CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044031	Orientia tsutsugamushi strain Wuj/2014 chromosome, complete genome	3 crisprs	RT	2	1	10	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044031_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044031_1

351742-351995

Orphan

Consensus_repeat	Method
TGGAACATGCGAAGTACTAGCTTTTTGTTCGATAGAGTCGATTTTTAAAGGTG	PILER-CR

2 spacers

DEDDh

The CRISPR arrays of NZ_CP044031_1

>merge|NZ_CP044031|1|351742-351995|PILER-CR
TGGAACATGCGAAGTACTAGCTTTTTGTTCGATAGAGTCGATTTTTAAAGGTGGTTCTGTAACTTTAGGAGTTATAGGCTGAGTAGTAGAAGCACTACTTTCTGTTGTAGTAGCAACATTAGCTTTATGTTCGATAGGTGGGCTTTGTAAAGTTTGCTCTATGACTTTCGGTGTAGCTTGAGGAGCGGAAGCAATTTTTTCTGGAACATGCGAAGTACTAGCTTTTTGTTCGATAGAGTCGATTTTTAAAGGTG

>NZ_CP044031|1|1|351742-351995|PILER-CR
TGGAACATGCGAAGTACTAGCTTTTTGTTCGATAGAGTCGATTTTTAAAGGTG	GTTCTGTAACTTTAGGAGTTATAGGCTGAGTAGTAGAAGCACTACTTTCTGTTGTAGTAGCAACA
TTAGCTTTATGTTCGATAGGTGGGCTTTGTAAAGTTTGCTCTATGACTTTCGG	TGTAGCTTGAGGAGCGGAAGCAATTTTTTCTGGAACATGCGAAGTACTAGCTTTTTGTTCGAT
AGAGTCGATTTTTAAAGGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044031.1\|WP_109227528.1\|343578_347016_-\|response-regulator	unknown	unknown	gnl\|CDD\|271357
NZ_CP044031.1\|WP_150339090.1\|347769_348438_+\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|99835
NZ_CP044031.1\|WP_150339110.1\|363733_364201_-\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|235782
NZ_CP044031.1\|WP_045917137.1\|348656_349166_+\|CarD-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224248
NZ_CP044031.1\|WP_045917956.1\|341252_341588_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_109227535.1\|355372_356056_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_045917953.1\|340723_340906_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319756
NZ_CP044031.1\|WP_150339102.1\|356298_357828_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150338913.1\|341713_341890_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271188
NZ_CP044031.1\|WP_150339106.1\|359398_361204_+\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_CP044031.1\|WP_150339100.1\|353663_354677_+\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|236450
NZ_CP044031.1\|WP_150339104.1\|358146_359251_-\|peptide-chain-release-factor-2	unknown	unknown	gnl\|CDD\|234799
NZ_CP044031.1\|WP_109227540.1\|364469_364952_+\|transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP044031.1\|WP_150339094.1\|350240_351032_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|179876
NZ_CP044031.1\|WP_150339098.1\|352803_353493_-\|protein-TolQ	unknown	unknown	gnl\|CDD\|131843
NZ_CP044031.1\|WP_150339092.1\|349189_350224_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	unknown	unknown	gnl\|CDD\|236585
NZ_CP044031.1\|WP_150339088.1\|340394_340724_-\|conjugal-transfer-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150339108.1\|362794_363655_-\|alpha/beta-hydrolase	unknown	unknown	unknown
NZ_CP044031.1\|WP_150338911.1\|340935_341253_-\|conjugative-transfer-protein	unknown	unknown	gnl\|CDD\|377500
NZ_CP044031.1\|WP_011944822.1\|352339_352798_-\|protein-TolR	unknown	unknown	gnl\|CDD\|274306

Protein	Function_ID	Function_description	E-value
NZ_CP044031.1\|WP_109227528.1\|343578_347016_-\|response-regulator	gnl\|CDD\|271357	cd10322, SLC5sbd, Solute carrier 5 family, sodium/glucose transporters and related proteins; solute-binding domain. This family represents the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporter family or solute sodium symporter family) that co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. Family members include: the human glucose (SGLT1, 2, 4, 5), chiro-inositol (SGLT5), myo-inositol (SMIT), choline (CHT), iodide (NIS), multivitamin (SMVT), and monocarboxylate (SMCT) cotransporters, as well as Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. Vibrio parahaemolyticus Na(+)/galactose cotransporter (vSGLT) has 13 transmembrane helices (TMs): TM-1, an inverted topology repeat: TMs1-5 and TMs6-10, and TMs 11-12 (TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). One member of this family, human SGLT3, has been characterized as a glucose sensor and not a transporter. Members of this family are important in human physiology and disease.	1.76566e-88
NZ_CP044031.1\|WP_150339090.1\|347769_348438_+\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|99835	cd06131, DNA_pol_III_epsilon_Ecoli_like, DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins. This subfamily is composed of the epsilon subunit of Escherichia coli DNA polymerase III (Pol III) and similar proteins. Pol III is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. It is a holoenzyme complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of Pol III also functions as a stabilizer of the holoenzyme complex.	7.07295e-94
NZ_CP044031.1\|WP_150339110.1\|363733_364201_-\|single-stranded-DNA-binding-protein	gnl\|CDD\|235782	PRK06341, PRK06341, single-stranded DNA-binding protein; Provisional.	3.40339e-64
NZ_CP044031.1\|WP_045917137.1\|348656_349166_+\|CarD-family-transcriptional-regulator	gnl\|CDD\|224248	COG1329, COG1329, Transcriptional regulators, similar to M. xanthus CarD [Transcription].	6.27418e-55
NZ_CP044031.1\|WP_045917953.1\|340723_340906_-\|hypothetical-protein	gnl\|CDD\|319756	cd16430, TraB, TraB is a homolog of VirB10 which forms part of core complex in Type IV secretion system (T4SS). This family contains TraB (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TraB is localized similarly to related proteins in other systems, but unlike in other systems, Neisseria gonorrhoeae TraB does not require the presence of other T4SS components for proper localization. It has been shown to be expressed with TraK (VirB9 homolog) at low levels in wild-type cells, suggesting that gonococcal T4SS may be present in single copy per cell and the small amounts of these proteins are sufficient for DNA secretion.	0.00218415
NZ_CP044031.1\|WP_150338913.1\|341713_341890_-\|hypothetical-protein	gnl\|CDD\|271188	cd01188, INT_RitA_C_like, C-terminal catalytic domain of recombinase RitA, a component of the recombinase trio. Recombinases RitA (also known as pAE1), RitB, and RitC are encoded by three adjacent and overlapping genes. Collectively they are known as the Recombinase in Trio (RIT). This RitA family includes various bacterial integrases and integrases from the deletion-prone region of plasmid pAE1 of Alcaligenes eutrophus H1. All three integrases contain a catalytic motif, suggesting that they are all active enzymes. However, their specific roles are not fully understood. All three families belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	0.00545729
NZ_CP044031.1\|WP_150339100.1\|353663_354677_+\|porphobilinogen-synthase	gnl\|CDD\|236450	PRK09283, PRK09283, porphobilinogen synthase.	0
NZ_CP044031.1\|WP_150339104.1\|358146_359251_-\|peptide-chain-release-factor-2	gnl\|CDD\|234799	PRK00578, prfB, peptide chain release factor 2; Validated.	0
NZ_CP044031.1\|WP_109227540.1\|364469_364952_+\|transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.65547e-21
NZ_CP044031.1\|WP_150338911.1\|340935_341253_-\|conjugative-transfer-protein	gnl\|CDD\|377500	pfam05309, TraE, TraE protein. This family consists of several bacterial sex pilus assembly and synthesis proteins (TraE). Conjugal transfer of plasmids from donor to recipient cells is a complex process in which a cell-to-cell contact plays a key role. Many genes encoded by self-transmissible plasmids are required for various processes of conjugation, including pilus formation, stabilisation of mating pairs, conjugative DNA metabolism, surface exclusion and regulation of transfer gene expression. The exact function of the TraE protein is unknown.	1.18563e-06
NZ_CP044031.1\|WP_150339098.1\|352803_353493_-\|protein-TolQ	gnl\|CDD\|131843	TIGR02796, Protein_TolQ, TolQ protein. TolQ is one of the essential components of the Tol-Pal system. Together with TolR, it harnesses protonmotive force to energize TolA, which spans the periplasm to reach the complex of TolB and Pal at the outer member. The tol-pal system proves to be important for maintaining outer membrane integrity. Gene pairs similar to the TolQ and TolR gene pair often number several per genome, but this model describes specificially TolQ per se, as found in tol-pal operons. A close homolog, excluded from this model, is ExbB of the ExbB/ExbD/TonB protein complex, which powers transport of siderophores and vitamin B12 across the bacterial outer membrane. The Tol-Pal system is exploited by colicin and filamentous phage DNA to enter the cell. It is also implicated in pathogenesis in several bacterial species [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	8.72994e-72
NZ_CP044031.1\|WP_150339092.1\|349189_350224_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD	gnl\|CDD\|236585	PRK09604, PRK09604, tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD.	7.00847e-178
NZ_CP044031.1\|WP_150339094.1\|350240_351032_+\|NAD-kinase	gnl\|CDD\|179876	PRK04761, ppnK, inorganic polyphosphate/ATP-NAD kinase; Reviewed.	6.88061e-78
NZ_CP044031.1\|WP_150339106.1\|359398_361204_+\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_CP044031.1\|WP_011944822.1\|352339_352798_-\|protein-TolR	gnl\|CDD\|274306	TIGR02801, Protein_TolR, TolR protein. The model describes the inner membrane protein TolR, part of the TolR/TolQ complex that transduces energy from the proton-motive force, through TolA, to an outer membrane complex made up of TolB and Pal (peptidoglycan-associated lipoprotein). The complex is required to maintain outer membrane integrity, and defects may cause a defect in the import of some organic compounds in addition to the resulting morphologic. While several gene pairs homologous to talR and tolQ may be found in a single genome, but the scope of this model is set to favor finding only bone fide TolR, supported by operon structure as well as by score. [Transport and binding proteins, Other, Cellular processes, Pathogenesis].	8.50704e-44

>NZ_CP044031.1|WP_150339094.1|350240_351032_+|NAD-kinase
MNVKNIRYFTSNLARSAQIANELQQKYSILPLSDKDNYSDSIDTIIVIGDDGVFLHALKNFLHLNVGFYGINVGNLGFLMNSYNNKHDLIEQISSAKVVSIHPLRAKVAYNDATEEKICFAFNECTILRYSSQAIKLDIKTDNVFRLNLFGDGVLVATAVGSAAYNYAAGGMVLPLAANLLSITAISPFRPKGWHGALIHNRSSIDITIHDYTTRPGYFTADLQEIYNVTTVNITEAQDQKVKLLFNAESDLEDKLLKEQFST
>NZ_CP044031.1|WP_150339092.1|349189_350224_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-transferase-subunit-TsaD
MNVIGIESSCDDTAIAIVNSNREIIANVVISQYTEHLPYSGVVPEIAARAHLKNLQYAMKETLNQAKINLTDIDVIAATSGPGLIGGVIVGSVFGQAIACALGKDFIAVNHLEGHILAVRLNENISFPYLVLLVSGGHCQFIAVLGVGKYKILGQTIDDAVGEAFDKTARLLKLGYPGGPIIEKLASKGDPRKYSLPLSMTKKSGCDLSFSGLKTAVKQLIFSIESLSEKVICDICASFQYTVVQILLCRSINAIKLFESYCSNNFKINRKNYFVISGGVAANQYLRQEIFNLVSTYGYCGVAPPSNLCTDNAAMIAWAGIERLNANLFSSNFVPRAKWSVEEL
>NZ_CP044031.1|WP_045917137.1|348656_349166_+|CarD-family-transcriptional-regulator
MEHQQQEQFKIGDKVVYPSHGVGEVIGIENQVFCGKELRVYVVSFPMDKMTLKVPVSSKSASGLRAISYKTDTDKIYKILCSQSQPGNRMWSRRAQEYENKINSGDLCSIAEVVRDLYKNAEVDRSYSERTIYESAITRLARELAILESVKYEEIIEKLTEILKNRNTV
>NZ_CP044031.1|WP_150339090.1|347769_348438_+|DNA-polymerase-III-subunit-epsilon
MQRKIVLDTETSGLDHKQGHRIIEIGAVELDSDCTEIRNTFHYYINPERDISKEAYKVHGLSRDFLSDKPKFREIVDEFLQFIDGAQLIMHNANFDMQFLNSELFRIRKSAIPNTCVIDTLTLARKRFPKERVNLDALCYKFRIDTSDRILHGALKDAQLLALVYGRMMRGMQVVLLDDTKHNKEIIISNCATNINNTVVVEPTCDEIIQHQQLLSKIHKRL
>NZ_CP044031.1|WP_109227528.1|343578_347016_-|response-regulator
MPALNIDLILVGLFLIANLAIGLWYGKEVKSVRDYALGGQNFSTASLASTLIATFIGGSTFSFYLSQTYALGILAVLPIIGQILGLLCYPYILIPRMQEFFGKLSVADVMGDLYGKHIRVIGAICVIIRSATGIAMQIKVFSTIFNHFLGIDSVYATVISSMVVIIYSAFGGIRAVVFTDIFQSLAFGAFIPTLAILIWGMLGSWESIANTLTTNPIFDPKILLDYHNINTLGYYGIFFYCFLPDTNPAMFHRILISRNTVQASKAFKIMIPMHLLFCVFVGFIGLILLSSHQNIETNNLVPYIIDSYAYPGFKGLVVIGISAMIMSTADSYINSASVVFVNDLCKPLGLFQKNTILEIIAVRIFSIFIGILGLCMALSQKNLIGILLFGASFYSPIIGIPLMFTILGFRTTTRVIVSGMIAGISTTFIWNKFFNAALPIGDLMPATIANFVVMMIMHYCLGEPGGWVGPSDRRPLNVLKEKRKQQINSIASFFKSLSHGLSWDNICAYCNNETFRGRHYYIEYSVITAASLMVMSLCGQVEHNVASAWLVTKVSVILLGLVMTTALLYNNKWNADFRTKYLGLIWHVTIFYTLVFSNTLLTMIGGSSPILLMCFISNLVVAGILLQWHTALFMILLGVPVGARVFNILASWRGYLADYNEIDNNLGMYVIWALALLGAILLFIRLRQNQFVDNTRSMLELKNDVDVLNLRLNTKSQKMEILLNAEKHILNNLSHEIKSPLSVVRTTINLLSKFLPKYYKDTEMILKEKERVLTMVTLANSGIERLVAYSNNLFDLSKFAQGQMIFDIELNNFQLMLKEIIAECNKVNAAEKHIISLNYVPQAETMFEFDNTRIKTVMLNLISNAIQYSQSGLILITVKPYRSGVEVSIEDEGVGIPENELEAIFVPFEESSRTKSKACGRGLGLTLAKEIILAHHGEIWAENRPNNRGSKFTFRLPLRQPEGGFNKAVYSKSEVFGKIYKDRIAKLLKGFGYECNSINSLKELENHIRVNKSILIVDDDQNVLDAISLDIYAEQYTPAPVNNAFEAVRLIKENPLQYSLVLLDMVMPEKSGEQVVQEIYTVTKMYGIPIIIISGYSQTYETKNLLYSMGVVAFIEKPYTYNELRNVINHYLKQTIIPLPYSYLP
>NZ_CP044031.1|WP_150338913.1|341713_341890_-|hypothetical-protein
MSDAGASQRTISTALNHRNPDSTIPYTIACIELVREYMSKATQIIRECAENYNIYNTI
>NZ_CP044031.1|WP_045917956.1|341252_341588_-|hypothetical-protein
MRNLMLQLRLKVIMQNQKLCWALSRPLKYMGLSIDEWRVVLAGVAPGIVLLNSRHAKLGLAFMVGGIALCYCFKKFKKVSENFLLKSFLVAKGLLPAPLGYSRLLGKKVGK
>NZ_CP044031.1|WP_150338911.1|340935_341253_-|conjugative-transfer-protein
MNHLFKQNAIQELVKYNKCLLSVTILLAAANIIAIIATITKEEKWLLIPAMEPDRKMTVSSKNYHKTYLKEWAIFMMKGLLTTSPNEVERQIADMKLELAMLLIS
>NZ_CP044031.1|WP_045917953.1|340723_340906_-|hypothetical-protein
MSLVVLIASGRVIDVVFKKGFDLREHKKKPHNLTYSQSTNNEKVNLHNKFDQSQKLEEYL
>NZ_CP044031.1|WP_150339088.1|340394_340724_-|conjugal-transfer-protein
MKFLLLLLGCMSLTSFFFESTFDCKIPKGQKCKSLYEIKNMVAQGAFDIDNLEKVETSKTKSKRRCILCYRQAKAVQGVDVVNTSPKKTKKYLINLFKSKQSQGERKHT
>NZ_CP044031.1|WP_011944822.1|352339_352798_-|protein-TolR
MDNNTINAISNVFAKKRSKRALISNINVTPLVDVMLVLLIVFMVTSPMLTLGVNINLPKTSASQPLSEQSEPLTISIDKSNNIYIFKTKISKTQLVNKLKALTRTKGKFNTRIFIKADQNLQYGEIAKLLAEITSAGFTKVALITDNCNEHK
>NZ_CP044031.1|WP_150339098.1|352803_353493_-|protein-TolQ
MLEHSSLTSQISIISAFLSADIICKTVMVTLIISSIWSWAIIFYKYYHFNNIKKEINTFNKLLQSNQSVDELYGKINKNNGNSISSMLTIVLNECKNEHNVTAGNNSNLKDRLLYTIELTKNQISEQLETYLIVLATISSTAPFIGLLGTVWGIMHSFQAIAATKNTSIAVVAPGIAEALLATAIGLFAAIPAGIFYNILTHKVSLIENKLENFIRKFYTVLCKTIDKK
>NZ_CP044031.1|WP_150339100.1|353663_354677_+|porphobilinogen-synthase
MDYLSCKFVRLRRNRQYEWLRDLVAETSILSSDLILPIFITDGMNKEIIINTMPSVKIVSPDLALQKVEEAIDYGIKAVALFPSISAAQKSNDAAEACNANNLICQTIRLLKSNNRFRKVGIIADVALDPYTIHGHDGLLTDDCLDIDNDRTLAVLCKQSLKLADAGADIIAPSDMMDGRVKAIRGSLNSKGYCNTIILSYAVKYASNFYGPFRNVVGAKLSSGPSSKKTYQMDYRNTREALKAVEINIQEGADMVVVKPAMTYLDIIFNVKNNFNIPVFAYQTSGEYSMIKYAALNGCMDFDQAILESIQCIKRAGATAIFTYAAIKLARFLAANH
>NZ_CP044031.1|WP_109227535.1|355372_356056_+|hypothetical-protein
MKAKKKKHNKVANLKNKTEKTANNSAAEQQIMEINAAFSDRIKKSLYKGAVLESIFACALKTEDIETLKIIESQNIKINTECITELFVGFITEFGKYKFAIQWLQEQFSSIIDDMITENPKIIKCMIIDSCENRDDEFISFIIKNYSNKIDVDEAFDNLVTLNFGHGITLLLNNCKVTQESIQKAIKTAQTLGNIAAEKILNPNIKLKKPPRKKKVTYNILISKKLK
>NZ_CP044031.1|WP_150339102.1|356298_357828_+|hypothetical-protein
MSYFEAKEDWYNIAVLHINRTFENEVFHCEKAIDAVFKINKTSERDKYAFVSTVLKYNILDDKENWARYLKFSDKLQKFSTGVYNTLNTAILYKKISTFILKGDKSNAEKYIEKLPESLPKEIINLEYRLKFDSNFDYSSEVQHIYNIKAEIDQQKLMIAGRILSEPVLRVLIKFWQHFDICNNDQQCNNILQICADLAKYHSLSSAQDDITNLLNNSSIKNKLSSDVIVANNLKKYDTADKRKNNQGISLKKESLNDYATTSSHKKNQVTTKNELEQDVEAKSGDAVDFLDNVNTDEVSEVDENIDNSCVNNTVFDEQYTPGEFYTKLMQVYTKHNDLFTKHDKHQHIHCHTKKHTYCTFDPDVKKCTWNGKTYYCAISKDLKLDSVKHMYYRNALEKEFVSSNINQSGIKCLPNKMFELKVCKEDFRLLACNTYVDNKGNYFIIFNKETNHTGISNIISNSTLSNNPILTESCKDCNEEADSTTVNTDITPCVIGQMLNQTEYYNDC
>NZ_CP044031.1|WP_150339104.1|358146_359251_-|peptide-chain-release-factor-2
MRIELKDYIKETNKILELIRRSLDPESLKSQLAKLEHDVEDHSLWNNYQHASLVLKEKKTIENKLATYNKIASAFDDYVELSNIAIKENDIEFIHNIEQEWKKLQEEAKKLQVECLFTSDVDVNDCFLDINAGAGGTESNDWASMMLRMYLRFAESMNFKTEVVYLLDGEEAGVKSASVKICGHNAYGWFKTESGVHRLVRNSPFNALGKRMTSFASAWVYPVINDNIQVVIEDKDIRIDTYRASGAGGQHVNTTDSAIRITHFPTKIVVQCQNDRSQHKNKAEAMRMLKAKIYELEQKKQNEIINNHNATKTDNSWGYHIRSYVLQPYQLVKDLRTNVETSDTKRVLDGDLEKFIYASLIHQNITF
>NZ_CP044031.1|WP_150339106.1|359398_361204_+|elongation-factor-4
MQRQSNIRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRLVYKADDGCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVDNNHKILIVLNKIDLPAANPQQVQQQIEDVIGIDASDALMISAKIGLGIKDVLQAIVTELPSPNGDSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMCSNNAVYTVENVGFFSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGLYPSDASQFNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREFDLDMITTAPSVMYKVYLNTGKVIDVHNPADLPEMQKIKSMSEPWVEATIFIPDQYLGAILGLCTEKRGVQVDLTYVNGRAKLVYLLPLNEIVFDFYDKLKSYSKGYASFDWQIDSYKQSDLIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIARETIRALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAALKITNKD
>NZ_CP044031.1|WP_150339108.1|362794_363655_-|alpha/beta-hydrolase
MNYSVFVARKKNLELVLINLLISLLLSSYINTSYNARVNRANKVVQNTEMKHDIIKTNKFLLTVFHKITNLNTNFVFYIEGDGLIYYNDSISNNPTPLLPLVIELATIDPRPNVVYIARPCQYTPLSLQKNCVKEYWTNKRFAKEIVDAINEAIVKISNNQLCDIIGYSGGGGLAVLVAAINPNVRTITTIAGNLDHIAFNNFHNNPHMTDSLNPIDYAEQVKYIPQLHLSGMKDKIVPPFIADKFVQHVNFAKVIKFESISHDKGWKSIWQKFCIRHEAYIAKPL
>NZ_CP044031.1|WP_150339110.1|363733_364201_-|single-stranded-DNA-binding-protein
MAGSLNRVTLIGNLGHDPEIRKTNDGKEIAAFSLATTETWRDKHSNEKKEKTEWHRIVVFNDGIVNIIKSYVKKGSKVLIEGSLQTRKWQDSSGQEKYTTEIVLQNYNASLILLDSKSSSDASSLHTKTPNDTLSVQNKTHANLSQSLDDDDLPF
>NZ_CP044031.1|WP_109227540.1|364469_364952_+|transposase
MKKCIITVYYLIDNFCKIYQEWERKRLIPSSNQRNRDGKLSLAELLTIEIYFYISPCKDCKNYHLYYLSHKYKGYFCLPSYNRIIQLRPRMLLPLAILMHYLKGEETGIYYIDSTKLAICHNTRPSSNRVFNKISKISKSSYGLFLGFELHLIINKMYYR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044031_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044031_2

1077251-1077339

Orphan

Consensus_repeat	Method
AAGTTAAATCTAATCTAGAAACTGAGTTAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044031_2

>merge|NZ_CP044031|2|1077251-1077339|CRISPRCasFinder
AAGTTAAATCTAATCTAGAAACTGAGTTAAAAATTGTTAAAGAACGTCTTGTCAAAAAAGTTACATCTAATCTAGAAACTGAGTTAAAA

>NZ_CP044031|2|1|1077251-1077339|CRISPRCasFinder
AAGTTAAATCTAATCTAGAAACTGAGTTAAAA	ATTGTTAAAGAACGTCTTGTCAAAA
AAGTTACATCTAATCTAGAAACTGAGTTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044031.1\|WP_045917961.1\|1060427_1060721_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150339714.1\|1065782_1070306_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150339702.1\|1057730_1058984_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
NZ_CP044031.1\|WP_150339639.1\|1091480_1092050_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150339712.1\|1063326_1065783_+\|virB4-protein-precursor	unknown	unknown	gnl\|CDD\|273346
NZ_CP044031.1\|WP_109227404.1\|1092897_1093056_+\|conjugal-transfer-protein-TraA	unknown	unknown	gnl\|CDD\|274289
NZ_CP044031.1\|WP_150339707.1\|1060734_1061955_-\|phosphoglycerate-kinase	unknown	unknown	gnl\|CDD\|234613
NZ_CP044031.1\|WP_045913377.1\|1074411_1074744_-\|iron-donor-protein-CyaY	unknown	unknown	gnl\|CDD\|376552
NZ_CP044031.1\|WP_150339722.1\|1082339_1082729_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	unknown	unknown	gnl\|CDD\|239575
NZ_CP044031.1\|WP_150339704.1\|1059111_1060413_-\|proline--tRNA-ligase	unknown	unknown	gnl\|CDD\|237059
NZ_CP044031.1\|WP_150339709.1\|1062035_1063052_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|273675
NZ_CP044031.1\|WP_150339727.1\|1086734_1088300_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|371642
NZ_CP044031.1\|WP_045916484.1\|1072667_1074428_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|131259
NZ_CP044031.1\|WP_150339730.1\|1088308_1089757_+\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|181676
NZ_CP044031.1\|WP_045918527.1\|1092146_1092602_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP044031.1\|WP_045914354.1\|1084745_1085531_+\|succinate-dehydrogenase-iron-sulfur-subunit	unknown	unknown	gnl\|CDD\|235652
NZ_CP044031.1\|WP_150339720.1\|1081925_1082309_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	unknown	unknown	gnl\|CDD\|239579
NZ_CP044031.1\|WP_150339733.1\|1089899_1091027_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150339699.1\|1056955_1057525_-\|elongation-factor-P	unknown	unknown	gnl\|CDD\|234788
NZ_CP044031.1\|WP_150339725.1\|1082923_1084711_+\|succinate-dehydrogenase-flavoprotein-subunit	unknown	unknown	gnl\|CDD\|236375

Protein	Function_ID	Function_description	E-value
NZ_CP044031.1\|WP_109227404.1\|1092897_1093056_+\|conjugal-transfer-protein-TraA	gnl\|CDD\|274289	TIGR02768, conjugal_transfer_protein_TraA, Ti-type conjugative transfer relaxase TraA. This protein contains domains distinctive of a single strand exonuclease (N-terminus, MobA/MobL, pfam03389) as well as a helicase domain (central region, homologous to the corresponding region of the F-type relaxase TraI, TIGR02760). This protein likely fills the same role as TraI(F), nicking (at the oriT site) and unwinding the coiled plasmid prior to conjugative transfer.	0.00781257
NZ_CP044031.1\|WP_150339702.1\|1057730_1058984_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	0
NZ_CP044031.1\|WP_150339712.1\|1063326_1065783_+\|virB4-protein-precursor	gnl\|CDD\|273346	TIGR00929, CAG_pathogenicity_island_protein_23, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).	1.74891e-115
NZ_CP044031.1\|WP_150339707.1\|1060734_1061955_-\|phosphoglycerate-kinase	gnl\|CDD\|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	7.45547e-179
NZ_CP044031.1\|WP_045913377.1\|1074411_1074744_-\|iron-donor-protein-CyaY	gnl\|CDD\|376552	pfam01491, Frataxin_Cyay, Frataxin-like domain. This family contains proteins that have a domain related to the globular C-terminus of Frataxin the protein that is mutated in Friedreich's ataxia. This domain is found in a family of bacterial proteins. The function of this domain is currently unknown. It has been suggested that this family is involved in iron transport.	1.16136e-20
NZ_CP044031.1\|WP_150339722.1\|1082339_1082729_+\|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein	gnl\|CDD\|239575	cd03495, SQR_TypeC_SdhD_like, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E. coli SdhD subunit. One characterized protein is the respiratory Complex II SdhD subunit of the only eukaryotic member, Reclinomonas americana. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. It is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. E. coli SQR is classified as Type C SQRs because it contains two transmembrane subunits and one heme group. The SdhD and SdhC subunits are membrane anchor subunits containing heme and quinone binding sites. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	1.42024e-22
NZ_CP044031.1\|WP_150339704.1\|1059111_1060413_-\|proline--tRNA-ligase	gnl\|CDD\|237059	PRK12325, PRK12325, prolyl-tRNA synthetase; Provisional.	0
NZ_CP044031.1\|WP_150339709.1\|1062035_1063052_-\|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|273675	TIGR01534, Glyceraldehyde-3-phosphate_dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, type I. This model represents glyceraldehyde-3-phosphate dehydrogenase (GAPDH), the enzyme responsible for the interconversion of 1,3-diphosphoglycerate and glyceraldehyde-3-phosphate, a central step in glycolysis and gluconeogenesis. Forms exist which utilize NAD (EC 1.2.1.12), NADP (EC 1.2.1.13) or either (1.2.1.59). In some species, NAD- and NADP- utilizing forms exist, generally being responsible for reactions in the anabolic and catabolic directions respectively. Two Pfam models cover the two functional domains of this protein; pfam00044 represents the N-terminal NAD(P)-binding domain and pfam02800 represents the C-terminal catalytic domain. An additional form of gap gene is found in gamma proteobacteria and is responsible for the conversion of erythrose-4-phosphate (E4P) to 4-phospho-erythronate in the biosynthesis of pyridoxine. This pathway of pyridoxine biosynthesis appears to be limited, however, to a relatively small number of bacterial species although it is prevalent among the gamma-proteobacteria. This enzyme is described by TIGR001532. These sequences generally score between trusted and noise to this GAPDH model due to the close evolutionary relationship. There exists the possiblity that some forms of GAPDH may be bifunctional and act on E4P in species which make pyridoxine and via hydroxythreonine and lack a separate E4PDH enzyme (for instance, the GAPDH from Bacillus stearothermophilus has been shown to posess a limited E4PD activity as well as a robust GAPDH activity). There are a great number of sequences in the databases which score between trusted and noise to this model, nearly all of them due to fragmentary sequences. It seems that study of this gene has been carried out in many species utilizing PCR probes which exclude the extreme ends of the consenses used to define this model. The noise level is set relative not to E4PD, but the next closest outliers, the class II GAPDH's (found in archaea, TIGR01546) and aspartate semialdehyde dehydrogenase (ASADH, TIGR01296) both of which have highest-scoring hits around -225 to the prior model. [Energy metabolism, Glycolysis/gluconeogenesis].	9.87532e-133
NZ_CP044031.1\|WP_150339727.1\|1086734_1088300_+\|hypothetical-protein	gnl\|CDD\|371642	pfam11638, DnaA_N, DnaA N-terminal domain. This family of proteins represents the N-terminal domain of DnaA, a protein involved in the initiation of bacterial chromosomal replication. The structure of this domain is known. It is also found in three copies in some proteins. The exact function of this domain is uncertain but it has been suggested to play a role in oligomerization.	7.65926e-05
NZ_CP044031.1\|WP_045916484.1\|1072667_1074428_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|131259	TIGR02204, system_ATPase_and_permease_component, ABC transporter, permease/ATP-binding protein. This protein is related to a Proteobacterial ATP transporter that exports lipid A and to eukaryotic P-glycoproteins.	3.82245e-134
NZ_CP044031.1\|WP_150339730.1\|1088308_1089757_+\|replicative-DNA-helicase	gnl\|CDD\|181676	PRK09165, PRK09165, replicative DNA helicase; Provisional.	0
NZ_CP044031.1\|WP_045918527.1\|1092146_1092602_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	7.24895e-19
NZ_CP044031.1\|WP_045914354.1\|1084745_1085531_+\|succinate-dehydrogenase-iron-sulfur-subunit	gnl\|CDD\|235652	PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed.	5.38652e-165
NZ_CP044031.1\|WP_150339720.1\|1081925_1082309_+\|succinate-dehydrogenase,-cytochrome-b556-subunit	gnl\|CDD\|239579	cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Members of this family reduce high potential quinones such as ubiquinone. SQR is also called succinate dehydrogenase or Complex II, and is part of the citric acid cycle and the aerobic respiratory chain. SQR is composed of a flavoprotein catalytic subunit, an iron-sulfur protein and one or two hydrophobic transmembrane subunits. Proteins in this subfamily are classified as Type C SQRs because they contain two transmembrane subunits and one heme group. The heme and quinone binding sites reside in the transmembrane subunits. The SdhC or CybL protein is one of the two transmembrane subunits of bacterial and eukaryotic SQRs. The two-electron oxidation of succinate in the flavoprotein active site is coupled to the two-electron reduction of quinone in the membrane anchor subunits via electron transport through FAD and three iron-sulfur centers. The reversible reduction of quinone is an essential feature of respiration, allowing transfer of electrons between respiratory complexes.	2.02909e-31
NZ_CP044031.1\|WP_150339699.1\|1056955_1057525_-\|elongation-factor-P	gnl\|CDD\|234788	PRK00529, PRK00529, elongation factor P; Validated.	1.10057e-79
NZ_CP044031.1\|WP_150339725.1\|1082923_1084711_+\|succinate-dehydrogenase-flavoprotein-subunit	gnl\|CDD\|236375	PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed.	0

>NZ_CP044031.1|WP_045913377.1|1074411_1074744_-|iron-donor-protein-CyaY
MLERNFIVLASQAISQIADSIISQDLDGIIDVNFIDEMILYITISTKQFVITGHTFARQIWLVSPISGPHHFSYIDNKWLNRDKQDIWPLLQTEINQLTGFNIHLNASNE
>NZ_CP044031.1|WP_045916484.1|1072667_1074428_-|ATP-binding-cassette-domain-containing-protein
MHLMSNYKILHLFLKYLQPYRFKIFIVLISLIMVSGSLLYVGSAIKLLIDHNCSCVNIIMAQISITIVIFSIFSFLRSFTINSISENLILDIRSDLFKHLLKLRISTFAKLKVTDINNRLLSNINNIGELINNLFSFILRNSIMFLGSLMLMFAQSNKFTYLVIIMFITIALPMIKIGHYIRTLAHITQFELLKIHSKIDESFNNIKLIYAFNQQSHQVDTLNTIQREYFVEFKRKIKLRSMFFALTMALVISAVTFIIWLGSNDIAVGVMSSGDLTSFLYYAIVAVASLGGIIESFAKFPGYFMAAEKVFSLFEIDSVESNLSTNDLHNGVIKFNNVSFSYPSRPNIAILSNCSLSIAPGQFVGIVGKSGAGKSTILQLLIKFYDPTTGTIQINNVDISSVHLPQLRKNFSYIPQETYIFSDTIKNNILFSNQHASSEDIAYAIQVALLDEFLTKMPDGLNSFIGEKGNMLSGGQKQRLAIARGLITKAPVMLLDEATNAIDSKTEKIILNNLRSISPQKTIIVVTHRISAIEQADNIIVLDNGKVNAQGNHAELMKHCQLYKELIRRRTNSSNCKIIAVNKLIE
>NZ_CP044031.1|WP_150339714.1|1065782_1070306_+|hypothetical-protein
MKPQHIFLVIIVAIINFITVANATASICTWFRGSRTETWNGDNEDLQGIIKRRKHLSFWQKREKQFTSTENCPPYYKYGGRRGCLLKFEEPATIFDSKFWTTVVDNSQTPDWYYAPGYLRYCGEETMATSYFNPKIRVRHQSCNAIACWHNDSNLSHGDCAVFATSLGIPLLRICARIAIPDTTSFDQNEKSICASDSITNDPLCQYNAKDDPGYTRCYHLNLQGGQEPDKIYDSVDDNCKARIIAPKLCLYVDPSLTSLSALLDPFDYNPVSQPLHSGSQIFPVGKILIELVNAGTSLADALVALVGIVVDKTGLSFLKDIVRFIGNVIQLVGSTFVDILKGAFDLNIVVNPEVLGCVELPLGPLPPPFYNELQKTASGKVEIIPICSKEELNLENKENINVASSQCAVSNIHNNIISNAVRISNSNQLPLCQNGEEGEKSYKANQCVKIQNIELLGPSVIRKKYNDVLKLCKYGNSDEPCVNYNGCEDSDNQLAGCQGRGFRVLYATNIKGKVVDDISQLEPSEKFNYCLPDCVGARCPIPASPGADSCCEGAQLCQQVYGVNVGNFDDIKLVFQQDKVNEGKNGVVKESIRFNGKDFIALITRTTRPICKELLQSSDSNIKCDDPQIIHEQTSDDICVYNINNTKKPLIGCVKRAAPPLPTAFKCRNSKNNHFKPDIGIKLEVKESETNYSLEGCIEAKHSHHQNRTNDVEDDENNNQFNINLAGYDYNAYVTDHKGSVSPDVGTKWGKYDSEAPKDAQDVQSHNAKYRYLNGIEFINNEYVVGGKLICVNQNSNAIPKCPLDEKMCVLAKVKENPECIKAQQNNNTQQNFGPETCKEVSQSIEDRVYPRDFALCNEESADYPNCFKLGTNEHYQLTKTGFGNTMSLSGSSIKTEEDIMQTIGNCGSETVESKECVSYSPRKYIYRFNTVQEVLKCKTDHSRCTVNVRSCTNDELMDRANTQLTNDAVKSETALIGLFKTTNNLICSGVIDKVCKDVKYKCQPKFTISDNGTVIDIETCIDSASASASANKKKATPITDFVCSTTKLESCDKLSESKFYTFTNSHENLIRHYNSANLLGELVETKKYVNKLDTKAVLIDPKFCGNRIKQCPENKHCTIFDEGKKFILGDEQEYVIKRCQTQLCYAKTSEEKKVDKDDALVKSPYEGDGKTRFRSKNALELGLCQVIPDIPKCKQEESYNAIWPETNPGDQAIGKCKQGTNPRIKYIPINKDSLKRRCLFDPAIDASSNVHFTSGDTAKPVFELPKKKTVGCKEYKVKCSKISENGVIWPAVEVDATSQPKCVNKAHKLSNPNATRKCELDHKNNPVFTSPTAHVTCSHPDKCDRLVDTKNGVVWSEAKVGEISRSTCVNQNHKLSHPTARRKCVLDNKGGIPRLELNAMIDTEDHITRGHRIRYILASNVTCYNPNKCSEVLENGIIWSEAEVGKESRPRCENPDYKVSHSVVTRMCLNDNGVPKLASTVSYSLSPIGPVSASVSSIKCLPRLR
>NZ_CP044031.1|WP_150339712.1|1063326_1065783_+|virB4-protein-precursor
MGFIHKFLHSRKIDAKQFDSNAQNFIPITCHYNDETLLTKNGELIQILQIKGINSEYTNKDLLGIRAAIRNAIKNHINNSNFAVWIHVVRRCDNIDDSTPYSQALPNFIHNIWSKKNYWQDKFVSTLYISIVHHGCNLNIRNLDSFLNSLSFKTLDSFYDKFIVSALKNLSIATNNIITELQRYNPCKLSIKIDNNKVYSDLLNFYKKIIQLNTGLIEVKDVDCAVQLATHKYSFGGDKIEVIHKQEKKFASILGIKEYQDIKDELVSKCLHAPVEFIATEIFYFADQVKAINSYSQQSKVISASRDSELALFKGIEPIVNSDNTLPQFCHQQISIMIMADSIDLLESRVAYISQRLVKQGIIHVREDINLAQTFWSQLPGNFNYIRRVSYNIIDNVAALAALHHYPVGMQHSRWGRSITIFRTECGTPYFMNFHDESAKGHTCIIGGAQSGRATIANFLLSEASKYSPTILYLTNRNNAQVFIKGIEGTWYNGRDLPFNPLSYLESSDDLLELFKIITGNYFNNLTDSEIECITELAIAVMDMPPESRSLIKIIKDFNFKAYSAGASVKKRIKLFISDDKCSKIFNQSSTLELQDNNVTAINLADYTDYQFNQSYTPQVGEKPEIYHNKLQTLHCLRSGIIFSLIKKFSLLASPEPKILVVDNMPDLIVEQVFMNLIKQITEQLSENNGIILSVVQVNQNDQFYYSDFWKKWLKFNNTKIILPTNIRNLPIAEICNLSTREAKKFNTISPNSRLFMVKQDNNYVIVELNLEGFPAIRKLLSAEEEDLNLFHKIMQKIGDDAPSAWLSDVYDQFQNSE
>NZ_CP044031.1|WP_150339709.1|1062035_1063052_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MRIAVNGLGRIGRLVVRAITLLQDSRLELVAANSLAESDIIAHLLNYDSTHGKLTNRFQYNNNYLFNSTSKISLFRQSKPETIPWKKENIDIVIECSGKFNSKNAAIAHLTAGAKKVIISAPCENADATIIVGVNDHLLNSNHNIISVGSCTTNAVAPIVKILNDKFGIQCGHITTVHAYTSDQNILDNSHKDFRRARSCFASIIPTKTGVSTSLKEVIPELANCLDGSSVRVPTSNVSLIDFTFYSHKTLTVQSINNEIKESAKLANMKDILDIAPAPLVSVDFNHSKFSAIFDPYETKVVGKNLGRIVVWYDNEWGFVHRIIDIVKIVELCCRDER
>NZ_CP044031.1|WP_150339707.1|1060734_1061955_-|phosphoglycerate-kinase
MIQLRQLSDVIVKDKVVLLRLDLNIPQEGGKITDNTRIVRTIPTIKYLILHGAKVVIISHLGNPKSRIELTLSLRSVVTELEALLNIKVQFCPESIGATPKNAIIKMKAGEVLLLENLRFNSGEELNDATFVNELSSLGDIYVNDAFSCSHRKHASICGLPAKLPSAAGFLLLSELKHLTSIFSNANKPFTVIIGGAKMSTKLDLLNSLITKADYLIVAGAMANIFLAMKRFNIGASLYKPELVNVASLILKKATSTNCKIILPFDAVIQNFNSNNITIIELNSSLVMQSNAKIMDIGPKTIAQIINIIKISKTIIWNGPVGAFEQPPFDHGSTYLSKAIAEKTRTGSLCSVAGGGDTISAIKKSGVIDDFSYISTGGGAFLEWLQGKTLPGVEALMQKLDTAKYI
>NZ_CP044031.1|WP_045917961.1|1060427_1060721_-|hypothetical-protein
MIVIVYNLDDAIKELNSIHVPVIITNPPGSIKYLGALTIDYLFKILKNKFNNISKVIINVEDDIPALFTLLKLNYSRSEIIYTGSSESAKKLLQLYN
>NZ_CP044031.1|WP_150339704.1|1059111_1060413_-|proline--tRNA-ligase
MRLSQYFLPLLKEDPAGAEIISHKLMLRAGMIKQACAGIYNWLPLGIKVLQNIQNIVRKNMNAAQCIELLMPCIQPAGLWKESSRYNAYGKEMLKIKDRHDNDLLFGPTNEELITDIFRSCIQSYKDLPKNFYHIQWKFRDEIRPRFGVMRSREFIMKDAYSFDIDQTSAIQSYNLMYLTYLKIFKDLGLKVIPVQADNGAIGGKLSHEFHIITATGDSKIYYDSTKFNPFDYNQDLSLNKLEQLYIVTEDKHKTDQNQISNDKISTISGIEVGHIFYFGTKYSELMKACIQLQNGKLTAVEMGSYGIGISRLIGAIIEANHDQYGIIWPQNVAPFKVSVINLLPNNDKCKQISNQLYQILTQQKTDALLDDTSSSAGHKLATHDLIGIPYQIIIGKNFIETSTIEFKYRHNHQLQKLSIDALINQLTEISKH
>NZ_CP044031.1|WP_150339702.1|1057730_1058984_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX
MAKKIDNKALSCSFCCKNQNEVKKLIAGFSGFICDECIELCIHLIEEERKSNLAISNYSKLPPKKIYEAINAHVVGQQQAAKILAVAVYIQCIRFEHRELADLVAKSNVLLIGPTGCGKTLIAQTLAKIINVPFAMADATSLTEAGYVGEDVENIILRLLQAADFNVERAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKIMEGTIALVPPQGGRKHPQQEFIQIDTTNMLFICGGAFTGIEKIIEARTSQSTIGFEATVKSKHDQDYNQILNNLEADDLTKFGLIPEFLGRLPVIATLSDLNQESLVDILTKPKNALVKQYQKLFELDGAELIFEQEALVAIAQKALAKKTGARGLRAILECVLLDTMFELSNLKNMQVIITADIVKNNLKPIIKPKLQKKSVKKKVTA
>NZ_CP044031.1|WP_150339699.1|1056955_1057525_-|elongation-factor-P
MKILANAIREGNILEYQNNLWIVSKKPDHTKPGKGGAYIQLEMKNLKTGTKIYERFSSSDYLEKATLEQRSYQYLYQENNHLVLMDLESFEQILVQKSIIASNKLPFLLENTVVTVETYKDEPVRLVLPHTVVVEILETSPNIKGATVTASYKPAILSNGAKIMVPPYLTAGEKIVVKLEDISFVERAK
>NZ_CP044031.1|WP_150339720.1|1081925_1082309_+|succinate-dehydrogenase,-cytochrome-b556-subunit
MNKFNNSHTRPISPHITIYRMQMSMILSILHRLSGMAVFGGASIITWWLILCVYSDFDRVVVDIFYNLWFQALIYLTIFTTCFHLCTGIRHLIWDTGYGFSVKYINISGWIAVALSIIVFYMCINNF
>NZ_CP044031.1|WP_150339722.1|1082339_1082729_+|succinate-dehydrogenase,-hydrophobic-membrane-anchor-protein
MKAPNLQNSLNTIKNLSTDKYCVQHWWYQRLSAILMLPLLVWLVFFGKAIVQKSPVELVELVKYPYNVLMIILLLITMFFHAAIGLKVIIEDYVNNLSVRYLLIVLVQCFTFVTVVAGIISIILLCINY
>NZ_CP044031.1|WP_150339725.1|1082923_1084711_+|succinate-dehydrogenase-flavoprotein-subunit
MKAYKIINHEFDVVVVGAGGAGLRAIVGMAESGLRAACITKLFPTRSHTVAAQGGISAALGNIQPDKWQWHAYDTIKGSDWLGDQDAIAYMCKEAPAAIIELEHYGVPFSRTADGKIYQRPFGGMTTEFGDGAAAVRTCAAADRTGHAMLHTLYQQALKHKAKFFIEYIALDLIMDNGACKGIVAWNLDDGTIHCFRSHIVVLATGGYGRAYFSATSAHSCTGDGNAMCARAGIALQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSEGERFMERYAPSAKDLASRDVVARAMTMEINAGRGVGIYKDHIFLHLNHLDSKTIQQRLPGISETAMIFAGVDVTKQPIPVIPTVHYNMGGIPTNYHGQVVTKTENGDMEIVPGLMAIGEAACVSVHGANRLGSNSLLDLIIFGRAAANKAKEIIAISTKHQPLGNNIVDAIIERFDQTRFLNGNMPIAELRLTMQRAMQNYAGVFRSYDKLTEGMKIIKQNFNSRTDIKLTDHSLIWNTDLVEAIELQNLLYQAAITMFCAANRQESRGAHAREDYPNRDDDNWLKHTLATIDEEGNVDIDYRNVVLDPKDDEMMAIVPKKRVY
>NZ_CP044031.1|WP_045914354.1|1084745_1085531_+|succinate-dehydrogenase-iron-sulfur-subunit
MVEFRLPPNSKVKVGKRYAAKDSVKKVKRVSVYRYSPDTGDNPRIDIFEIDMENCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCSMNINGTNGLACIKAINDIKGDVIIYPLPHMSVIKDLVSDMTHFYAQYQSIEPWLKAETIDITSGERLQTPEDRDKLDGLYECILCACCSTACPSYWWNADKYLGPAVLLQAYRWIIDSRDEHASERLDQLEDSFKLYRCHTIMNCTKTCPKGLNPAKAISEIKKKMFERHGV
>NZ_CP044031.1|WP_150339727.1|1086734_1088300_+|hypothetical-protein
MRPVVFVFLTNSCNIIKKNSNNNDTIFYNFIGNIIPPEWRKLTGDNGKALSKTSKQLLSFIVFRLHIYYNKDIDELQESYQLYEDKLNVCQRRVRQCLVELRDAGFIEIENRTIIKDNLKLRNVHCIKILKNFQHYSEKGKEENIALPEKNFCPNMKEISGQPETFFRDIYRYIKKSKISRSTEGELVENKKNENEEQNFQNVDDFENDIQTSIKNCNQDIESLITKILKSSNGKKEWFKRYRLEEFYPLTPEDVVTLQHKSDRGFNIYFINKLLLKLAGRYSNYHFGCKSSVLNYIAKALANELRNTDQTNSGNCRLDNVEKFNKEKYLTQIEKSTNLSKESQLKHKIAGSFEAAMAYQILTSCSFGPAVRTRFFVKLLKNITLTECDRSKILQAVQDVYGYEIQELQVTPFEQLKTVSQKQINEEEYLLNLSKQLGSNSTWYKVRESLVTCYGQAIDKSWFSKLEVINEDSVNKKIFIKAKTEFEDSYIRENYLKDLESAFKAQGFSFELVKFSNFNKI
>NZ_CP044031.1|WP_150339730.1|1088308_1089757_+|replicative-DNA-helicase
MEKDLAKIAPSNIQAEQMILGAILINNRALYNINEFLLPEHFYEPLHGKIYKSINLIISKGISATVISLKNMLGNEPSFDEIGGVDYLAKLTTLALSIVNVNEYGKIVYDLALRRYLIEIGEKIVTNAYSSTLADLAISQIETAESQLYDLGARGTLSKGFTKLQTSIEESWTSISSAIKNKNSINGISSGLLDLDSKLGGFKNSDLIILAGRPSMGKTALGVNLAINACKYFLSSSTQQNSKVSNITPSVGFFSLEMSSQQISTRILSIESEINSSALFNGKIDEQDVDKLKTVQNEIQKWNFFIDDAPAISISAIRSRARRLKRTHNLAILFVDYLQLIKIDNRRSQYNRVQEISEITQSLKALAKDLNISIIALSQLSRAVEQRTDKKPILSDLRESGSIEQDADIVMLIYRDEYYLSRSEPDPGTREHIEWKARQNKCYNTAEIIVAKHRNGPVGTVKLHYNSRYSKFSNIIKNSHQG
>NZ_CP044031.1|WP_150339733.1|1089899_1091027_-|hypothetical-protein
MNTMSHMLAILNYSGYAAYTKLAHGAKLSKQSMYKDSIFIKGTSISFPCDNIRRLLSINESINHSIWLEKLKLSSGLADCNNNCMIGFYSSSSLIWIENADNFHLLTNNQIVSQSSFSAPIINSLSSVNFCRQTKATSFSSYALHDLELWSLIRGNVLIKIKNVLKGIKNIEPMQPLEWKAFGAFMDMFFVELSRNPATLITLPMCFDIYNHLTNDKNKAHLNEFINKNSLYPERPNHEVLRCILTEYFPMSMTGALHVSIHFSNIIEQVLKENKLDKYCYSYDLRDGDAPSYLYISKFITIEKRLINAYQYFISKFNDDIYSFAESLDNLLVSWYGSDCNIDGLCSQEIANNAGNNNGMDTTIGIANNIYALYE
>NZ_CP044031.1|WP_150339639.1|1091480_1092050_-|hypothetical-protein
MRISDTSDSIQILPNSNNLAELTKLVHNCIFNHKGYNILFLLGWDNTTYRNIQDKILQLRNTETETIRVIRSTQDDIPICLEYFCEDQSAQNVLYTQVSFTFNTLRLIVEKYYYVSIRFKPYKSNLAIVYNSHNENLQKQLDDFFTQQCMNHNESSKCIHHNESSISVLDIDQFRDFVGDILLIDDPER
>NZ_CP044031.1|WP_045918527.1|1092146_1092602_-|conjugal-transfer-protein-TraD
MANLMQQKITLQQKKAKLIMDEVNLKIKERKMRTRRLIEMGGLVAKAKLDHLSANTLFGAIVSLKETLTQHPNVQNHWTTIGKDIFDKEQQNKAAVILKFSSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIEALTNGLLNVQYSIELVS
>NZ_CP044031.1|WP_109227404.1|1092897_1093056_+|conjugal-transfer-protein-TraA
MAIQFARTEFLSRSKGGDSCRKAAYNARTIVKNEQTKIRYNFFLLSRMLKKQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044031_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044031_3

1645623-1645741

Orphan

Consensus_repeat	Method
AGCTGAAGGCAGAGCTGAAGGTA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP044031_3

>merge|NZ_CP044031|3|1645623-1645741|CRISPRCasFinder
GACTAAAGGCAGAGCTGAAGGCAGAGCTGAAGGTATAAAGCTTGGTGAGACTAAAGGCAGAGCTGAAGGCATAGCTGAAGGCATAGCTGAAGGCATAGCTGAAGGTAGAGCTGAAGGTA

>NZ_CP044031|3|2|1645623-1645741|CRISPRCasFinder
GACTAAAGGCAGAGCTGAAGGCA	GAGCTGAAGGTATAAAGCTTGGTGA
GACTAAAGGCAGAGCTGAAGGCA	TAGCTGAAGGCATAGCTGAAGGCAT
AGCTGAAGGTAGAGCTGAAGGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044031.1\|WP_150339752.1\|1633790_1634600_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	unknown	unknown	gnl\|CDD\|273146
NZ_CP044031.1\|WP_150340205.1\|1653463_1655155_-\|conjugal-transfer-protein-TraN	unknown	unknown	gnl\|CDD\|369160
NZ_CP044031.1\|WP_150339758.1\|1635295_1635994_+\|histidine-kinase	unknown	unknown	gnl\|CDD\|367112
NZ_CP044031.1\|WP_150340203.1\|1652768_1653467_-\|conjugal-transfer-protein-TraF	unknown	unknown	gnl\|CDD\|372692
NZ_CP044031.1\|WP_150340502.1\|1659990_1660410_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP044031.1\|WP_150340418.1\|1655151_1655559_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	unknown	unknown	gnl\|CDD\|370610
NZ_CP044031.1\|WP_150340191.1\|1639934_1640390_-\|conjugal-transfer-protein-TraD	unknown	unknown	gnl\|CDD\|368890
NZ_CP044031.1\|WP_150340207.1\|1658079_1658541_-\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|319756
NZ_CP044031.1\|WP_045919541.1\|1658652_1659054_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150340201.1\|1648830_1651470_-\|conjugal-transfer-protein-TraG	unknown	unknown	gnl\|CDD\|369594
NZ_CP044031.1\|WP_150339763.1\|1638219_1638807_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|223394
NZ_CP044031.1\|WP_150340199.1\|1647660_1648806_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP044031.1\|WP_150339761.1\|1637673_1638168_+\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP044031.1\|WP_150339749.1\|1633283_1633787_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150340197.1\|1645902_1647657_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|313610
NZ_CP044031.1\|WP_150340470.1\|1636221_1636695_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236848
NZ_CP044031.1\|WP_150340189.1\|1638928_1639867_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	unknown	unknown	gnl\|CDD\|372314
NZ_CP044031.1\|WP_150339755.1\|1634967_1635231_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044031.1\|WP_150340193.1\|1643682_1644786_+\|conjugal-transfer-protein-TraI	unknown	unknown	gnl\|CDD\|274285
NZ_CP044031.1\|WP_041621693.1\|1659602_1659938_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044031.1\|WP_150339752.1\|1633790_1634600_-\|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase	gnl\|CDD\|273146	TIGR00571, DNA_adenine_methylase, DNA adenine methylase (dam). All proteins in this family for which functions are known are DNA-adenine methyltransferases. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). The DNA adenine methylase (dam) of E. coli and related species is instrumental in distinguishing the newly synthesized strand during DNA replication for methylation-directed mismatch repair. This family includes several phage methylases and a number of different restriction enzyme chromosomal site-specific modification systems. [DNA metabolism, DNA replication, recombination, and repair].	7.10385e-51
NZ_CP044031.1\|WP_150340205.1\|1653463_1655155_-\|conjugal-transfer-protein-TraN	gnl\|CDD\|369160	pfam06986, TraN, Type-1V conjugative transfer system mating pair stabilisation. TraN is a large cysteine-rich outer membrane protein involved in the mating-pair stabilisation (adhesin) component of the F-type conjugative plasmid transfer system. TraN is believed to interact with the core type IV secretion system apparatus through the TraV protein.	8.0021e-106
NZ_CP044031.1\|WP_150339758.1\|1635295_1635994_+\|histidine-kinase	gnl\|CDD\|367112	pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.	4.47911e-06
NZ_CP044031.1\|WP_150340418.1\|1655151_1655559_-\|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC	gnl\|CDD\|370610	pfam09673, TrbC_Ftype, Type-F conjugative transfer system pilin assembly protein. This entry represents TrbC, a protein that is an essential component of the F-type conjugative pilus assembly system for the transfer of plasmid DNA. The N-terminal portion of these proteins is heterogeneous.	3.61784e-20
NZ_CP044031.1\|WP_150340191.1\|1639934_1640390_-\|conjugal-transfer-protein-TraD	gnl\|CDD\|368890	pfam06412, TraD, Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer.	8.32704e-19
NZ_CP044031.1\|WP_150340207.1\|1658079_1658541_-\|conjugal-transfer-protein	gnl\|CDD\|319756	cd16430, TraB, TraB is a homolog of VirB10 which forms part of core complex in Type IV secretion system (T4SS). This family contains TraB (VirB10 homolog) and a component of the type IV secretion system (T4SS), and similar proteins. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TraB is localized similarly to related proteins in other systems, but unlike in other systems, Neisseria gonorrhoeae TraB does not require the presence of other T4SS components for proper localization. It has been shown to be expressed with TraK (VirB9 homolog) at low levels in wild-type cells, suggesting that gonococcal T4SS may be present in single copy per cell and the small amounts of these proteins are sufficient for DNA secretion.	4.42012e-36
NZ_CP044031.1\|WP_150340201.1\|1648830_1651470_-\|conjugal-transfer-protein-TraG	gnl\|CDD\|369594	pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions.	3.0619e-42
NZ_CP044031.1\|WP_150339763.1\|1638219_1638807_+\|HD-domain-containing-protein	gnl\|CDD\|223394	COG0317, SpoT, Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription].	8.91443e-31
NZ_CP044031.1\|WP_150340197.1\|1645902_1647657_-\|type-IV-secretion-system-DNA-binding-domain-containing-protein	gnl\|CDD\|313610	pfam10412, TrwB_AAD_bind, Type IV secretion-system coupling protein DNA-binding domain. The plasmid conjugative coupling protein TrwB forms hexamers from six structurally very similar protomers. This hexamer contains a central channel running from the cytosolic pole (made up by the AADs) to the membrane pole ending at the transmembrane pore shaped by 12 transmembrane helices, rendering an overall mushroom-like structure. The TrwB_AAD (all-alpha domain) domain appears to be the DNA-binding domain of the structure. TrwB, a basic integral inner-membrane nucleoside-triphosphate-binding protein, is the structural prototype for the type IV secretion system coupling proteins, a family of proteins essential for macromolecular transport between cells and export.	0
NZ_CP044031.1\|WP_150339761.1\|1637673_1638168_+\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	9.45897e-09
NZ_CP044031.1\|WP_150340203.1\|1652768_1653467_-\|conjugal-transfer-protein-TraF	gnl\|CDD\|372692	pfam13728, TraF, F plasmid transfer operon protein. TraF protein undergoes proteolytic processing associated with export. The 19 amino acids at the amino terminus of the polypeptides appear to constitute a typical membrane leader peptide - not included in this family, while the remainder of the molecule is predicted to be primarily hydrophilic in character. F plasmid TraF and TraH are required for F pilus assembly and F plasmid transfer, and they are both localized to the outer membrane in the presence of the complete F transfer region, especially TraV, the putative anchor.	1.61207e-54
NZ_CP044031.1\|WP_150340199.1\|1647660_1648806_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	6.96205e-21
NZ_CP044031.1\|WP_150340470.1\|1636221_1636695_+\|sensor-histidine-kinase	gnl\|CDD\|236848	PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional.	5.1773e-08
NZ_CP044031.1\|WP_150340189.1\|1638928_1639867_+\|Rpn-family-recombination-promoting-nuclease/putative-transposase	gnl\|CDD\|372314	pfam12784, PDDEXK_2, PD-(D/E)XK nuclease family transposase. Members of this family belong to the PD-(D/E)XK nuclease superfamily. These proteins are transposase proteins.	9.57427e-47
NZ_CP044031.1\|WP_150340193.1\|1643682_1644786_+\|conjugal-transfer-protein-TraI	gnl\|CDD\|274285	TIGR02760, conjugative_transfer_relaxase_protein_TraI, conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.	5.04172e-12
NZ_CP044031.1\|WP_150340502.1\|1659990_1660410_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.31277e-17

>NZ_CP044031.1|WP_150340193.1|1643682_1644786_+|conjugal-transfer-protein-TraI
MTIIAEGAETALSLQQSGIKGNIIASAGISNLRNYSPFPGEKIIIAADNDSKNSITNNTVIKAAKTLEMKGAITCIVKPPENGDFNNLLQTCGDQSIRDIIEPEITKLTKAVETTKLTQTENNSIEKQNDITNVKELYNKSSSLYYLKQEEEAKVEAIVVNKFLEKHTGIYSSKIFNNSNLRANMVFDEESQKSWPALTIFVKNETGEITGAKILALNSKTCNKADVAEKSVGTISGSFAEIAQQNSKYSPVTIITKDIETALTIQQAGVEGKILCAIEAENLQNYNPGPKEKIILAVKNDVNTEKAEKVLEDKEAVVCTVKNDFNNVLKTQGLYAVRNIISPEIRKLNEKIESIQTNIQPGLCPKH
>NZ_CP044031.1|WP_150340191.1|1639934_1640390_-|conjugal-transfer-protein-TraD
MANLMQQKITLQQKKAKLIMDEVNLKIKERKMRTRRLIEMGGLVAKAKLDHLSANTLFGAIVSLKETLTQHPNVQNHWTTIGKDIFDKEQQNKAAVILKFSSEPDENTKRHIRLHGLKWNSFRQEWCGHVKDIEALTNGLLNVQYSIELVV
>NZ_CP044031.1|WP_150340189.1|1638928_1639867_+|Rpn-family-recombination-promoting-nuclease/putative-transposase
MHLSRFLDPKNDVAFKKIFGSEKNKDILIHFLNDILLFEGNRKIIEVEFLGTILDADIASKKESIVDVLCKDKNGAQYIIEMQVDPTQGFEKRAQYYAAKAYGRQPNRGKEGKYSDLKEVIFIAIADYKLFPNKEDYISRHVILDKKAYEHDLKDFSFTFIELPKFKKNRVEELSDITEKWCYFFKHAKETTLDGYNKIIGKDLIIKRAYEALDQFNWSEDELITYEQELKRIWDNKAVEDYKLERAKAEGKAEGIKLGEAKGKAEGKAEGKAEAKKDLAIKLLKSELSVETIAEYTDLSIQEVLNLKNSVK
>NZ_CP044031.1|WP_150339763.1|1638219_1638807_+|HD-domain-containing-protein
MLAFLNCEHINKLLDKLDLINHSFDKRINLDKVKKAIFYAKKYHSNQKRDTGEPYYMHPLEVARMVADYSFKTDTIITAILHDTIEDTTLTKEKIAIEFNDNIAEQVLALTRNRGGKKTSSIKMIKTLVNQDKVELLLIKLLDRLDNIKTIFIKPVKRRQEIILETQQEFIPLAEYLKLPEIAIKLNKYCERYAT
>NZ_CP044031.1|WP_150339761.1|1637673_1638168_+|HAMP-domain-containing-histidine-kinase
MSHTIKSGDFGIQAKVNSTIIALKPFTENKGINLSCNFKNDIKDLIIVNSTQIQKVLTLLICNATNSKCSEISVEVDLLPSTNKKTNYRILQLIVSNNGIGISAEKVKKINNELRNLHIKSYAVLGSELLLVKPFIHEMTGKIKLESQQDKYTAFTCSIPIEVR
>NZ_CP044031.1|WP_150340470.1|1636221_1636695_+|sensor-histidine-kinase
MLNGTIAAIRLIAADENIELRKKIGNDIYDIITGDRFRIRAVLTQLVGSAIMHSTNSKVRVSIDFLPPKNEQSNSKDRILQFVVHSVGAGISKNKLQEMNSELKNPHLIKHQALDSGLELIKHLTYEMKGSIKIESKEGHYTKFLVSIPIQISNLNS
>NZ_CP044031.1|WP_150339758.1|1635295_1635994_+|histidine-kinase
MENNIYLIQYIRHIVNNCNKTKRNIVELVGYKQDAIAKITDTLGSLDELINHLNDKICVFRKNIESKNVELENFSLQTFVKDTVARLKAIVEDDRIDLKSNFQANIKDNIIGDSLRIRAVLSQLAESAIIYGTKGTTINICVHLLPSQDGKTDSKDKILQFLVQNICPSIQKEKLQKMNSELSNSNLTKHQELGQGLVFIKQLTHQMKGNLKIDQGSNYISSSFEVPIQLYT
>NZ_CP044031.1|WP_150339755.1|1634967_1635231_+|hypothetical-protein
MSLGNEGQQKNKNIQSKLLLRHLAAGDKELLKLTHQIKTLNLNIIDVFKQLKSESEDVRTLQSEIIENKKSTLREAICHIPISLANS
>NZ_CP044031.1|WP_150339752.1|1633790_1634600_-|Dam-family-site-specific-DNA-(adenine-N6)-methyltransferase
MSVAVANKSKPFLHWIGSKRRIVNKLIEHLPQGPHYNYYEPFLGGGALFFQVRHLFKQCFLSDINLDLITSYNAVKNNPNEVNRLLSLYHKHHSKDYYYKVKNKYSNNPNEITAKFIYLNKYSFRGIYRVYKNGQSAQTFSGECYIKLHIASRINQCSNLLHGVSIYATDFSFIEPQQNDFVYFDPPYHKSGERFYTRVPFDEKEQIRLRDFVYELNNKGVKIMLSNNNTTFIKDLYKDFFITHIGVTYSINEQRNLVNELIITNYKTC
>NZ_CP044031.1|WP_150339749.1|1633283_1633787_+|hypothetical-protein
MNVLKSLLQPCYAVMLAFVVLSSPSICTANNNVNFNAFKDSIDTSQFYIKFSTGIATNYDTLEAGIGYRLDRHRMDVRLGFMCHHKCRDNFIQGNYYYNIIEGNKASIFVTGGLVSVFNGDSDTGIDLGVGTTINLSRDTYLDIECSTIANYRPLHIHIRFGLRVHI
>NZ_CP044031.1|WP_150340197.1|1645902_1647657_-|type-IV-secretion-system-DNA-binding-domain-containing-protein
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVCLSSLYYFTIERYVQLKLAIGEHFYDIDQIGIKFYSLRFKKWIHLNAQDFLHEFYTGQHGFKIQQLWEFLINSALLEGLIVFAIGVIISIVFFTAQGKNTIIKAKIRGADFVEYKCLSKMLKSAKKASKICFGGLPLVKNSERLHILITGTTGTGKTNMLNELLPQIRLHKDRAIIVDTTGAFTDRFFDHKCDKLLNPFEKNSEQWLPWNDCFEAADFHDIASSFSNYTHKIDDFFAKNAELVLSEALKLYKDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTLGKNITSLQYLKPGGSFSIKEWFSNSNETSWLFITATPNQRATLCPLISAWISIAIKALMCRNPNHDNKNMWFILDELPALQKVSSLPVALAESRKYGGCFVAGLQNIHQLEAIYGAAECASMLDLFNSKFIFRVSDQVTAYKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKILVMPSEIMNLPDLTCYVKLAGNFPITKLTMQLQNLNTAFVWGYKLLKKLKLVEY
>NZ_CP044031.1|WP_150340199.1|1647660_1648806_-|tetratricopeptide-repeat-protein
MKNIYKLAIIIILQVMLLNRAIAIEENKLIQQNSIKDENVLAREYFNIGSSFLRLKKYQAAIENFDIAIKYNPNYPEAYLEKGIALNDSGKPLEAIKNYDIAIKYNPHFAEAYNNKGASYGKLGKDKEAIRFYDLAIKYKPNFAKAYNNKGASLSRLGQYEDATENFDIAIRYNSSYPEAYYNKGIALMNLGYIQEAIESCDIAIKYRPNYSEAYHNKGLTLAILGQFQNAIEHFDLAIRYDPNDSKAYCNKGYVLNLLERYSEAMENSNLAIKIDPNCADAYCLKGMVFEKLGKHQEAIKNYDIAIKYNPNFDKNYLEKGISLVNLGQYSSAKENFLLAIKYNPNIIAEHETMLKRLTELKNFTGVKEYEQKLQILKKYS
>NZ_CP044031.1|WP_150340201.1|1648830_1651470_-|conjugal-transfer-protein-TraG
MDYVIYTFGGGDLLWHVFNGIGRVFASNSEYFTPVGHLALTIGGIWAATRAIFRGNIGIFAMEWFFPSIFIFTLLFAPKSTVWLKDEVSMSAPVKVDNIPIGIAMFASLSSQTSYFVSKMLENHLLPAYEGLSSRKTGIMFGAKAVAKIRDVQIHDPVTLTNTKEFLRQCFMKPYIIGNILGKKAAAQQTNDIIGFIEQNIPNNFGIYYREPSNLGISFKTCRQATPLIKAAIHKELNEGLLTNFAAAIGVQSDQSHMLSQRLKVMIEDTLKYLQREQQDIHEWMKQAMLLNANRESYDDWREKFSLSRIYPNLVSMHAIRGLFQQSFSYLVAGEMAAHMMPILQSVFFALVVSMIFIVFPMGLLPGGYNILKTWILLIIWVSSWPVFFTIIHCLGMISLSSKSGAFGSDYGLNMLSQGSFAEMILYSYATFQMLASSIPMLSWSVIKACAHATANLASQFSPMPVASSLGSNIVDNNLSMDNYSIGNRTISQQNLAPSLDMTDSIINYGSYKIFRTADGRQIINENVDSLLNNFRSSAMLQAGYQNQFVHSQSMLNSLTQKESNLISTGNSMAMEIGQRLTHDEIRSIGLTESEYQALQEVGSSSMATTEYTGSSHSKSSSTSTSAGGGVWGFNTKVLGGDANESNKGQSSNQQQSYNEAVSKIQSAVKEGRFSTTNSDVRSLSENLNANLSEQQSIGQEIAKTKQEMEQLSYSMNYVSQNSITIDRNINELVLNEIIAQNPEIRSKEQAARWAKDHSAEAEKIAFKVAQINNEVPKDLNDYINDGNFLNKQKLKASFDANVEQLEAIYDKSNQMHSQNIEQAFVDKEKVENLDRISDSIKNKTQEIQKKFSDTTDSTFSMAGKQALENLGITKKDKR
>NZ_CP044031.1|WP_150340203.1|1652768_1653467_-|conjugal-transfer-protein-TraF
MSRLLMFMILISHLSTVDASPTGFLWYNDKHGHELDDSTSKLMRRAHDHRIEELKEQFNRAQRIALDNPTLENVITAQRLQKQIMEKAHKFATMWQLATLLDYQLINANEPANSLHRKLYQEKSEQKNDSKLKNIAKNWGLILQVKQDCLLCKAFIPIVQSFANKYAFQLLAVSKNNELLNKLNPKHVVPVLYLVASDGKKIYAVARGIISEDKIIDNILAIDRYYHKLETR
>NZ_CP044031.1|WP_150340205.1|1653463_1655155_-|conjugal-transfer-protein-TraN
MRLLSILTLITLNISSCIASMQSSYNEASNYNVNLGNSSNTQELFHQGSNVNYPNNDEDLTYHGRNQLGTESGTMLFQAENSKNNALTQHNINDQNYMIANSMRIESDPLSALDSSNFVTQISTTNTEIIQSCTEGSKFNIELIRELNVECRLDNVWLPWQNRQMEFATEKIKENHSNWLKSRSDVYDESGAQIYCLVDDPEAIVKQMKRAIANRLGVSTQHIGRNFLLHEINEICILEYDYRDKTQELRKVAEYWKVLNSELEQLTESNECYEVNRINYDGGDRVFFDKFKVNRPFWKQKIVFSCTSDPKDGCKHLKIQNCELKNSTCQKSVANICLLWQHDYSCSTEKQTMLHSSLRNNSIFCLGGNCNTPTIIPNRDIAKVAHLAMLNQMSKDIKTNPVSVFSGKHRKCKKDVFSFLNCCSSMTGWGRDIGLSQCKSKEQELALYRKKGYCYYIGTYCSSRIPILGICLARKSTYCCFQSKLARIFQEEARKQLKLNFGTPECPKCRGLTVEELQKVDFTKINMDELFGDILTKAQNSMNKDIIAGIKDKVHRMQQSQSK
>NZ_CP044031.1|WP_150340418.1|1655151_1655559_-|type-F-conjugative-transfer-system-pilin-assembly-protein-TrbC
MRANPKLAGFVDEDWLIVLLFVNNANAFFLEQQKTFIFVSFSMSDEALKSYFAESQKAGAKLVMRGLINNSFTQTKNKTMELGISFNIDPSLFEQYKIDVVPVIVIDDEKRGLTKKLTGHIPLAIAIEIMNENTP
>NZ_CP044031.1|WP_150340207.1|1658079_1658541_-|conjugal-transfer-protein
MIGEDGRSGIKGIVVDKSSKVVKMAALNGVFSSIAKFLQTKAIKPDMTPTLNLVAGGQQQEFQIGYALQSGAYAGASNAFDKLADFAIKRADSMSPVVLIASGRVIDVVFKKGFDLREHKKKPHNLTYSQSTNNEKVNLHNKFDQSQKLEEYL
>NZ_CP044031.1|WP_045919541.1|1658652_1659054_-|hypothetical-protein
MSIRVLRFIIWFIALVNVNNIYAVEYELEADNLLKLEISDSGPTRINLKDEKINDIFMYPQNAAEVVVHESGFLFIAPREEGNKVYLTVIGEYKTIQDLMLTFTPKTPHPVMLVNAATKLEEKDNSKGKIKLA
>NZ_CP044031.1|WP_041621693.1|1659602_1659938_-|hypothetical-protein
MRNLMLQLRLKVIMQNQKLCWALSRPLKYMGLSIDEWGVVLAGVAPGIVLLNSRHAKLGLAFMVGGIALCYCFKKFKKVSENFLLKSFLVAKGLLPAPLGYSRLLGKKVGK
>NZ_CP044031.1|WP_150340502.1|1659990_1660410_-|tyrosine-type-recombinase/integrase
MKYLKQETNSEWVLPSPRDNSKHWSSEAIQCAWDKIRTKARIPNVTIHDLRRTFATWSINNGEELRTIAEILGHSRISTTAEIYTKISIEKVKAATNKVVNNILTGDNANTELDKIIPEILASLGCKEERQIINSLSEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	513949-513973	2	0.92
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	633559-633583	2	0.92
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	1823310-1823334	2	0.92
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	1850377-1850401	2	0.92
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	1850425-1850449	2	0.92
NZ_CP044031_3	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	NZ_CP044031.1	1901777-1901801	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	97286-97310	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	322832-322856	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	322844-322868	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	322856-322880	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	322868-322892	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	1749790-1749814	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NZ_CP044031.1	1316320-1316344	2	0.92

1. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 513949-513973, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

2. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 633559-633583, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

3. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 1823310-1823334, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

4. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 1850377-1850401, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

5. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 1850425-1850449, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

6. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to position: 1901777-1901801, mismatch: 2, identity: 0.92

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

7. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 97286-97310, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcagagctgaaggcat	Protospacer
*****.****** ************

8. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 322832-322856, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctaaaggcat	Protospacer
*****.***********.*******

9. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 322844-322868, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctaaaggcat	Protospacer
*****.***********.*******

10. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 322856-322880, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctaaaggcat	Protospacer
*****.***********.*******

11. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 322868-322892, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctaaaggcat	Protospacer
*****.***********.*******

12. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 1749790-1749814, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctaaaggcat	Protospacer
*****.***********.*******

13. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to position: 1316320-1316344, mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcagagctgaaggcat	Protospacer
*****.****** ************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	MN693058	Marine virus AFVG_25M517, complete genome	17501-17525	2	0.92
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	NC_018086	Enterococcus phage BC-611, complete genome	10930-10954	4	0.84
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	AB712291	Enterococcus phage BC-611 DNA, complete genome	10930-10954	4	0.84
NZ_CP044031_3	3.2\|1645694\|25\|NZ_CP044031\|CRISPRCasFinder	1645694-1645718	25	MN855932	Bacteriophage sp. isolate 485, partial genome	1319-1343	4	0.84

1. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to MN693058 (Marine virus AFVG_25M517, complete genome) position: , mismatch: 2, identity: 0.92

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctaaaggcatagctgaaggcaa	Protospacer
*****.******************

2. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to NC_018086 (Enterococcus phage BC-611, complete genome) position: , mismatch: 4, identity: 0.84

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctgaagacttagctgaaggcca	Protospacer
*********.* ***********

3. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to AB712291 (Enterococcus phage BC-611 DNA, complete genome) position: , mismatch: 4, identity: 0.84

tagctgaaggcatagctgaaggcat	CRISPR spacer
tagctgaagacttagctgaaggcca	Protospacer
*********.* ***********

4. spacer 3.2|1645694|25|NZ_CP044031|CRISPRCasFinder matches to MN855932 (Bacteriophage sp. isolate 485, partial genome) position: , mismatch: 4, identity: 0.84

tagctgaaggcatagctgaaggcat	CRISPR spacer
cagctgtaggcgtagctgaaggcag	Protospacer
.***** ****.************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

18179 : 97449

Wolbachia_phage(22.22%)

integrase,tRNA,transposase

attL 30107:30132|attR 73084:73109

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150338845.1\|18179_19184_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150338847.1\|19168_20272_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_045918451.1\|20572_21397_-	hypothetical protein	NA	NA	NA	NA
WP_150338849.1\|24215_25142_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	7.5e-85	60.1
WP_109227713.1\|25526_25979_-	ATP-binding protein	NA	NA	NA	NA
WP_150338851.1\|27464_27968_-	hypothetical protein	NA	NA	NA	NA
WP_109227461.1\|28014_28659_-	hypothetical protein	K7Y837	Megavirus	6.7e-16	34.4
30107:30132	attL	NA	NA	NA	NA
WP_150338853.1\|30644_31271_-	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_109227463.1\|31353_32772_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_011944928.1\|32778_33906_+	cell division protein FtsW	NA	NA	NA	NA
WP_045919112.1\|33909_34989_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_109227464.1\|36593_36806_+	hypothetical protein	NA	NA	NA	NA
WP_109227465.1\|38721_39018_-	hypothetical protein	NA	NA	NA	NA
WP_109227466.1\|39930_40161_-\|transposase	transposase	NA	NA	NA	NA
WP_011944734.1\|41108_41543_-	CopD family protein	NA	NA	NA	NA
WP_150338855.1\|41551_42586_-	ferrochelatase	NA	NA	NA	NA
WP_150338857.1\|42578_43607_-	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_150338859.1\|45096_46602_+	transcription termination factor Rho	NA	NA	NA	NA
WP_150340414.1\|47341_47530_+\|integrase	integrase	NA	NA	NA	NA
WP_150338861.1\|48570_49854_+	hypothetical protein	NA	NA	NA	NA
WP_150338863.1\|50493_52362_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG	NA	NA	NA	NA
WP_045915711.1\|52519_53173_-	dTMP kinase	M1PSC7	Streptococcus_phage	6.4e-22	34.1
WP_150338865.1\|53165_54239_-	cell division protein ZapE	NA	NA	NA	NA
WP_150338867.1\|54309_54993_-	hypothetical protein	NA	NA	NA	NA
WP_150338869.1\|55001_56366_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_150338871.1\|56431_59101_-	DNA polymerase I	A0A1B1IST8	uncultured_Mediterranean_phage	2.1e-42	30.7
WP_150338873.1\|59537_60989_-	sodium:solute symporter family protein	NA	NA	NA	NA
WP_045918164.1\|61809_62640_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_150338875.1\|62796_63150_+\|transposase	transposase	NA	NA	NA	NA
WP_150338877.1\|64125_64998_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_150338879.1\|66967_68365_+	hypothetical protein	NA	NA	NA	NA
WP_150338881.1\|69413_72641_+	response regulator	A0A1V0SGX0	Hokovirus	2.4e-21	27.2
WP_109227491.1\|74348_74588_-	hypothetical protein	NA	NA	NA	NA
73084:73109	attR	NA	NA	NA	NA
WP_012460882.1\|75155_76163_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_150338883.1\|76241_76799_+	ankyrin repeat domain-containing protein	K7Y837	Megavirus	9.3e-14	32.9
WP_150338885.1\|76843_77347_+	hypothetical protein	NA	NA	NA	NA
WP_150338887.1\|78296_79025_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_045919583.1\|79922_80498_+	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9L285	Tupanvirus	5.7e-06	28.9
WP_045919584.1\|80618_81593_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	3.9e-84	64.1
WP_080503971.1\|82183_82258_+	hypothetical protein	NA	NA	NA	NA
WP_150338889.1\|82722_86160_-	response regulator	A0A1V0SGX0	Hokovirus	4.7e-15	22.2
WP_045915350.1\|86983_87358_+	hypothetical protein	NA	NA	NA	NA
WP_045915347.1\|87662_88814_+	hypothetical protein	NA	NA	NA	NA
WP_150338891.1\|89330_89612_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_045915056.1\|89650_89848_-	hypothetical protein	NA	NA	NA	NA
WP_150338893.1\|89985_90330_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150338895.1\|92683_93508_+	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150340416.1\|95343_96438_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150338897.1\|96489_97449_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_2

155685 : 226415

Bacillus_phage(16.67%)

protease,integrase,tail,head,transposase,tRNA,capsid

attL 155362:155387|attR 186483:186508

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
155362:155387	attL	NA	NA	NA	NA
WP_108884077.1\|155685_155859_+\|integrase	integrase	NA	NA	NA	NA
WP_150338943.1\|156132_156939_-	uracil-DNA glycosylase	A0A127AW33	Bacillus_phage	3.7e-11	33.1
WP_109227403.1\|157967_158294_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150338945.1\|159211_159826_-	hypothetical protein	NA	NA	NA	NA
WP_150338947.1\|159812_160424_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150338949.1\|160941_161778_-	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150338951.1\|163429_163885_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150338953.1\|163982_164546_+	hypothetical protein	NA	NA	NA	NA
WP_150338955.1\|164632_165208_-	HD domain-containing protein	A0A2K9L285	Tupanvirus	5.7e-06	28.9
WP_150338887.1\|166105_166834_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150338885.1\|167783_168287_-	hypothetical protein	NA	NA	NA	NA
WP_150338957.1\|168333_168963_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.2e-12	31.9
WP_150338959.1\|169198_170647_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-71	36.1
WP_150338961.1\|170655_171702_-	hypothetical protein	NA	NA	NA	NA
WP_150338963.1\|171698_172199_-	hypothetical protein	NA	NA	NA	NA
WP_045918161.1\|172794_173178_-	hypothetical protein	NA	NA	NA	NA
WP_045918162.1\|173241_173841_-	hypothetical protein	NA	NA	NA	NA
WP_045916011.1\|174145_175072_+	AEC family transporter	NA	NA	NA	NA
WP_150338965.1\|175091_176393_+	malate dehydrogenase	NA	NA	NA	NA
WP_150338967.1\|177418_178300_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_150338969.1\|178540_178945_-	F0F1 ATP synthase subunit epsilon	NA	NA	NA	NA
WP_064591327.1\|178941_180378_-	F0F1 ATP synthase subunit beta	NA	NA	NA	NA
WP_052692508.1\|180723_181863_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_150338971.1\|181898_182672_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_150338973.1\|183057_185055_-	transglycosylase SLT domain-containing protein	A0A0S2SXL7	Bacillus_phage	4.4e-05	34.3
WP_045916193.1\|185096_186035_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_109227718.1\|186774_186981_-	hypothetical protein	NA	NA	NA	NA
186483:186508	attR	NA	NA	NA	NA
WP_045914669.1\|190944_191979_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	2.4e-31	40.7
WP_150338975.1\|191975_194417_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_150338977.1\|194502_195432_-	translation elongation factor Ts	NA	NA	NA	NA
WP_041621781.1\|195428_196289_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_109227499.1\|196631_197483_-	AAA family ATPase	NA	NA	NA	NA
WP_150338979.1\|197466_199119_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	9.4e-46	34.6
WP_150340422.1\|199268_199445_-	hypothetical protein	NA	NA	NA	NA
WP_150338981.1\|199929_201414_-	PRANC domain-containing protein	A0A1V0S7Q4	Shearwaterpox_virus	1.7e-09	27.2
WP_109227496.1\|202580_204092_+	YifB family Mg chelatase-like AAA ATPase	NA	NA	NA	NA
WP_150338983.1\|204424_204634_+	hypothetical protein	NA	NA	NA	NA
WP_150338985.1\|204929_206822_+	DUF1601 domain-containing protein	NA	NA	NA	NA
WP_150338987.1\|208341_209901_-	hypothetical protein	NA	NA	NA	NA
WP_150338989.1\|212589_214188_+	hypothetical protein	NA	NA	NA	NA
WP_150338991.1\|214728_215112_-	glutaredoxin	A0A223FNA2	NY_014_poxvirus	9.6e-10	41.2
WP_045914457.1\|215319_215748_-	hypothetical protein	NA	NA	NA	NA
WP_150338993.1\|215845_216649_-	DUF2163 domain-containing protein	NA	NA	NA	NA
WP_150338995.1\|216661_217264_-	TIGR02217 family protein	A0A1W6DWM9	Sphingobium_phage	1.8e-18	33.0
WP_150338997.1\|217256_217682_-	hypothetical protein	NA	NA	NA	NA
WP_146695262.1\|217681_218023_-\|head,tail	head-tail adaptor protein	NA	NA	NA	NA
WP_150338999.1\|218024_218570_-	hypothetical protein	NA	NA	NA	NA
WP_150339001.1\|218603_219719_-\|capsid	phage major capsid protein	B0VK33	Azospirillum_phage	4.9e-54	40.3
WP_011944605.1\|219730_220285_-\|head,protease	HK97 family phage prohead protease	I6S2W2	Marinomonas_phage	1.7e-23	44.6
WP_150339003.1\|220962_221934_-	hypothetical protein	NA	NA	NA	NA
WP_045914450.1\|222017_223379_-	cell division protein FtsZ	NA	NA	NA	NA
WP_045918176.1\|223583_224849_-	UDP-N-acetylglucosamine 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_150339005.1\|225539_226415_+\|transposase	IS982 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

322035 : 414110

Salmonella_phage(18.18%)

portal,integrase,tRNA,transposase

attL 313270:313305|attR 401592:401627

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
313270:313305	attL	NA	NA	NA	NA
WP_150339078.1\|322035_323043_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340432.1\|323052_324099_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150339080.1\|326753_329225_-	hypothetical protein	NA	NA	NA	NA
WP_150339082.1\|333941_334502_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	1.5e-24	41.8
WP_150339084.1\|334611_335814_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339086.1\|336064_337756_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_150339088.1\|340394_340724_-	conjugal transfer protein	NA	NA	NA	NA
WP_045917953.1\|340723_340906_-	hypothetical protein	NA	NA	NA	NA
WP_150338911.1\|340935_341253_-	conjugative transfer protein	NA	NA	NA	NA
WP_045917956.1\|341252_341588_-	hypothetical protein	NA	NA	NA	NA
WP_150338913.1\|341713_341890_-	hypothetical protein	NA	NA	NA	NA
WP_109227528.1\|343578_347016_-	response regulator	A0A1V0SGX0	Hokovirus	6.2e-15	22.2
WP_150339090.1\|347769_348438_+	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	5.5e-37	47.5
WP_045917137.1\|348656_349166_+	CarD family transcriptional regulator	NA	NA	NA	NA
WP_150339092.1\|349189_350224_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	7.2e-68	44.3
WP_150339094.1\|350240_351032_+	NAD kinase	NA	NA	NA	NA
WP_150339096.1\|351123_352353_-	hypothetical protein	NA	NA	NA	NA
WP_011944822.1\|352339_352798_-	protein TolR	NA	NA	NA	NA
WP_150339098.1\|352803_353493_-	protein TolQ	NA	NA	NA	NA
WP_150339100.1\|353663_354677_+	porphobilinogen synthase	NA	NA	NA	NA
WP_109227535.1\|355372_356056_+	hypothetical protein	NA	NA	NA	NA
WP_150339102.1\|356298_357828_+	hypothetical protein	NA	NA	NA	NA
WP_150339104.1\|358146_359251_-	peptide chain release factor 2	NA	NA	NA	NA
WP_150339106.1\|359398_361204_+	elongation factor 4	A0A2K9L6L3	Tupanvirus	5.7e-20	32.6
WP_150339108.1\|362794_363655_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_150339110.1\|363733_364201_-	single-stranded DNA-binding protein	A0A1B1IVU7	uncultured_Mediterranean_phage	1.0e-37	51.9
WP_109227540.1\|364469_364952_+\|transposase	transposase	NA	NA	NA	NA
WP_150339112.1\|365330_365495_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_150339114.1\|365511_365805_+\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109227542.1\|366017_366179_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_045918756.1\|367028_367580_+	conjugal transfer protein	NA	NA	NA	NA
WP_150339116.1\|367977_368136_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_150340434.1\|369027_369648_-	hypothetical protein	NA	NA	NA	NA
WP_150339118.1\|372490_372724_+	hypothetical protein	NA	NA	NA	NA
WP_150339120.1\|372786_374127_+	hypothetical protein	NA	NA	NA	NA
WP_150339122.1\|374172_374616_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150339124.1\|375035_377252_+	hypothetical protein	NA	NA	NA	NA
WP_150339126.1\|377777_379067_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_150339128.1\|379629_380256_+	hypothetical protein	NA	NA	NA	NA
WP_150339130.1\|380408_380936_+	hypothetical protein	NA	NA	NA	NA
WP_150339132.1\|380941_381517_-	HD domain-containing protein	A0A1X9SH80	Bradyrhizobium_phage	1.0e-07	41.5
WP_150338887.1\|382496_383225_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150338885.1\|384174_384678_-	hypothetical protein	NA	NA	NA	NA
WP_150338957.1\|384724_385354_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.2e-12	31.9
WP_150338959.1\|385589_387038_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-71	36.1
WP_150340436.1\|387046_387793_-	hypothetical protein	NA	NA	NA	NA
WP_150339134.1\|388896_390684_+	hypothetical protein	NA	NA	NA	NA
WP_150339136.1\|390815_392006_+\|portal	phage portal protein	W8ECU7	Geobacillus_phage	3.1e-59	37.1
WP_150339138.1\|392020_392287_+	hypothetical protein	NA	NA	NA	NA
WP_011945001.1\|392712_392952_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_150339140.1\|393130_394702_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_150339142.1\|396412_397099_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_150339144.1\|397575_398658_+	hypothetical protein	NA	NA	NA	NA
WP_045914809.1\|402386_403568_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.4e-14	22.2
401592:401627	attR	NA	NA	NA	NA
WP_150339146.1\|404547_404745_-	hypothetical protein	NA	NA	NA	NA
WP_150339148.1\|406922_407591_+	ATP-binding protein	NA	NA	NA	NA
WP_045918742.1\|408951_409983_-	hypothetical protein	NA	NA	NA	NA
WP_150339150.1\|410097_410268_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109227549.1\|412322_413123_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150339152.1\|413174_414110_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA

DBSCAN-SWA_4

554420 : 616746

Wolbachia_phage(12.5%)

integrase,tRNA,transposase

attL 573607:573628|attR 618578:618599

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150339234.1\|554420_555359_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.7e-84	60.9
WP_150339236.1\|556178_556373_-	hypothetical protein	NA	NA	NA	NA
WP_150339238.1\|558511_559987_-	PRANC domain-containing protein	Q70GU1	Fowlpox_virus	1.3e-06	28.3
WP_150339239.1\|563341_563956_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_150339241.1\|563960_564527_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	6.5e-23	39.7
WP_150339243.1\|566293_567985_-	conjugal transfer protein TraN	NA	NA	NA	NA
WP_150339245.1\|567981_568365_-	type-F conjugative transfer system pilin assembly protein TrbC	NA	NA	NA	NA
WP_150340450.1\|568387_569356_-	conjugal transfer pilus assembly protein TraU	NA	NA	NA	NA
WP_012460825.1\|569365_569569_-	hypothetical protein	NA	NA	NA	NA
WP_150339247.1\|569655_570315_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
WP_045917984.1\|572780_573110_-	hypothetical protein	NA	NA	NA	NA
WP_109227581.1\|573109_573571_-	conjugal transfer protein	NA	NA	NA	NA
573607:573628	attL	NA	NA	NA	NA
WP_045919541.1\|573682_574084_-	hypothetical protein	NA	NA	NA	NA
WP_041621693.1\|574632_574968_-	hypothetical protein	NA	NA	NA	NA
WP_150340452.1\|575020_575449_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3M2X0	Bacillus_phage	6.1e-05	38.2
WP_045917985.1\|577617_578901_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_150339249.1\|580418_580682_-	hypothetical protein	NA	NA	NA	NA
WP_150339251.1\|583322_585251_-	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_150339253.1\|585296_587195_-	DUF3857 domain-containing protein	NA	NA	NA	NA
WP_150339255.1\|587343_588264_+	EamA family transporter	NA	NA	NA	NA
WP_150339257.1\|588301_589657_-	DNA repair protein RadA	NA	NA	NA	NA
WP_150339259.1\|589656_590229_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_150339261.1\|590232_590736_-	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_150339263.1\|590976_591699_+	SURF1 family protein	NA	NA	NA	NA
WP_150339265.1\|591693_592161_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_150339267.1\|592488_593418_-	tyrosine recombinase	S5W9T9	Leptospira_phage	3.2e-19	30.0
WP_150339269.1\|593761_595135_+	TolC family protein	NA	NA	NA	NA
WP_150339271.1\|595179_595752_+	DUF2497 domain-containing protein	NA	NA	NA	NA
WP_150339273.1\|595753_597637_+	hypothetical protein	NA	NA	NA	NA
WP_146695850.1\|597684_598449_+\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_012460802.1\|598445_598820_+	50S ribosomal protein L19	NA	NA	NA	NA
WP_150339275.1\|598846_601042_+	ATP-dependent RecD-like DNA helicase	A0A0H3UZA5	Geobacillus_virus	1.1e-54	27.6
WP_150339277.1\|601663_602566_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_045912308.1\|602546_603443_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_109227587.1\|603445_603907_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	2.5e-28	47.9
WP_045918603.1\|603927_604836_+	signal peptide peptidase SppA	A0A0F6TJW1	Escherichia_coli_O157_typing_phage	1.4e-19	31.6
WP_150339279.1\|604846_605755_+	lipoyl synthase	NA	NA	NA	NA
WP_150339281.1\|605775_606222_+	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_150339283.1\|607419_607614_+\|transposase	transposase	NA	NA	NA	NA
WP_109227588.1\|608633_609176_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_109227589.1\|609459_609795_+	hypothetical protein	NA	NA	NA	NA
WP_150339285.1\|610344_610746_+	hypothetical protein	NA	NA	NA	NA
WP_109227590.1\|610833_611328_+	conjugal transfer protein	NA	NA	NA	NA
WP_150339287.1\|615403_616240_+\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150340454.1\|616317_616746_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
618578:618599	attR	NA	NA	NA	NA

DBSCAN-SWA_5

793790 : 876950

Pseudomonas_phage(16.67%)

integrase,transposase

attL 790980:791033|attR 825597:825650

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
790980:791033	attL	NA	NA	NA	NA
WP_150340468.1\|793790_794549_-\|integrase	tyrosine-type recombinase/integrase	B6SD77	Bacteriophage	1.8e-15	33.5
WP_109227638.1\|798098_798446_-	MobA/MobL family protein	NA	NA	NA	NA
WP_108883845.1\|799370_799445_-	hypothetical protein	NA	NA	NA	NA
WP_045918146.1\|799444_799648_-	hypothetical protein	NA	NA	NA	NA
WP_109227639.1\|799724_800039_-	hypothetical protein	NA	NA	NA	NA
WP_012462169.1\|801497_801767_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_150339453.1\|801807_802134_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_045918143.1\|802272_802941_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_012462166.1\|803045_803795_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_150339454.1\|803987_805358_+	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	2.6e-41	33.5
WP_150339456.1\|805416_806892_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_150339457.1\|806983_809950_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_150339467.1\|811006_812686_+	DNA polymerase III subunit gamma/tau	E7DN81	Pneumococcus_phage	3.2e-41	38.4
WP_045918139.1\|812697_813258_+	hypothetical protein	NA	NA	NA	NA
WP_045918785.1\|813526_814240_+	metal ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	4.0e-17	30.0
WP_045918780.1\|814220_815009_+	metal ABC transporter permease	NA	NA	NA	NA
WP_109227642.1\|815769_816066_+	reverse transcriptase	A0A0U4J920	Pseudomonas_phage	2.6e-07	52.8
WP_012462157.1\|816648_817041_+	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_045918709.1\|823819_824095_+	hypothetical protein	NA	NA	NA	NA
WP_150340470.1\|824264_824738_+	sensor histidine kinase	NA	NA	NA	NA
WP_150340472.1\|825231_825687_+	ATP-binding protein	NA	NA	NA	NA
825597:825650	attR	NA	NA	NA	NA
WP_150339469.1\|826071_826998_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	2.0e-85	61.7
WP_150339472.1\|827065_827521_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_012461970.1\|830003_831788_-	hypothetical protein	NA	NA	NA	NA
WP_150339474.1\|832378_833494_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150339476.1\|833545_834517_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150339479.1\|834526_836092_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150339482.1\|837482_837944_+	hypothetical protein	NA	NA	NA	NA
WP_150339484.1\|838463_839792_+	conjugal transfer protein	NA	NA	NA	NA
WP_150339487.1\|839791_840121_+	conjugal transfer protein	NA	NA	NA	NA
WP_150339489.1\|842715_844407_+	conjugal transfer protein TraN	NA	NA	NA	NA
WP_150339492.1\|844403_845102_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_150339495.1\|845098_846400_+	conjugal transfer protein TraH	NA	NA	NA	NA
WP_150339497.1\|846399_849051_+	conjugal transfer protein TraG	NA	NA	NA	NA
WP_150339499.1\|849066_850212_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339502.1\|850215_851970_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150339504.1\|851979_852999_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340416.1\|853050_854145_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150338895.1\|855980_856805_-	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150339507.1\|856819_857530_-	AAA family ATPase	NA	NA	NA	NA
WP_150339510.1\|857501_858824_-	MobA/MobL family protein	NA	NA	NA	NA
WP_108840172.1\|859103_859559_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150339513.1\|859626_860601_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	3.9e-84	64.1
WP_150339515.1\|860722_861298_-	HD domain-containing protein	B3FJI5	Pseudomonas_phage	9.6e-06	38.6
WP_150339518.1\|861398_862256_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_045915190.1\|862277_863006_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_045917470.1\|863372_864182_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.4e-18	26.7
WP_150339520.1\|864185_864689_-	hypothetical protein	NA	NA	NA	NA
WP_150339523.1\|864736_865381_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	9.7e-15	33.3
WP_150339525.1\|865415_865991_-	HD domain-containing protein	A0A292GI44	Xanthomonas_phage	1.0e-07	28.6
WP_150339527.1\|866224_867661_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	6.7e-72	37.0
WP_150339530.1\|867669_869385_-	hypothetical protein	NA	NA	NA	NA
WP_150339532.1\|870577_871276_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_150339535.1\|872574_874566_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339537.1\|876458_876950_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_6

1057730 : 1162997

Streptococcus_phage(15.38%)

protease,integrase,tRNA,transposase

attL 1142196:1142224|attR 1171193:1171221

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150339702.1\|1057730_1058984_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	3.4e-120	53.3
WP_150339704.1\|1059111_1060413_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_045917961.1\|1060427_1060721_-	hypothetical protein	NA	NA	NA	NA
WP_150339707.1\|1060734_1061955_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_150339709.1\|1062035_1063052_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_150339712.1\|1063326_1065783_+	virB4 protein precursor	NA	NA	NA	NA
WP_150339714.1\|1065782_1070306_+	hypothetical protein	NA	NA	NA	NA
WP_045916484.1\|1072667_1074428_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	5.7e-41	25.8
WP_045913377.1\|1074411_1074744_-	iron donor protein CyaY	NA	NA	NA	NA
WP_150339717.1\|1075650_1079763_+	hypothetical protein	NA	NA	NA	NA
WP_150339720.1\|1081925_1082309_+	succinate dehydrogenase, cytochrome b556 subunit	NA	NA	NA	NA
WP_150339722.1\|1082339_1082729_+	succinate dehydrogenase, hydrophobic membrane anchor protein	NA	NA	NA	NA
WP_150339725.1\|1082923_1084711_+	succinate dehydrogenase flavoprotein subunit	NA	NA	NA	NA
WP_045914354.1\|1084745_1085531_+	succinate dehydrogenase iron-sulfur subunit	NA	NA	NA	NA
WP_150339727.1\|1086734_1088300_+	hypothetical protein	NA	NA	NA	NA
WP_150339730.1\|1088308_1089757_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	6.7e-72	36.3
WP_150339733.1\|1089899_1091027_-	hypothetical protein	NA	NA	NA	NA
WP_150339639.1\|1091480_1092050_-	hypothetical protein	NA	NA	NA	NA
WP_045918527.1\|1092146_1092602_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_109227404.1\|1092897_1093056_+	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150339736.1\|1093100_1094243_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	7.8e-07	27.1
WP_150339738.1\|1094257_1095082_+	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150339637.1\|1095382_1096486_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150339741.1\|1096537_1097338_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_011945084.1\|1097799_1098225_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.8e-17	37.4
WP_045919076.1\|1098368_1098593_+	hypothetical protein	NA	NA	NA	NA
WP_150339744.1\|1100224_1101937_+	hypothetical protein	NA	NA	NA	NA
WP_150339746.1\|1104230_1104875_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	2.8e-14	32.4
WP_150339749.1\|1104922_1105426_+	hypothetical protein	NA	NA	NA	NA
WP_150339752.1\|1105429_1106239_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	1.3e-19	28.5
WP_150339755.1\|1106606_1106870_+	hypothetical protein	NA	NA	NA	NA
WP_150339758.1\|1106934_1107633_+	histidine kinase	NA	NA	NA	NA
WP_150340470.1\|1107860_1108334_+	sensor histidine kinase	NA	NA	NA	NA
WP_150339761.1\|1109312_1109807_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150339763.1\|1109858_1110446_+	HD domain-containing protein	A0A2I2L310	Orpheovirus	3.4e-06	29.8
WP_150339766.1\|1110567_1111530_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.0e-84	64.5
WP_150339768.1\|1111597_1111996_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150340482.1\|1112347_1115221_+	AAA family ATPase	A0A2P0VMS9	Tetraselmis_virus	6.1e-08	24.7
WP_150339770.1\|1116877_1117972_+	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150339772.1\|1118023_1118971_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150339775.1\|1118980_1120735_-	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_109234468.1\|1120740_1121880_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339777.1\|1126548_1127109_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	1.7e-23	39.0
WP_150339780.1\|1127212_1128217_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339782.1\|1130305_1131109_-	conjugative transfer protein	NA	NA	NA	NA
WP_150339785.1\|1131436_1132537_+	PRANC domain-containing protein	A0A1V0QGP6	Shearwaterpox_virus	1.9e-10	30.4
WP_150339788.1\|1132444_1134238_-	TraC family protein	NA	NA	NA	NA
WP_150339791.1\|1134218_1134548_-	conjugal transfer protein	NA	NA	NA	NA
WP_150339794.1\|1134547_1134937_-	conjugal transfer protein	NA	NA	NA	NA
WP_150339796.1\|1136222_1136870_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011944522.1\|1138628_1138928_-	hypothetical protein	NA	NA	NA	NA
1142196:1142224	attL	NA	NA	NA	NA
WP_150339799.1\|1143120_1144524_-	sodium:solute symporter family protein	NA	NA	NA	NA
WP_045918655.1\|1144539_1145802_-	MFS transporter	NA	NA	NA	NA
WP_150339802.1\|1149877_1150594_-	hypothetical protein	NA	NA	NA	NA
WP_150339804.1\|1151959_1152220_-	hypothetical protein	NA	NA	NA	NA
WP_012460860.1\|1153356_1153686_-	hypothetical protein	NA	NA	NA	NA
WP_150339806.1\|1155060_1155390_-	hypothetical protein	NA	NA	NA	NA
WP_150339809.1\|1156558_1156894_-	hypothetical protein	NA	NA	NA	NA
WP_150339811.1\|1159013_1159922_-	AAA family ATPase	A0A218KST2	Xenohaliotis_phage	5.5e-56	42.4
WP_012461740.1\|1162790_1162997_+\|integrase	integrase	NA	NA	NA	NA
1171193:1171221	attR	NA	NA	NA	NA

DBSCAN-SWA_7

1279563 : 1348742

Indivirus(16.67%)

protease,tRNA,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045918381.1\|1279563_1280472_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_012461867.1\|1280495_1280765_+	30S ribosomal protein S15	NA	NA	NA	NA
WP_045918383.1\|1281012_1283223_+	polyribonucleotide nucleotidyltransferase	NA	NA	NA	NA
WP_045918384.1\|1283364_1284642_-	hypothetical protein	NA	NA	NA	NA
WP_150339907.1\|1285123_1286353_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_045918387.1\|1286444_1287164_-	DUF5394 family protein	NA	NA	NA	NA
WP_150340488.1\|1287389_1288619_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_150339910.1\|1288808_1290059_-	MFS transporter	NA	NA	NA	NA
WP_108840015.1\|1290165_1290663_+	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_012461860.1\|1290691_1290898_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_150339913.1\|1291069_1291675_+	COQ9 family protein	NA	NA	NA	NA
WP_150339916.1\|1291711_1294915_+\|tRNA	isoleucine--tRNA ligase	A0A2I2L3Y0	Orpheovirus	2.6e-177	34.4
WP_045913650.1\|1295051_1295636_+	DUF1013 domain-containing protein	NA	NA	NA	NA
WP_150339919.1\|1295990_1297199_+	2-polyprenyl-6-methoxyphenol hydroxylase	NA	NA	NA	NA
WP_150339921.1\|1297255_1298416_+	ADP-forming succinate--CoA ligase subunit beta	NA	NA	NA	NA
WP_150339924.1\|1298430_1299309_+	succinate--CoA ligase subunit alpha	A0A2K9L1S3	Tupanvirus	8.6e-22	31.9
WP_150339926.1\|1299377_1301054_+	NADH-quinone oxidoreductase subunit D	NA	NA	NA	NA
WP_150339928.1\|1301230_1304059_-	hypothetical protein	NA	NA	NA	NA
WP_041621668.1\|1304087_1304342_-	hypothetical protein	NA	NA	NA	NA
WP_045917099.1\|1304338_1304824_-	sodium:proton antiporter	NA	NA	NA	NA
WP_150339931.1\|1304874_1305648_-\|holin	phosphatidylcholine/phosphatidylserine synthase	NA	NA	NA	NA
WP_109227251.1\|1305699_1306392_-	phosphatidylserine decarboxylase	A0A1V0SDU9	Indivirus	7.3e-16	33.7
WP_045918076.1\|1306468_1307014_-	demethoxyubiquinone hydroxylase family protein	NA	NA	NA	NA
WP_150339934.1\|1306967_1307525_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_150339936.1\|1307663_1309244_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_045913414.1\|1309961_1310255_-	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_045916254.1\|1310260_1311010_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_150339939.1\|1311090_1312620_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_150339941.1\|1312659_1313265_-	hypothetical protein	NA	NA	NA	NA
WP_150339944.1\|1313525_1313765_-	hypothetical protein	NA	NA	NA	NA
WP_150339947.1\|1313935_1314955_-	hypothetical protein	NA	NA	NA	NA
WP_150338897.1\|1316180_1317140_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340416.1\|1317191_1318286_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_045919247.1\|1319851_1320397_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.1e-19	41.7
WP_150339950.1\|1320393_1321317_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	5.1e-09	28.2
WP_150339953.1\|1321531_1324063_-	hypothetical protein	NA	NA	NA	NA
WP_150339956.1\|1324232_1324727_+	ribosome maturation factor RimM	NA	NA	NA	NA
WP_150339959.1\|1324954_1325911_+	malate dehydrogenase	NA	NA	NA	NA
WP_150339962.1\|1326003_1328370_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	3.1e-90	33.7
WP_150339965.1\|1328369_1329755_+	hypothetical protein	NA	NA	NA	NA
WP_150339968.1\|1329689_1330595_-	bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase	A0A249XZQ2	Enterococcus_phage	3.0e-30	39.1
WP_150339971.1\|1330591_1331608_-	FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	1.1e-17	27.1
WP_150339974.1\|1331806_1334590_+	hypothetical protein	A0A0B5A7K5	Paracoccus_phage	8.9e-97	28.6
WP_109227262.1\|1334856_1335471_-	peptidoglycan-associated lipoprotein Pal	NA	NA	NA	NA
WP_109227263.1\|1335684_1337085_-\|protease	DegP-like serine protease TSA47	W5SAB9	Pithovirus	1.2e-06	31.1
WP_045917627.1\|1337102_1337969_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_150339977.1\|1337992_1339048_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_150339979.1\|1339230_1340262_+	P-loop NTPase	NA	NA	NA	NA
WP_150339982.1\|1342168_1342378_-	hypothetical protein	NA	NA	NA	NA
WP_108883954.1\|1344948_1345896_-	paraslipin	S4VT23	Pandoravirus	3.7e-10	26.1
WP_109227265.1\|1346155_1346704_+	cytochrome c family protein	NA	NA	NA	NA
WP_150339984.1\|1347872_1348742_+\|transposase	IS630 family transposase	A0A2H4UV16	Bodo_saltans_virus	6.1e-20	33.8

DBSCAN-SWA_8

1659990 : 1749965

Streptococcus_phage(14.29%)

integrase,tRNA,transposase

attL 1645625:1645654|attR 1749817:1749846

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1645625:1645654	attL	NA	NA	NA	NA
WP_150340502.1\|1659990_1660410_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_150340209.1\|1660922_1661333_-\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150340211.1\|1665179_1667330_+	UvrD-helicase domain-containing protein	A7KV33	Bacillus_phage	3.3e-107	37.3
WP_150340213.1\|1668312_1669749_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	5.5e-50	32.1
WP_150340215.1\|1669813_1671160_-\|tRNA	glutamate--tRNA ligase	A0A2K9L594	Tupanvirus	5.7e-09	34.8
WP_150340217.1\|1671339_1673382_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	7.7e-98	36.7
WP_045913615.1\|1673409_1674663_-	MFS transporter	NA	NA	NA	NA
WP_150340219.1\|1674699_1677264_-	type VI secretion protein	NA	NA	NA	NA
WP_150340221.1\|1677256_1680529_-	type VI secretion protein	NA	NA	NA	NA
WP_150340223.1\|1680582_1684482_-	type VI secretion protein	NA	NA	NA	NA
WP_150340225.1\|1684503_1686951_-	type VI secretion protein	NA	NA	NA	NA
WP_012461381.1\|1686950_1689368_-	VirB4 family type IV secretion/conjugal transfer ATPase	NA	NA	NA	NA
WP_012461380.1\|1689378_1689666_-	type VI secretion protein	NA	NA	NA	NA
WP_150340227.1\|1689981_1691922_-	primosomal protein N'	NA	NA	NA	NA
WP_150340229.1\|1692108_1693644_+\|tRNA	methionine--tRNA ligase	A0A1V0SHR2	Klosneuvirus	1.3e-94	36.9
WP_045914475.1\|1693656_1694445_+	TatD family hydrolase	NA	NA	NA	NA
WP_150340231.1\|1695108_1695975_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_012461375.1\|1697025_1697691_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	4.2e-13	40.2
WP_109227702.1\|1698500_1700126_-	hypothetical protein	NA	NA	NA	NA
WP_150340233.1\|1701212_1701788_-	HD domain-containing protein	A0A292GI44	Xanthomonas_phage	5.1e-07	28.8
WP_150340235.1\|1702068_1703469_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	8.8e-69	36.9
WP_150340237.1\|1703477_1705043_-	hypothetical protein	NA	NA	NA	NA
WP_045912460.1\|1706238_1706763_+	hypothetical protein	NA	NA	NA	NA
WP_011944708.1\|1707234_1707393_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_150340504.1\|1707911_1708901_-	GTPase ObgE	NA	NA	NA	NA
WP_150340239.1\|1708920_1709298_-	hypothetical protein	NA	NA	NA	NA
WP_150340241.1\|1709320_1709650_-	hypothetical protein	NA	NA	NA	NA
WP_045914482.1\|1709829_1710570_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_045914483.1\|1710909_1711308_+	hypothetical protein	NA	NA	NA	NA
WP_150340506.1\|1711325_1713461_+	RelA/SpoT family protein	A0A2I2L310	Orpheovirus	1.4e-09	35.6
WP_109227397.1\|1713471_1713867_+	holo-ACP synthase	NA	NA	NA	NA
WP_012460965.1\|1714985_1716653_-	chaperonin GroEL	A0A219YK78	uncultured_virus	1.4e-142	53.1
WP_045914486.1\|1716725_1717010_-	co-chaperone GroES	A0A221S4E4	uncultured_virus	8.1e-06	29.2
WP_080503903.1\|1717250_1717517_-	hypothetical protein	NA	NA	NA	NA
WP_150340508.1\|1717628_1717886_-	hypothetical protein	NA	NA	NA	NA
WP_150340243.1\|1717944_1719117_+	PRANC domain-containing protein	Q6VZB8	Canarypox_virus	2.3e-06	27.6
WP_045918345.1\|1719602_1721057_-	replicative DNA helicase	A0A218KST2	Xenohaliotis_phage	5.2e-64	34.6
WP_150340510.1\|1721807_1723319_-	histidine kinase	A0A1V0SGX0	Hokovirus	4.4e-26	34.4
WP_011944696.1\|1723653_1724004_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_150340245.1\|1726283_1727999_+	hypothetical protein	NA	NA	NA	NA
WP_150340247.1\|1728007_1729444_+	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.2e-73	37.4
WP_150340249.1\|1729676_1730252_+	HD domain-containing protein	A0A292GI44	Xanthomonas_phage	4.6e-08	29.2
WP_150340251.1\|1730286_1730931_+	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.8e-13	31.9
WP_150340253.1\|1730977_1731529_+	hypothetical protein	NA	NA	NA	NA
WP_150340255.1\|1731532_1732342_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	9.7e-20	27.4
WP_109456017.1\|1732715_1732994_+	hypothetical protein	NA	NA	NA	NA
WP_150340257.1\|1733058_1733760_+	histidine kinase	NA	NA	NA	NA
WP_150340512.1\|1734213_1734690_+	sensor histidine kinase	NA	NA	NA	NA
WP_045915388.1\|1735177_1735642_+	sensor histidine kinase	NA	NA	NA	NA
WP_045914126.1\|1735660_1736155_+	ATP-binding protein	NA	NA	NA	NA
WP_150340259.1\|1736196_1736784_+	HD domain-containing protein	J9Q7H7	Salmonella_phage	3.1e-07	34.1
WP_150340261.1\|1736905_1737916_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.8e-84	64.1
WP_150340263.1\|1738514_1739486_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150340265.1\|1739809_1740265_-	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150340514.1\|1740559_1743403_+	AAA family ATPase	NA	NA	NA	NA
WP_150340267.1\|1746391_1746931_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340269.1\|1746920_1748021_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150340516.1\|1748324_1749293_-\|transposase	IS110-like element ISOt5 family transposase	A0A1S7J231	Thermus_phage	5.9e-24	30.2
WP_150340271.1\|1749503_1749965_+\|transposase	transposase	NA	NA	NA	NA
1749817:1749846	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1810285 : 1882541

Streptococcus_phage(23.08%)

integrase,transposase

attL 1872428:1872448|attR 1899714:1899734

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150340297.1\|1810285_1811230_+\|integrase	tyrosine-type recombinase/integrase	Q9T1P3	Pseudomonas_phage	7.8e-13	24.8
WP_045918420.1\|1811282_1811588_+	hypothetical protein	NA	NA	NA	NA
WP_150340299.1\|1811583_1811778_+	hypothetical protein	NA	NA	NA	NA
WP_150340456.1\|1813844_1814813_+	conjugal transfer pilus assembly protein TraU	NA	NA	NA	NA
WP_150339301.1\|1814835_1815219_+	conjugal transfer protein	NA	NA	NA	NA
WP_150339303.1\|1815589_1816288_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_150339304.1\|1820237_1821377_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150339306.1\|1821382_1823137_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150340301.1\|1823146_1824142_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340458.1\|1824193_1825288_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150340303.1\|1827123_1827948_-	conjugal transfer protein TraA	NA	NA	NA	NA
WP_150340305.1\|1827962_1828637_-	AAA family ATPase	NA	NA	NA	NA
WP_150340307.1\|1831022_1831382_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150340309.1\|1832157_1832958_+	hypothetical protein	NA	NA	NA	NA
WP_080946883.1\|1833459_1833723_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150340311.1\|1833801_1834728_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.7e-84	61.7
WP_045919583.1\|1834848_1835424_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A2K9L285	Tupanvirus	5.7e-06	28.9
WP_150338887.1\|1836321_1837050_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150340313.1\|1837416_1838226_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	3.0e-21	27.4
WP_045918529.1\|1838229_1838733_-	hypothetical protein	NA	NA	NA	NA
WP_150340315.1\|1839518_1840094_-	HD domain-containing protein	A0A292GI44	Xanthomonas_phage	1.3e-07	31.3
WP_150340317.1\|1840712_1841546_+	hypothetical protein	NA	NA	NA	NA
WP_150340319.1\|1844645_1847297_+	conjugal transfer protein TraG	NA	NA	NA	NA
WP_150340321.1\|1847312_1848458_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150340323.1\|1848461_1850216_+	type IV secretion system DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150340325.1\|1850225_1851266_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340524.1\|1851250_1852354_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_045917117.1\|1857328_1857784_+	conjugal transfer protein TraD	NA	NA	NA	NA
WP_150340327.1\|1858129_1859311_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_150340329.1\|1859503_1860538_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	8.4e-85	64.5
WP_150340331.1\|1860659_1861247_-	HD domain-containing protein	A0A2I2L310	Orpheovirus	9.8e-06	29.0
WP_150339761.1\|1861298_1861793_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150340470.1\|1862770_1863244_-	sensor histidine kinase	NA	NA	NA	NA
WP_150339758.1\|1863471_1864170_-	histidine kinase	NA	NA	NA	NA
WP_150339755.1\|1864234_1864498_-	hypothetical protein	NA	NA	NA	NA
WP_150340333.1\|1864865_1865675_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1S5PRR3	Streptococcus_phage	2.8e-19	27.8
WP_150340335.1\|1865678_1866227_-	hypothetical protein	NA	NA	NA	NA
WP_150340337.1\|1866273_1866918_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	8.2e-14	32.2
WP_150340339.1\|1866952_1867528_-	HD domain-containing protein	A0A292GI44	Xanthomonas_phage	6.7e-07	29.2
WP_150340341.1\|1867760_1869209_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	4.4e-71	36.9
WP_150340343.1\|1869217_1870777_-	hypothetical protein	NA	NA	NA	NA
WP_150340344.1\|1871492_1872053_-	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	5.9e-24	41.1
WP_150340346.1\|1872163_1873567_-	tetratricopeptide repeat protein	NA	NA	NA	NA
1872428:1872448	attL	NA	NA	NA	NA
WP_150339824.1\|1874189_1874573_-	conjugal transfer protein	NA	NA	NA	NA
WP_150340348.1\|1877111_1877519_-	TraC family protein	NA	NA	NA	NA
WP_150340350.1\|1877427_1877748_-	conjugal transfer protein	NA	NA	NA	NA
WP_150340352.1\|1877747_1879076_-	conjugal transfer protein	NA	NA	NA	NA
WP_150340354.1\|1879799_1880288_-	hypothetical protein	NA	NA	NA	NA
WP_064612831.1\|1880284_1880836_-	conjugal transfer protein	NA	NA	NA	NA
WP_150340356.1\|1880835_1881171_-	hypothetical protein	NA	NA	NA	NA
WP_150340358.1\|1881296_1882541_-\|integrase	tyrosine-type recombinase/integrase	A0A0R6PGY7	Moraxella_phage	9.7e-19	24.1
1899714:1899734	attR	NA	NA	NA	NA

DBSCAN-SWA_10

1901601 : 1951931

Wolbachia_phage(12.5%)

integrase,tRNA,transposase

attL 1922556:1922587|attR 1962947:1962978

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150340371.1\|1901601_1902573_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_150340193.1\|1902624_1903728_-	conjugal transfer protein TraI	NA	NA	NA	NA
WP_150340526.1\|1905947_1906082_-	conjugal transfer protein TraA	NA	NA	NA	NA
WP_109227356.1\|1906904_1908155_-	hypothetical protein	NA	NA	NA	NA
WP_045919549.1\|1908177_1908597_-	hypothetical protein	NA	NA	NA	NA
WP_150340373.1\|1908831_1909734_-\|transposase	Rpn family recombination-promoting nuclease/putative transposase	A0A1B2LRR6	Wolbachia_phage	1.3e-86	57.6
WP_150339763.1\|1909855_1910443_-	HD domain-containing protein	A0A2I2L310	Orpheovirus	3.4e-06	29.8
WP_150339761.1\|1910494_1910989_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_150340470.1\|1911967_1912441_-	sensor histidine kinase	NA	NA	NA	NA
WP_045918709.1\|1912610_1912886_-	hypothetical protein	NA	NA	NA	NA
WP_150338885.1\|1913850_1914354_-	hypothetical protein	NA	NA	NA	NA
WP_150338957.1\|1914400_1915030_-	ankyrin repeat domain-containing protein	A0A2K9L931	Tupanvirus	1.2e-12	31.9
WP_150338959.1\|1915265_1916714_-	replicative DNA helicase	A0A1P8VVQ6	Streptococcus_phage	1.1e-71	36.1
WP_150338961.1\|1916722_1917769_-	hypothetical protein	NA	NA	NA	NA
WP_150338963.1\|1917765_1918266_-	hypothetical protein	NA	NA	NA	NA
WP_109227703.1\|1919178_1920147_-	conjugal transfer pilus assembly protein TraU	NA	NA	NA	NA
WP_150340375.1\|1920418_1921078_-	type-F conjugative transfer system protein TraW	NA	NA	NA	NA
1922556:1922587	attL	NA	NA	NA	NA
WP_109227704.1\|1923170_1923338_-	conjugative transfer protein	NA	NA	NA	NA
WP_012461748.1\|1925079_1925550_-	peroxiredoxin	NA	NA	NA	NA
WP_109227405.1\|1925552_1925714_-	hypothetical protein	NA	NA	NA	NA
WP_045918548.1\|1925760_1925991_-	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_109227705.1\|1927028_1927529_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3M2X0	Bacillus_phage	7.1e-05	40.0
WP_150340377.1\|1927877_1928234_-\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150340379.1\|1929352_1929940_+	hypothetical protein	NA	NA	NA	NA
WP_150340381.1\|1930192_1931185_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_150340383.1\|1931247_1932519_-\|tRNA	tRNA (N(6)-L-threonylcarbamoyladenosine(37)-C(2))- methylthiotransferase MtaB	NA	NA	NA	NA
WP_150340385.1\|1932846_1933611_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_150340528.1\|1933594_1933765_-	hypothetical protein	NA	NA	NA	NA
WP_150340387.1\|1934374_1937188_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_052692533.1\|1937920_1938160_-	hypothetical protein	NA	NA	NA	NA
WP_150340389.1\|1940094_1941483_-	2-polyprenylphenol 6-hydroxylase	A0A0R6PKQ6	Moraxella_phage	2.9e-32	25.9
WP_150340391.1\|1941479_1942253_-	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_150340393.1\|1942844_1943327_+	ribosome maturation factor RimP	NA	NA	NA	NA
WP_109227479.1\|1943345_1944848_+	transcription termination/antitermination protein NusA	NA	NA	NA	NA
WP_045918048.1\|1945097_1947638_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	6.1e-28	27.3
WP_011944947.1\|1947668_1948031_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_109227480.1\|1949511_1949751_+	hypothetical protein	NA	NA	NA	NA
WP_150340395.1\|1950916_1951339_+\|integrase	integrase arm-type DNA-binding domain-containing protein	NA	NA	NA	NA
WP_150339412.1\|1951495_1951687_+	hypothetical protein	NA	NA	NA	NA
WP_150340397.1\|1951595_1951931_+\|integrase	tyrosine-type recombinase/integrase	B6SD77	Bacteriophage	2.1e-05	42.9
1962947:1962978	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP044031.1|WP_109227480.1|1949511_1949751_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP044031.1|WP_109227480.1|1949511_1949751_+|hypothetical-protein

1949511_1949751_+

79 aa aa

1901601-1951931

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP044031_3	Orphan	3.1\|1645646\|25\|NZ_CP044031\|CRISPRCasFinder	1645646-1645670	25	1901801-1901777	2

1. spacer 3.1|1645646|25|NZ_CP044031|CRISPRCasFinder matches to NZ_CP044031 position: 1901801-1901777, mismatch: 2

gagctgaaggtataaagcttggtga	CRISPR spacer
gagctgaaggtatagagattggtga	Protospacer
**************.** *******

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044031

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information