain-containing protein	A4JX16	Burkholderia_virus	1.9e-261	45.2
WP_006385697.1\|5824695_5825301_-\|tail	tail assembly protein	Q6JIL3	Burkholderia_virus	1.0e-50	55.7
WP_054442583.1\|5825297_5826077_-	C40 family peptidase	Q3HQU3	Burkholderia_phage	9.5e-65	46.9
WP_047991976.1\|5826079_5826808_-\|tail	phage minor tail protein L	Q6JIL5	Burkholderia_virus	2.4e-70	57.9
WP_149895561.1\|5826810_5828772_-\|tail	tail fiber domain-containing protein	A0A0K0KVF1	Prochlorococcus_phage	8.7e-14	36.2
WP_035182017.1\|5828768_5829107_-\|tail	phage tail protein	A0A0S2SYI2	Pseudomonas_phage	8.1e-21	38.4
WP_054499930.1\|5829109_5830396_-\|tail	phage tail tape measure protein	A0A1W6JP49	Morganella_phage	2.2e-13	30.3
WP_054439099.1\|5830453_5830744_-	DUF4035 domain-containing protein	S4TND7	Salmonella_phage	2.7e-12	48.2
WP_054497360.1\|5830743_5831217_-\|tail	phage tail protein	A4JX08	Burkholderia_virus	1.8e-26	44.4
WP_006385689.1\|5831222_5831690_-	hypothetical protein	NA	NA	NA	NA
WP_049055147.1\|5831939_5832581_-	hypothetical protein	NA	NA	NA	NA
WP_149895562.1\|5832805_5833501_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_149895563.1\|5833553_5835011_-	DUF1254 domain-containing protein	M1IA53	Paramecium_bursaria_Chlorella_virus	3.6e-65	35.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection