CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP044044	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed2, complete sequence	0 crisprs	NA	0
NZ_CP044043	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed1, complete sequence	0 crisprs	NA	1
NZ_CP044047	Klebsiella pneumoniae strain FDAARGOS_629 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,DinG,csa3	6
NZ_CP044046	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed4, complete sequence	0 crisprs	DEDDh	3
NZ_CP044045	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed3, complete sequence	0 crisprs	RT	3
NZ_CP044048	Klebsiella pneumoniae strain FDAARGOS_629 plasmid unnamed5	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044047_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044047_1

461429-461565

Orphan

Consensus_repeat	Method
CTGCTTCAGTTTTGTAGGCCGGGTAAGGCGCCAGCCGCCACCCGGCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044047_1

>merge|NZ_CP044047|1|461429-461565|CRISPRCasFinder
CTGCTTCAGTTTTGTAGGCCGGGTAAGGCGCCAGCCGCCACCCGGCATAAAGCGGCTCCGTGCCCGGCGGCGCTGCGCTTGCCGGGTCAACTGCTTCGGTTTTGTAGGCCGGGTAAGGCGCCAGCCGCCACCCGGCA

>NZ_CP044047|1|1|461429-461565|CRISPRCasFinder
CTGCTTCAGTTTTGTAGGCCGGGTAAGGCGCCAGCCGCCACCCGGCA	TAAAGCGGCTCCGTGCCCGGCGGCGCTGCGCTTGCCGGGTCAA
CTGCTTCGGTTTTGTAGGCCGGGTAAGGCGCCAGCCGCCACCCGGCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044047.1\|WP_004145825.1\|452791_453373_+\|D-sedoheptulose-7-phosphate-isomerase	unknown	unknown	gnl\|CDD\|179012
NZ_CP044047.1\|WP_002889722.1\|461182_461398_+\|(Na+)-NQR-maturation-NqrM	unknown	unknown	gnl\|CDD\|225538
NZ_CP044047.1\|WP_032420366.1\|468541_468754_-\|DUF1471-domain-containing-protein	unknown	unknown	gnl\|CDD\|369322
NZ_CP044047.1\|WP_002889702.1\|455337_456681_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	unknown	unknown	gnl\|CDD\|235426
NZ_CP044047.1\|WP_004147186.1\|456684_457923_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	unknown	unknown	gnl\|CDD\|235425
NZ_CP044047.1\|WP_048270456.1\|468911_469328_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP044047.1\|WP_023325095.1\|469360_470158_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP044047.1\|WP_048270455.1\|463698_464151_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|182099
NZ_CP044047.1\|WP_004177335.1\|459347_459944_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	unknown	unknown	gnl\|CDD\|235074
NZ_CP044047.1\|WP_002889733.1\|465908_466367_+\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|236395
NZ_CP044047.1\|WP_002889724.1\|461620_462481_-\|glycerophosphoryl-diester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176522
NZ_CP044047.1\|WP_025861706.1\|466472_467717_+\|esterase-FrsA	unknown	unknown	gnl\|CDD\|235337
NZ_CP044047.1\|WP_002889726.1\|462640_463696_+\|DNA-polymerase-IV	unknown	unknown	gnl\|CDD\|235035
NZ_CP044047.1\|WP_002889793.1\|467774_468173_+\|sigma-factor-binding-protein-Crl	unknown	unknown	gnl\|CDD\|182882
NZ_CP044047.1\|WP_002889696.1\|453447_454215_+\|class-II-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|372525
NZ_CP044047.1\|WP_002889716.1\|458702_459341_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	unknown	unknown	gnl\|CDD\|236457
NZ_CP044047.1\|WP_002889720.1\|459956_461180_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	unknown	unknown	gnl\|CDD\|235481
NZ_CP044047.1\|WP_004177336.1\|457915_458710_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	unknown	unknown	gnl\|CDD\|235423
NZ_CP044047.1\|WP_064162511.1\|464193_465651_-\|cytosol-nonspecific-dipeptidase	unknown	unknown	gnl\|CDD\|184986
NZ_CP044047.1\|WP_040215270.1\|454185_454926_-\|murein-L,D-transpeptidase	unknown	unknown	gnl\|CDD\|225577

Protein	Function_ID	Function_description	E-value
NZ_CP044047.1\|WP_004145825.1\|452791_453373_+\|D-sedoheptulose-7-phosphate-isomerase	gnl\|CDD\|179012	PRK00414, gmhA, D-sedoheptulose 7-phosphate isomerase.	2.35176e-148
NZ_CP044047.1\|WP_002889722.1\|461182_461398_+\|(Na+)-NQR-maturation-NqrM	gnl\|CDD\|225538	COG2991, COG2991, Uncharacterized protein conserved in bacteria [Function unknown].	5.41902e-29
NZ_CP044047.1\|WP_032420366.1\|468541_468754_-\|DUF1471-domain-containing-protein	gnl\|CDD\|369322	pfam07338, DUF1471, Protein of unknown function (DUF1471). This family consists of several hypothetical Enterobacterial proteins of around 90 residues in length. Some members of this family are annotated as ydgH precursors and contain two copies of this region, one at the N-terminus and the other at the C-terminus. The function of this family is unknown.	5.26043e-05
NZ_CP044047.1\|WP_002889702.1\|455337_456681_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-A	gnl\|CDD\|235426	PRK05352, PRK05352, Na(+)-translocating NADH-quinone reductase subunit A; Provisional.	0
NZ_CP044047.1\|WP_004147186.1\|456684_457923_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B	gnl\|CDD\|235425	PRK05349, PRK05349, Na(+)-translocating NADH-quinone reductase subunit B; Provisional.	0
NZ_CP044047.1\|WP_048270456.1\|468911_469328_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	9.9091e-45
NZ_CP044047.1\|WP_023325095.1\|469360_470158_-\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.29477e-50
NZ_CP044047.1\|WP_048270455.1\|463698_464151_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|182099	PRK09831, PRK09831, GNAT family N-acetyltransferase.	2.97281e-85
NZ_CP044047.1\|WP_004177335.1\|459347_459944_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E	gnl\|CDD\|235074	PRK02830, PRK02830, Na(+)-translocating NADH-quinone reductase subunit E; Provisional.	4.25239e-127
NZ_CP044047.1\|WP_002889733.1\|465908_466367_+\|xanthine-phosphoribosyltransferase	gnl\|CDD\|236395	PRK09177, PRK09177, xanthine-guanine phosphoribosyltransferase; Validated.	2.19173e-113
NZ_CP044047.1\|WP_002889724.1\|461620_462481_-\|glycerophosphoryl-diester-phosphodiesterase	gnl\|CDD\|176522	cd08580, GDPD_Rv2277c_like, Glycerophosphodiester phosphodiesterase domain of uncharacterized bacterial protein Rv2277c and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in uncharacterized bacterial protein Rv2277c and similar proteins. Members in this subfamily are bacterial homologous of mammalian GDE4, a transmembrane protein whose cellular function has not yet been elucidated.	7.97848e-129
NZ_CP044047.1\|WP_025861706.1\|466472_467717_+\|esterase-FrsA	gnl\|CDD\|235337	PRK05077, frsA, esterase FrsA.	0
NZ_CP044047.1\|WP_002889726.1\|462640_463696_+\|DNA-polymerase-IV	gnl\|CDD\|235035	PRK02406, PRK02406, DNA polymerase IV; Validated.	0
NZ_CP044047.1\|WP_002889793.1\|467774_468173_+\|sigma-factor-binding-protein-Crl	gnl\|CDD\|182882	PRK10984, PRK10984, sigma factor-binding protein Crl.	2.69204e-83
NZ_CP044047.1\|WP_002889696.1\|453447_454215_+\|class-II-glutamine-amidotransferase	gnl\|CDD\|372525	pfam13230, GATase_4, Glutamine amidotransferases class-II. This family captures members that are not found in pfam00310.	1.08772e-144
NZ_CP044047.1\|WP_002889716.1\|458702_459341_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D	gnl\|CDD\|236457	PRK09292, PRK09292, Na(+)-translocating NADH-quinone reductase subunit D; Validated.	1.0782e-142
NZ_CP044047.1\|WP_002889720.1\|459956_461180_+\|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F	gnl\|CDD\|235481	PRK05464, PRK05464, Na(+)-translocating NADH-quinone reductase subunit F; Provisional.	0
NZ_CP044047.1\|WP_004177336.1\|457915_458710_+\|Na(+)-translocating-NADH-quinone-reductase-subunit-C	gnl\|CDD\|235423	PRK05346, PRK05346, Na(+)-translocating NADH-quinone reductase subunit C; Provisional.	1.37213e-153
NZ_CP044047.1\|WP_064162511.1\|464193_465651_-\|cytosol-nonspecific-dipeptidase	gnl\|CDD\|184986	PRK15026, PRK15026, aminoacyl-histidine dipeptidase; Provisional.	0
NZ_CP044047.1\|WP_040215270.1\|454185_454926_-\|murein-L,D-transpeptidase	gnl\|CDD\|225577	COG3034, COG3034, Uncharacterized protein conserved in bacteria [Function unknown].	1.3611e-109

>NZ_CP044047.1|WP_002889722.1|461182_461398_+|(Na+)-NQR-maturation-NqrM
MLTVFIATFVIFALVILGMSLGYLVKRKSIQGSCGGISALGLEKVCDCPEPCDARKKRLAREAQRQQRRIL
>NZ_CP044047.1|WP_002889720.1|459956_461180_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-F
MEIILGVVMFTLIVLVLSGLILAARSKLVNAGDVVIEINNEADKQIRTPAGDKLLNTLSSNGIFVSSACGGGGSCGQCRVTVKEGGGDILPTELSHITKRDAKAGCRLACQVAVKQNMKIELPEEIFGVKKWECEVISNDNKATFIKELKLRIPEGEVVPFRAGGYIQIECPPHKVAYADFDVPDEYRSDWDKFNLFRYVSEVKEPTLRAYSMANYPEEKGIIMLNVRIATPPPKVPDAPPGIMSSYIWSLKPGDKVTISGPFGEFFAKETDAEMVFIGGGAGMAPMRSHIFDQLKRLHSTRKISFWYGARSLREMFYDEEFEQLARDNPNFTFHVALSDPLPEDNWTGHTGFIHNVLYENYLRDHPAPEDCEFYMCGPPVMNAAVIKMLKDLGVEDENILLDDFGG
>NZ_CP044047.1|WP_004177335.1|459347_459944_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-E
MAHYISLFVRAVFVENMALAFFLGMCTFLAVSKKVSTAFGLGVAVTVVLGLAVPINNLVYNLVLRDGALVEGVDLSFLNFITFIGVIAALVQILEMILDKYFPALYNALGIFLPLIAVNCAIFGGVSFMVQRDYNFPESIVYGFGSGIGWMLAIVAMAGIREKMKYANVPAGLRGLGITFITTGLMALGFMSFSGVQL
>NZ_CP044047.1|WP_002889716.1|458702_459341_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-D
MAEQSDMKEVKRVLVGPLIANNPIALQVLGVCSALAVTTKLETAFVMTIAVTLVTAFSSMFISMIRHHIPNSVRIIVQMAIIASLVIVVDQLLRAFAYETSKQLSVFVGLIITNCIVMGRAEAYAMKSPPLASFMDGIGNGLGYGAILIIVGFLRELIGSGKLFGITVLETVQNGGWYQPNGLFLLAPSAFFIIGLLIWALRSWKPEQQEKE
>NZ_CP044047.1|WP_004177336.1|457915_458710_+|Na(+)-translocating-NADH-quinone-reductase-subunit-C
MAEKKSNDSIGKTLLVVLVLCLVCSIVVAGSAVGLKSRQQAQRALDKQRNILAVSGLMHPGMDADAVADTFAARITPRLVNLATGELLEKDPGKFNQAQALKDPQQSMALDASQDPAGIKRRSNLAEIYLVRDAQQKIEQVVLPIYGNGLWSMMYAFVALDVDGRTVKGITYYDQGETPGLGGEVENPNWRQQFVGKQVLDDNGMPALKVVKGGARAGDLHAVDGLSGATLTSNGVQHSFDFWMGELGFGPFLKKVREGELNNG
>NZ_CP044047.1|WP_004147186.1|456684_457923_+|NADH:ubiquinone-reductase-(Na(+)-transporting)-subunit-B
MGLKHLIEKLEPHFTHGGKLEKYYPLYEAAATIFYTPGQVTRGAAHVRDAIDLKRMMILVWFAVFPAMFWGMYNVGLQTIPALHKLYGAEQLQQAIANNWHYSVAQWLGVSFSADAGWLSMMTLGAVFFLPIYITVFIVGGFWEVLFAIVRKHEINEGFFVTSILFALIVPPTLPLWQAALGISFGVVIAKEIFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTAADGFSGATPLSQWASGGGEALVNVATGVPVSWMDAFLGNIPGSIGEVSTLMIFIGGAIILFGRVASWRIVAGVMIGMIATATLFNVIGSDTNPMFAMPWYWHLVLGGFAFGMMFMATDPVSASFTDKGKWSYGVLIGVMCVLIRVVNPAYPEGMMLAILFANLFAPLFDYLVVQANIKRRKSRG
>NZ_CP044047.1|WP_002889702.1|455337_456681_+|Na(+)-translocating-NADH-quinone-reductase-subunit-A
MIKITKGLDLPIAGMPLQQISPAPAVKRVALLGEEYVGMRPAMAVKEGDRVKKGQILFEDKKIPGVCFTAPASGIVSAIHRGERRVLQSVVIDIEGNDAVAFTRYAADALAELPRDTVQQQLLASGQWTALRTRPFSKTPLPGSTPAAIFVNAMDTNPLAAEPQPIILAERAAFDAGLTVLTRLTDGKVHVCQPSGGKLGGHPLGQVCFNQFSGPHPAGLPGTHIHFLEPVSLNKQVWHLNYQDAIAIGKLFLDGELYCERIIALGGPQVTSPRLVKTTLGASLEDLLAGELQEGENRVISGSVLSGARAHGPHAFLGRFHLQVSVVKEGREKELFGWVMPGKEKFSITRTTLGHFFKRKRFHFSTDTNGGERAMVPIGNYERVMPLDILPTILLRDLLAGDTDSAQALGCLELDEEDLALCTYVCPGKYEYGPALRSVLTRIEQEG
>NZ_CP044047.1|WP_040215270.1|454185_454926_-|murein-L,D-transpeptidase
MRKIALFIAMLLLPCVSFAGLLSSNSPTTPVSKEYKQQLMGSPVYIEIFKEERMLDLYVKMGETYQLLDSYRICNYSGGLGPKQRQGDFKSPEGFYNVTRSQLKPDSRFYKAINIGFPNAYDRAHGYEGKYLMIHGDCVSVGCYAMTDSGIDEIFQFVTGALVFGQPSVQVSIYPFRMTNANMERHKYSYYADFWKQLKPGYDYFQQTHKPPIVSVTDGRYVVSKPLSHEVVQPQLASNYTLPETK
>NZ_CP044047.1|WP_002889696.1|453447_454215_+|class-II-glutamine-amidotransferase
MCELLGMSANVPTDICFSFTGLVQRGGGTGPHKDGWGITFYEGKGCRTFKDPQPSFQSPIAKLVQDYPIKSCSVVAHIRQANRGRVALENTHPFTRELWGRNWTYAHNGQLKGYKSLKTGNFHPVGETDSEKAFCWLLHRLTERYPRTPGNMLGVFKYIATLAGELREKGVFNMLLSDGRYVMAFCSTNLHWITRRAPFGVAKLLDQDVEIDFQRETTPNDVVTVIATQPLTANETWHKIMPGEWALFCLGERVV
>NZ_CP044047.1|WP_004145825.1|452791_453373_+|D-sedoheptulose-7-phosphate-isomerase
MYQDLIRNELNEAAETLANFLQDEANIHAIQRAAVLLADSFKAGGKVLSCGNGGSHCDAMHFAEELTGRYRENRPGYPAIAISDVSHLSCVSNDFGYEYVFSRYVESVGRAGDVLLGISTSGNSGNVIKAIEAARAQGMKVITLTGKDGGKMAGSADVEIRVPHFGYADRIQEIHIKVIHILIMLIEKEMAKG
>NZ_CP044047.1|WP_002889724.1|461620_462481_-|glycerophosphoryl-diester-phosphodiesterase
MKKILTALCLLATAGAWAAPQLIAHRGGTGDAPENTLPAIKLALENNAEAIWVTVQLSRDGVPVLYRSSDLSALTNSEGKVSSLTAAELAKVDAGWKWGDDSHPWRGKQATIPTLQSVLQQWPHTFFYIDIKSPDADPTVMGQRLLEVLKTTDSLDRVRVYSTEDRYIAALPPAIPRFVTRSETRTRLANISLSHQCQPASQRDGEQWYGLELKRKVEVVEKFTLGEGISPATLTWDKEAMDCFRSQDKAHIIFFGINSAEDYRTAIELGADGVMVDSPAQAKSWQ
>NZ_CP044047.1|WP_002889726.1|462640_463696_+|DNA-polymerase-IV
MRKIIHVDMDCFFAAVEMRDNPALRDIPLAIGGSRVQRGVISTANYPARKFGVRSAMPTATALKLCPHLTLLPGRFDAYKEASNHIREIFSRYTSRIEPLSLDEAYLDVSDSEHCHGSATLIAQEIRQTIERELRLTASAGVAPVKFLAKIASDMNKPNGQFVIAPHQVAEFVRALPLAKIPGVGKVSAAKLENMGLRTCGDVQNSDLAMLLKRFGKFGRILWERSHGIDEREIHNDRQRKSVGVERTLAEDIHEWPECEAIIENLYPELERRLAKVKPDLLIARQGIKLKFNDFQLTTQEHVWPRLNKEDLIATAHKAWDERRGGRGVRLVGLHVTLLDPQLERQLLLGI
>NZ_CP044047.1|WP_048270455.1|463698_464151_+|GNAT-family-N-acetyltransferase
MHIRAYRDSDLPLLCQIFLRAVWETASRDYTPGQIAAWAQVDETRWRQKLADSIGLVAVVNSQPVGFITAIGTHIDLLFVSPDRARQGIGGALIEALCAQYPAQILTVDASITAKPCFTAHGFKVVAEQRVAARGEWFINYRMEKRVALR
>NZ_CP044047.1|WP_064162511.1|464193_465651_-|cytosol-nonspecific-dipeptidase
MSELSQLSPQPLWDIFAKICSIPHPSYHEEQLAEHIMGWAKEKGLHAERDQVGNILIRKGATAGMENRRPVALQAHLDMVPQKNNDTVHDFVKDPIQPYIDGEWVKARGTTLGADNGIGMASALAVLADDSVAHGPLEVLLTMTEEAGMDGAFGLQANWLQADILINTDSEEEGEIYMGCAGGIDFTSNLALTREAIPAGFQSFKVTLKGLKGGHSGGDIHLGLGNANKLLSRFLAGHADELDLRLVDFNGGTLRNAIPREAYATVAVAADKADALKALVNTYQALLKNELEAKEKNLVVLVEAVDNDKAALTQASRDTFIRLLNATPNGVIRNSDVAKGVVETSLNVGVVTMTDDNVQIHCLIRSLIDSGKDYVVSMLDSLGKLAGAKTEAKGAYPGWQPDANSPVMHLVRETYQRLFNKTPNIQIIHAGLECGLFKKPYPEMDMVSIGPTITGPHSPDEQVHIESVGQYWTLLTELLKAIPAK
>NZ_CP044047.1|WP_002889733.1|465908_466367_+|xanthine-phosphoribosyltransferase
MSEKYVVTWDMLQIHARKLASRLLPVEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMGVVFVPPIAGR
>NZ_CP044047.1|WP_025861706.1|466472_467717_+|esterase-FrsA
MSQANLSETLFKPRFKHPETSTLVRRFSAGKPQAMQSALSGNHVDHWYRLINRLMWIWRGVTPQEILDVQARIVMSEAERTDPELFDTVIGYRGGNWIFEWAKEAMQWQQKAGQEADPLLSGRHWLHASNLYSIAAYPHIKGDELAEQAQALANRAYEEAAQRLPGSLRELEFTIPGGSPITGFLHMPKGEGPFPTVLMCGGLDSLQTDYYNLYENYFSPLGIAMLTIDMPSIGFSSKWTLNQDTSLLHQHALRHLENVPWVDHTRVAAFGFRFGANIAVRLGYLEPQRLKAVACLGPVVHGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELNRYSLKTQGLLGRRCPTPMLSGFWKDDPFSPEEESRLITSSSADGKLLEIPFNPVYRNFDHALRQIARWINHRFG
>NZ_CP044047.1|WP_002889793.1|467774_468173_+|sigma-factor-binding-protein-Crl
MTLPSGHLKSKLIKKFTALGPYIREEQCHDNRFFFDCLAVCVNVKPAPEKREFWGWWMEMEAQESRFTYSYQFGLFNKEGSWQAVDIDDPEVSDRLEKTLREFHERAAALLTTFNLKLEPADDFSEPVRLRA
>NZ_CP044047.1|WP_032420366.1|468541_468754_-|DUF1471-domain-containing-protein
MKTVSTIFSAAALSLFAFTASAHSVTATSNTLDSAEAMIAKKAKELNATDYKITSAHMGNKVTMSAVLDK
>NZ_CP044047.1|WP_048270456.1|468911_469328_-|SRPBCC-family-protein
MATTTVSIEIPASVDQVWQLMGGFDSLPDWLPFIPKSMVSEGGRVRTLTTSDGGTVIERLEAFDNRQRSYSYSIIQAPFPVVDYLSTIAVVATADSNITRVEWSGSFTPVNVSDADAEALFSGIYRDGLQALKDNFSA
>NZ_CP044047.1|WP_023325095.1|469360_470158_-|SDR-family-oxidoreductase
MKLDLTHKVAVVSGSTSGIGLGIAKGLAWAGATVVIVGRQQRGVDTAIAAINAEHPDAQLRGVVADLSTEEGVSALLAAEPHADVVVNNLGIFNDKDFFSVPDSEWMHFYNVNVLSGVRLSRHYAQGMIDNGWGRIIFVSSESGVAIPADMINYGVTKSANLAVSHGLAKRLAGTGVTVNAILPGPTFTEGLQEMLAEAATQSGRSPREQADEFVKTARPSSIIQRAADVDEVANLAVYLASPLSSATTGAALRVDGGVVDTLAM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1201359 : 1210822

Dickeya_phage(16.67%)

protease,tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002896440.1\|1201359_1202475_+	macrolide transporter subunit MacA	A0A140XAI1	Dickeya_phage	1.3e-06	52.7
WP_004150848.1\|1202471_1204412_+	macrolide ABC transporter ATP-binding protein/permease MacB	G9BWD6	Planktothrix_phage	1.9e-37	40.5
WP_002896516.1\|1204488_1204710_-	cold shock-like protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.3e-16	61.2
WP_002896520.1\|1205035_1205353_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.0e-13	45.7
WP_002896522.1\|1205383_1207663_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.6e-165	42.0
WP_001040187.1\|1207782_1208001_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_002898014.1\|1208354_1209056_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_062920823.1\|1209100_1210822_-	cysteine/glutathione ABC transporter ATP-binding protein/permease CydC	A0A2R8FG22	Brazilian_cedratvirus	9.0e-15	34.0

DBSCAN-SWA_2

1467037 : 1546467

Enterobacterial_phage(24.0%)

holin,tail,terminase,portal,protease,tRNA,integrase

attL 1463571:1463588|attR 1546065:1546082

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1463571:1463588	attL	NA	NA	NA	NA
WP_004150803.1\|1467037_1468144_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_004150802.1\|1468200_1468659_-	NUDIX hydrolase	NA	NA	NA	NA
WP_004150801.1\|1468675_1469326_-	23S rRNA pseudouridine(2457) synthase RluE	NA	NA	NA	NA
WP_004150800.1\|1469566_1470817_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	1.1e-19	92.6
WP_014228877.1\|1470934_1472062_-\|integrase	tyrosine-type recombinase/integrase	O21925	Phage_21	3.3e-119	58.4
WP_012542206.1\|1472042_1472288_-	excisionase	NA	NA	NA	NA
WP_064184756.1\|1472340_1474479_-	exonuclease	S4TNL0	Salmonella_phage	5.0e-100	43.0
WP_014228879.1\|1474620_1474965_-	transcriptional regulator	NA	NA	NA	NA
WP_016160636.1\|1475007_1475202_-	DUF1482 family protein	NA	NA	NA	NA
WP_114140416.1\|1475211_1475430_-	hypothetical protein	NA	NA	NA	NA
WP_040234937.1\|1475592_1475907_+	hypothetical protein	NA	NA	NA	NA
WP_032428184.1\|1476248_1476629_-	helix-turn-helix domain-containing protein	A0A0M4REM4	Salmonella_phage	1.9e-10	37.7
WP_023342905.1\|1476734_1476947_+	helix-turn-helix transcriptional regulator	A0A077K9X2	Edwardsiella_phage	1.9e-15	57.6
WP_063666440.1\|1476949_1477504_+	hypothetical protein	NA	NA	NA	NA
WP_040240595.1\|1477555_1478539_+	hypothetical protein	A0A0U2RT81	Escherichia_phage	2.4e-44	55.8
WP_040240646.1\|1478531_1478996_+	replication protein	A0A0U2JGJ0	Escherichia_phage	1.7e-61	68.9
WP_074182017.1\|1479009_1479450_+	hypothetical protein	NA	NA	NA	NA
WP_063666443.1\|1479679_1480711_+	hypothetical protein	NA	NA	NA	NA
WP_071034541.1\|1480940_1481270_+	hypothetical protein	K7PGV5	Enterobacterial_phage	3.4e-24	54.9
WP_048289195.1\|1481422_1481656_+	DinI family protein	K7PM44	Enterobacteria_phage	1.2e-26	73.7
WP_150340975.1\|1481667_1481958_+	hypothetical protein	H6WRY6	Salmonella_phage	4.0e-16	60.9
WP_052453822.1\|1481998_1482391_+	DNA-binding protein	K7PHB4	Enterobacterial_phage	1.4e-11	35.6
WP_040147621.1\|1482387_1482591_+	hypothetical protein	NA	NA	NA	NA
WP_048270331.1\|1482590_1483622_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	2.8e-96	49.6
WP_048270332.1\|1483638_1484241_+	hypothetical protein	H9C175	Pectobacterium_phage	1.9e-76	68.1
WP_017880269.1\|1485663_1485879_+\|holin	holin	A5LH82	Enterobacteria_phage	7.9e-30	87.3
WP_048270333.1\|1485878_1486376_+	lysozyme	A0A1V0E5Q7	Salmonella_phage	5.6e-79	85.2
WP_017898986.1\|1486372_1486723_+	hypothetical protein	R9TPM9	Aeromonas_phage	1.8e-10	39.8
WP_017898988.1\|1487802_1487991_+	hypothetical protein	NA	NA	NA	NA
WP_017898989.1\|1488097_1488319_+	hypothetical protein	NA	NA	NA	NA
WP_023342894.1\|1488771_1489089_+	hypothetical protein	NA	NA	NA	NA
WP_077256680.1\|1489085_1489508_+	hypothetical protein	Q6UAS0	Klebsiella_phage	1.2e-40	61.3
WP_023342892.1\|1489739_1490228_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	1.3e-72	87.7
WP_040234925.1\|1490227_1492330_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	84.0
WP_023342890.1\|1492326_1492539_+	hypothetical protein	A5LH28	Enterobacteria_phage	2.9e-24	80.0
WP_023342889.1\|1492538_1494041_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	2.8e-246	83.0
WP_032428174.1\|1493985_1496013_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	0.0e+00	82.1
WP_016530353.1\|1496096_1496423_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	8.1e-34	66.7
WP_023342887.1\|1496415_1496691_+	hypothetical protein	K7PH43	Enterobacteria_phage	1.1e-23	57.1
WP_016530351.1\|1496694_1497273_+\|tail	phage tail protein	K7PMB7	Enterobacterial_phage	1.7e-79	81.2
WP_016530350.1\|1497269_1497671_+\|tail	minor tail family protein	K7PHM6	Enterobacterial_phage	2.7e-55	75.6
WP_016530349.1\|1497679_1498423_+\|tail	phage tail protein	K7PKX6	Enterobacterial_phage	1.7e-111	83.0
WP_072216832.1\|1498433_1498862_+\|tail	phage minor tail protein G	M9NZD7	Enterobacteria_phage	2.7e-37	60.0
WP_071609142.1\|1498882_1499197_+\|tail	phage tail assembly protein T	E4WL32	Enterobacteria_phage	5.0e-41	75.0
WP_023342886.1\|1499180_1502324_+\|tail	phage tail tape measure protein	E4WL33	Enterobacteria_phage	0.0e+00	73.1
WP_023342885.1\|1502328_1502676_+\|tail	phage tail protein	K7PJT2	Enterobacteria_phage	4.7e-40	67.8
WP_016530342.1\|1502672_1503428_+\|tail	phage minor tail protein L	Q6UAW5	Klebsiella_phage	1.3e-130	84.1
WP_023342884.1\|1503429_1504140_+	hypothetical protein	Q6UAW4	Klebsiella_phage	1.1e-136	90.7
WP_016530340.1\|1504171_1504762_+\|tail	tail assembly protein	K7PHE5	Enterobacteria_phage	2.5e-81	77.0
WP_023342883.1\|1504824_1513641_+	DUF1983 domain-containing protein	Q6UAW1	Klebsiella_phage	0.0e+00	43.2
WP_023342882.1\|1513702_1515199_+\|tail	tail fiber domain-containing protein	A0A0P0IDN1	Klebsiella_phage	5.6e-130	65.4
WP_004892953.1\|1515353_1515506_+	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
WP_064162249.1\|1515617_1516760_-\|integrase	tyrosine-type recombinase/integrase	Q77Z02	Phage_21	5.9e-172	81.9
WP_064162275.1\|1516749_1516986_-	excisionase	NA	NA	NA	NA
WP_071562415.1\|1517014_1517287_-	hypothetical protein	K7PKM4	Enterobacterial_phage	4.4e-09	40.4
WP_064162248.1\|1517286_1517505_-	hypothetical protein	G8C7S3	Escherichia_phage	2.7e-09	53.4
WP_064162247.1\|1517497_1517866_-	hypothetical protein	A0A088CE95	Shigella_phage	1.1e-18	55.2
WP_064162245.1\|1518517_1518724_-	hypothetical protein	R9TRD3	Aeromonas_phage	1.1e-31	97.1
WP_023158884.1\|1518720_1518981_-	DUF4752 family protein	T1S9K2	Salmonella_phage	7.4e-30	75.0
WP_048983165.1\|1519668_1520454_-	hypothetical protein	A4JX52	Burkholderia_virus	2.2e-61	50.6
WP_024623196.1\|1520453_1520753_-	hypothetical protein	K7PJS4	Enterobacterial_phage	1.1e-13	48.6
WP_049264668.1\|1520842_1521760_-	recombination-associated protein RdgC	A0A1W6JP69	Morganella_phage	8.9e-46	36.5
WP_064162520.1\|1521969_1522329_-	hypothetical protein	NA	NA	NA	NA
WP_064162521.1\|1522630_1523326_-	helix-turn-helix transcriptional regulator	Q8HAA0	Salmonella_phage	3.2e-88	71.7
WP_001191665.1\|1523423_1523666_+	helix-turn-helix transcriptional regulator	A0A1C9IHV8	Salmonella_phage	1.3e-25	80.3
WP_004213338.1\|1523700_1524162_+	hypothetical protein	K7PJS5	Enterobacterial_phage	1.7e-69	88.2
WP_001208720.1\|1524399_1524579_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	4.6e-15	73.1
WP_024176409.1\|1524568_1525522_+	helix-turn-helix domain-containing protein	U5P0A0	Shigella_phage	3.7e-103	75.5
WP_065801420.1\|1525518_1526328_+	Dam family site-specific DNA-(adenine-N6)-methyltransferase	A0A1C9II58	Salmonella_phage	5.9e-110	69.3
WP_000779146.1\|1526337_1526715_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.3e-48	73.6
WP_032437712.1\|1526727_1527708_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	1.9e-134	66.9
WP_004899672.1\|1527721_1528300_+	DUF1133 family protein	A0A0U2S606	Escherichia_phage	7.6e-51	57.2
WP_071579616.1\|1528612_1528870_+	hypothetical protein	A0A286N2Q3	Klebsiella_phage	2.8e-42	98.8
WP_031280381.1\|1528775_1529222_-	hypothetical protein	NA	NA	NA	NA
WP_031280382.1\|1529834_1530134_+\|holin	holin	A0A286N2Q5	Klebsiella_phage	2.9e-46	99.0
WP_004184488.1\|1530130_1530670_+	glycoside hydrolase family 108 protein	A0A286N2Q6	Klebsiella_phage	2.3e-102	100.0
WP_004190674.1\|1530666_1531011_+	hypothetical protein	A0A286N2Q7	Klebsiella_phage	2.0e-38	80.7
WP_064162540.1\|1531007_1531283_+	hypothetical protein	G8C7W1	Escherichia_phage	7.3e-20	60.7
WP_071579617.1\|1531233_1531428_+	hypothetical protein	A0A286SGR9	Klebsiella_phage	1.1e-25	90.6
WP_124245667.1\|1531594_1531807_+	hypothetical protein	A0A286N2Q9	Klebsiella_phage	3.9e-21	70.0
WP_064162539.1\|1532241_1532487_+	DUF2560 family protein	A0A286N2R1	Klebsiella_phage	3.9e-33	95.1
WP_107334310.1\|1532712_1532973_+	hypothetical protein	NA	NA	NA	NA
WP_023320792.1\|1533038_1533224_+	hypothetical protein	Q8W634	Enterobacteria_phage	1.9e-11	61.1
WP_014228567.1\|1533545_1534037_+	DUF1441 family protein	K7PJY2	Enterobacterial_phage	6.4e-67	84.0
WP_064162538.1\|1534036_1536145_+\|terminase	phage terminase large subunit family protein	K7PH52	Enterobacterial_phage	0.0e+00	83.2
WP_020317294.1\|1536141_1536357_+	hypothetical protein	A5LH28	Enterobacteria_phage	7.7e-25	77.1
WP_049186538.1\|1536353_1537853_+\|portal	phage portal protein	K7PHM5	Enterobacterial_phage	1.9e-247	83.2
WP_150340978.1\|1537866_1538397_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	1.8e-46	76.0
WP_057729203.1\|1538344_1539580_+\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	2.2e-100	43.0
WP_057729204.1\|1539581_1539806_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_057729205.1\|1539865_1540726_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_114261011.1\|1540742_1540913_-	hypothetical protein	A0A2H4JB52	uncultured_Caudovirales_phage	2.1e-09	58.9
WP_077264224.1\|1541043_1541319_+	host cell division inhibitor Icd-like protein	A0A2H4JGW3	uncultured_Caudovirales_phage	3.3e-20	63.2
WP_057729206.1\|1541315_1541570_+	hypothetical protein	NA	NA	NA	NA
WP_032743295.1\|1541566_1541935_+	hypothetical protein	A0A2H4JCX7	uncultured_Caudovirales_phage	3.8e-56	91.0
WP_096923804.1\|1542213_1543302_+	AAA family ATPase	A0A2H4JFA4	uncultured_Caudovirales_phage	2.3e-157	79.3
WP_047050593.1\|1543497_1544211_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_047050594.1\|1544362_1544557_+	hypothetical protein	NA	NA	NA	NA
WP_047050595.1\|1544553_1546467_+\|protease	Clp protease ClpP	K7PKX4	Enterobacterial_phage	2.3e-213	57.6
1546065:1546082	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1550322 : 1597648

Enterobacteria_phage(36.84%)

tail,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049186541.1\|1550322_1550649_+	DUF2190 family protein	K7PJY3	Enterobacterial_phage	4.0e-33	66.4
WP_020317349.1\|1550641_1550935_+	sugar ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_064162536.1\|1550924_1551476_+\|tail	phage tail protein	K7P7A8	Enterobacteria_phage	1.6e-53	67.3
WP_020804325.1\|1551472_1551871_+\|tail	phage tail protein	K7PHM6	Enterobacterial_phage	3.2e-40	57.8
WP_071579619.1\|1551878_1552181_+	hypothetical protein	M9NYX0	Enterobacteria_phage	2.0e-34	70.2
WP_020804338.1\|1552177_1552360_+\|tail	major tail protein V domain protein	K7PGX1	Enterobacteria_phage	2.1e-15	72.7
WP_025714420.1\|1552402_1552798_+\|tail	phage tail protein	M9NZD7	Enterobacteria_phage	1.9e-08	27.5
WP_032420719.1\|1552818_1553136_+\|tail	phage tail assembly protein T	A0A0K2FJB3	Enterobacteria_phage	1.4e-19	51.5
WP_064162535.1\|1553116_1555813_+\|tail	phage tail tape measure protein	K7PKR0	Enterobacteria_phage	2.2e-201	62.6
WP_032420722.1\|1555812_1556286_+	hypothetical protein	A0A286S298	Klebsiella_phage	3.9e-53	63.5
WP_038433285.1\|1556272_1556755_+	DUF1833 family protein	A0A286S2B1	Klebsiella_phage	8.5e-56	67.7
WP_029497207.1\|1556762_1557149_+	hypothetical protein	A0A286S2A6	Klebsiella_phage	4.7e-33	50.8
WP_064162534.1\|1557145_1560214_+	hypothetical protein	A0A286S259	Klebsiella_phage	0.0e+00	66.3
WP_071579620.1\|1562257_1563058_+	hypothetical protein	NA	NA	NA	NA
WP_064162136.1\|1563068_1563251_+	Hin recombinase	A0A286S1P7	Klebsiella_phage	1.8e-19	87.0
WP_071579621.1\|1563328_1563751_+	hypothetical protein	K7P834	Enterobacteria_phage	1.2e-24	43.8
WP_077265864.1\|1564593_1564887_+	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	3.9e-27	80.0
WP_064162135.1\|1565083_1566790_+	hypothetical protein	NA	NA	NA	NA
WP_064162134.1\|1567825_1568626_-	hypothetical protein	NA	NA	NA	NA
WP_004892953.1\|1568834_1568987_+	isocitrate dehydrogenase	Q77Z09	Phage_21	3.8e-18	92.0
WP_032419088.1\|1569259_1569973_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_023159861.1\|1569969_1570362_-	ACT domain protein	NA	NA	NA	NA
WP_004150797.1\|1570354_1570678_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_023159860.1\|1570921_1571107_+	hypothetical protein	NA	NA	NA	NA
WP_004140530.1\|1571127_1571355_-	DUF1272 domain-containing protein	NA	NA	NA	NA
WP_004140529.1\|1571467_1572661_-	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_004150795.1\|1573283_1573469_+	general stress protein	NA	NA	NA	NA
WP_004148027.1\|1573559_1574054_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004140514.1\|1574080_1574587_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_004140512.1\|1574603_1575491_+	manganese catalase family protein	NA	NA	NA	NA
WP_021313534.1\|1575546_1576953_+	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_004183659.1\|1576949_1577960_+	cytochrome d ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_023328665.1\|1578075_1578273_-	hypothetical protein	NA	NA	NA	NA
WP_004183660.1\|1578839_1579472_+	DNA-binding protein	NA	NA	NA	NA
WP_004140501.1\|1579511_1579691_+	hypothetical protein	NA	NA	NA	NA
WP_004150790.1\|1580089_1580776_+	EAL domain-containing protein	NA	NA	NA	NA
WP_004140497.1\|1581086_1582595_-	UbiD family decarboxylase	NA	NA	NA	NA
WP_032439862.1\|1582715_1583606_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_019705575.1\|1583612_1585397_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.8e-17	36.1
WP_004140494.1\|1585470_1586679_-	HD domain-containing protein	NA	NA	NA	NA
WP_004179363.1\|1586981_1588025_+	type II asparaginase	NA	NA	NA	NA
WP_004148038.1\|1588686_1589601_+	kdo(2)-lipid IV(A) palmitoleoyltransferase	A0A1W6JP29	Morganella_phage	1.1e-72	50.4
WP_004150783.1\|1589690_1590329_+	leucine efflux protein LeuE	NA	NA	NA	NA
WP_004140489.1\|1590459_1590723_+	DUF2534 family protein	NA	NA	NA	NA
WP_004140488.1\|1590782_1590908_-	hypothetical protein	NA	NA	NA	NA
WP_004213093.1\|1591025_1591100_-	protein YoaJ	NA	NA	NA	NA
WP_004150782.1\|1591099_1591201_-	YoaK family small membrane protein	NA	NA	NA	NA
WP_064162133.1\|1591258_1592272_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	1.1e-12	33.8
WP_004140479.1\|1592572_1592812_+	DUF333 domain-containing protein	NA	NA	NA	NA
WP_004150779.1\|1592801_1593158_-	DUF488 domain-containing protein	NA	NA	NA	NA
WP_004176547.1\|1593144_1593654_-	DUF523 domain-containing protein	NA	NA	NA	NA
WP_032439865.1\|1593799_1594492_+	CTP synthase	NA	NA	NA	NA
WP_004148041.1\|1594523_1595708_-	CynX/NimT family MFS transporter	NA	NA	NA	NA
WP_002901073.1\|1595809_1596601_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002901080.1\|1596584_1597031_-	DUF441 domain-containing protein	NA	NA	NA	NA
WP_002901088.1\|1597147_1597648_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA

DBSCAN-SWA_4

1991515 : 2002402

Escherichia_phage(87.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002210516.1\|1991515_1992136_-	aldolase	A0A077SK32	Escherichia_phage	8.0e-115	100.0
WP_004224682.1\|1992128_1993394_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	7.8e-234	99.8
WP_002903955.1\|1993405_1994308_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-159	99.7
WP_002210513.1\|1994568_1995330_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_001620095.1\|1995350_1996211_-	class A broad-spectrum beta-lactamase SHV-1	A0A077SL40	Escherichia_phage	4.4e-156	99.7
WP_004176262.1\|1996508_1996769_+	hypothetical protein	A0A077SK33	Escherichia_phage	5.4e-41	98.8
WP_001620097.1\|1996855_1997944_+	AAA family ATPase	A0A077SLJ9	Escherichia_phage	8.0e-211	100.0
WP_032419002.1\|1997974_1999240_-	MFS transporter	NA	NA	NA	NA
WP_064162078.1\|1999294_2002402_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	0.0e+00	59.6

DBSCAN-SWA_5

2778816 : 2869178

113

Enterobacteria_phage(19.3%)

head,plate,tail,terminase,portal,protease,capsid,tRNA,integrase

attL 2822875:2822890|attR 2877156:2877171

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002911381.1\|2778816_2779701_-\|protease	protease HtpX	NA	NA	NA	NA
WP_004145536.1\|2779935_2781984_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	3.0e-86	33.3
WP_014907336.1\|2782003_2782681_-	RNA chaperone ProQ	NA	NA	NA	NA
WP_002911386.1\|2782778_2783276_-	GAF domain-containing protein	NA	NA	NA	NA
WP_064162198.1\|2783408_2784692_+	membrane integrity lipid transport subunit YebS	NA	NA	NA	NA
WP_002911388.1\|2784660_2787294_+	PqiB family protein	NA	NA	NA	NA
WP_004148845.1\|2787418_2788852_+	16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF	NA	NA	NA	NA
WP_002911393.1\|2788967_2789207_+	YebV family protein	NA	NA	NA	NA
WP_002911395.1\|2789304_2789496_+	YebW family protein	NA	NA	NA	NA
WP_004180432.1\|2789492_2790146_-	protein-serine/threonine phosphatase	A0A222YWF0	Escherichia_phage	8.0e-57	50.7
WP_002911397.1\|2790266_2791271_+	DUF535 domain-containing protein	NA	NA	NA	NA
WP_002911398.1\|2791375_2791519_+	Ecr family regulatory small membrane protein	NA	NA	NA	NA
WP_015874944.1\|2792155_2792497_-	YebY family protein	NA	NA	NA	NA
WP_004175431.1\|2792510_2793380_-	copper homeostasis membrane protein CopD	NA	NA	NA	NA
WP_004151448.1\|2793383_2793758_-	CopC domain-containing protein YobA	NA	NA	NA	NA
WP_002911406.1\|2793870_2794101_+	DNA polymerase III subunit theta	H9C187	Pectobacterium_phage	5.9e-15	57.4
WP_002911407.1\|2794179_2794839_+	exodeoxyribonuclease X	A0A0H4IT92	Pseudoalteromonas_phage	2.2e-14	31.7
WP_004151449.1\|2794842_2796903_-	oligopeptidase B	NA	NA	NA	NA
WP_004145550.1\|2797023_2797683_-	tellurite resistance TerB family protein	NA	NA	NA	NA
WP_004175424.1\|2797822_2798170_-	LexA family transcriptional regulator	NA	NA	NA	NA
WP_023313384.1\|2798314_2799493_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_002911423.1\|2799550_2800192_-	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_064162199.1\|2800230_2802042_-	phosphogluconate dehydratase	NA	NA	NA	NA
WP_002911427.1\|2802264_2803740_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	3.2e-77	36.8
WP_004145554.1\|2803750_2803900_-	hypothetical protein	NA	NA	NA	NA
WP_004189259.1\|2803871_2804060_+	hypothetical protein	NA	NA	NA	NA
WP_040236900.1\|2804095_2804965_+	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002911440.1\|2805090_2806533_+	pyruvate kinase	NA	NA	NA	NA
WP_004175421.1\|2806573_2807548_-	lauroyl-Kdo(2)-lipid IV(A) myristoyltransferase	NA	NA	NA	NA
WP_002911444.1\|2807665_2808985_-	murein DD-endopeptidase MepM	A8ATH6	Listeria_phage	5.3e-15	38.2
WP_071579711.1\|2809000_2809945_-	zinc ABC transporter substrate-binding protein ZnuA	NA	NA	NA	NA
WP_002911449.1\|2810023_2810776_+	zinc ABC transporter ATP-binding protein ZnuC	W6JKT0	Anomala_cuprea_entomopoxvirus	6.7e-15	32.4
WP_002911451.1\|2810775_2811561_+	zinc ABC transporter permease subunit ZnuB	NA	NA	NA	NA
WP_004148860.1\|2811624_2812635_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.4e-07	24.3
WP_002911454.1\|2812643_2813255_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_002911456.1\|2813334_2813856_-	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	3.4e-10	35.1
WP_002911459.1\|2813890_2814631_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_002911477.1\|2814658_2815102_-	dihydroneopterin triphosphate diphosphatase	NA	NA	NA	NA
WP_049000419.1\|2815103_2816891_-\|tRNA	aspartate--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.3e-11	27.2
WP_004145564.1\|2817158_2817725_+	hydrolase	NA	NA	NA	NA
WP_076997021.1\|2817989_2818307_-	hypothetical protein	I6PCW5	Cronobacter_phage	1.4e-22	52.6
WP_065801522.1\|2818306_2818546_-	hypothetical protein	K7P7N3	Enterobacteria_phage	1.3e-17	53.2
WP_076997020.1\|2818650_2819451_-	hypothetical protein	NA	NA	NA	NA
WP_076997019.1\|2819460_2821452_-	hypothetical protein	A0A286S1P0	Klebsiella_phage	3.1e-27	29.1
WP_076997017.1\|2822536_2823220_-	YmfQ family protein	NA	NA	NA	NA
2822875:2822890	attL	NA	NA	NA	NA
WP_048294794.1\|2823216_2824365_-\|plate	baseplate J/gp47 family protein	R9TN81	Rhizobium_phage	7.1e-16	27.5
WP_048294792.1\|2824354_2824804_-	hypothetical protein	A0A0C4UR04	Shigella_phage	3.8e-18	40.7
WP_077259445.1\|2824796_2825345_-\|plate	phage baseplate assembly protein	A0A077KAY0	Edwardsiella_phage	5.4e-06	33.3
WP_076997016.1\|2825380_2826460_-\|tail	phage tail protein	Q8SBG7	Shigella_phage	1.2e-38	31.3
WP_076997015.1\|2826456_2827857_-	hypothetical protein	NA	NA	NA	NA
WP_076997014.1\|2827902_2829777_-	hypothetical protein	Q858G0	Salmonella_phage	4.5e-20	40.5
WP_101976956.1\|2829769_2829961_-	hypothetical protein	NA	NA	NA	NA
WP_076997013.1\|2829918_2830197_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_048294781.1\|2830198_2830567_-\|tail	phage tail protein	NA	NA	NA	NA
WP_076997012.1\|2830570_2832082_-\|tail	phage tail protein	B5TK67	Pseudomonas_phage	2.0e-106	44.2
WP_070082887.1\|2832078_2832264_-	DUF2635 domain-containing protein	A0A2P9JZJ7	Alteromonadaceae_phage	1.8e-06	42.6
WP_076997011.1\|2832267_2832813_-	ATP-binding protein	NA	NA	NA	NA
WP_072061027.1\|2832809_2833169_-	hypothetical protein	NA	NA	NA	NA
WP_076997010.1\|2833174_2833573_-	hypothetical protein	NA	NA	NA	NA
WP_069197048.1\|2833544_2834594_-\|capsid	major capsid protein	V5Q8X6	Xylella_phage	1.2e-38	29.4
WP_064169643.1\|2834691_2835096_-\|head	head decoration protein	A0A0C5AN05	Bacteriophage	3.1e-11	37.6
WP_096645209.1\|2835095_2835410_-	hypothetical protein	NA	NA	NA	NA
WP_096833751.1\|2835393_2835651_+	hypothetical protein	NA	NA	NA	NA
WP_076997008.1\|2835678_2836545_-	S49 family peptidase	A0A2D1GN02	Marinobacter_phage	3.1e-48	39.5
WP_048294765.1\|2836541_2838179_-\|portal	phage portal protein	A0A291AUL8	Sinorhizobium_phage	6.8e-89	35.9
WP_032735077.1\|2838178_2838442_-\|head,tail	phage head-tail adapter protein	NA	NA	NA	NA
WP_076997007.1\|2838450_2840574_-\|terminase	terminase	A0A2K9V3X4	Faecalibacterium_phage	1.6e-98	35.9
WP_058836975.1\|2840515_2841079_-	hypothetical protein	NA	NA	NA	NA
WP_076997006.1\|2841334_2842048_-	hypothetical protein	NA	NA	NA	NA
WP_076997005.1\|2842116_2842755_-	hypothetical protein	NA	NA	NA	NA
WP_076997004.1\|2843159_2843588_-	hypothetical protein	NA	NA	NA	NA
WP_076997003.1\|2843725_2843980_-	Rz1 lytic protein	U5P461	Shigella_phage	2.5e-22	66.7
WP_076997002.1\|2843867_2844257_-	DUF2570 domain-containing protein	A0A192Y6H8	Salmonella_phage	1.2e-23	48.4
WP_064144940.1\|2844253_2844757_-	lysozyme	K7P7Q3	Enterobacteria_phage	1.9e-74	79.6
WP_004146347.1\|2844759_2845074_-	hypothetical protein	H6WRZ3	Salmonella_phage	6.3e-44	86.1
WP_048322094.1\|2845499_2846024_+	hypothetical protein	NA	NA	NA	NA
WP_048322093.1\|2846368_2847058_-	antiterminator	I6PDF8	Cronobacter_phage	1.9e-56	54.5
WP_001548467.1\|2847054_2847195_-	YlcG family protein	NA	NA	NA	NA
WP_071579703.1\|2847191_2847773_-	protein NinG	E7C9S3	Salmonella_phage	8.7e-39	43.8
WP_071579702.1\|2847765_2848440_-	serine/threonine protein phosphatase	K7P6H8	Enterobacteria_phage	5.1e-99	74.0
WP_071579701.1\|2848436_2848604_-	NinE family protein	G8C7V4	Escherichia_phage	6.2e-14	75.0
WP_071579700.1\|2848603_2849041_-	recombination protein NinB	G8C7V3	Escherichia_phage	7.4e-59	77.7
WP_039108779.1\|2849392_2849713_-	hypothetical protein	NA	NA	NA	NA
WP_039108781.1\|2849878_2850127_-	hypothetical protein	NA	NA	NA	NA
WP_085921672.1\|2850126_2850687_-	DUF551 domain-containing protein	A5LH60	Enterobacteria_phage	2.7e-05	30.3
WP_029602865.1\|2850794_2851088_-	hypothetical protein	Q6UAT9	Klebsiella_phage	2.7e-44	86.6
WP_040181701.1\|2851580_2851841_-	DUF4752 family protein	T1S9K2	Salmonella_phage	1.6e-29	75.6
WP_052450983.1\|2851837_2852290_-	hypothetical protein	R9TME7	Aeromonas_phage	4.4e-14	40.6
WP_040182091.1\|2852526_2852820_-	protein ren	M1FPD5	Enterobacteria_phage	2.1e-25	62.4
WP_040182092.1\|2852816_2853665_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	1.2e-89	60.8
WP_071579699.1\|2853661_2854522_-	replication protein	K7PGT1	Enterobacteria_phage	1.2e-60	53.6
WP_001548453.1\|2854607_2854829_-	hypothetical protein	G8EYH8	Enterobacteria_phage	6.9e-05	41.7
WP_004191589.1\|2854868_2855087_-	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	1.4e-13	50.7
WP_021312733.1\|2855195_2855855_+	helix-turn-helix domain-containing protein	K7P7K3	Enterobacteria_phage	1.9e-69	61.5
WP_032717012.1\|2856540_2856735_+	hypothetical protein	NA	NA	NA	NA
WP_071579698.1\|2856822_2857824_+	hypothetical protein	M9P0E1	Enterobacteria_phage	4.2e-65	90.4
WP_064162447.1\|2857831_2858116_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	5.2e-29	61.7
WP_008807812.1\|2858132_2858879_+	phage recombination protein Bet	A0A0M4RD39	Salmonella_phage	3.1e-65	67.7
WP_008807811.1\|2858875_2859499_+	exonuclease	A0A0S2SY31	Pseudomonas_phage	9.0e-58	59.7
WP_032439799.1\|2859527_2860055_+	phage N-6-adenine-methyltransferase	Q9ZWX6	Enterobacteria_phage	1.2e-55	59.8
WP_060415520.1\|2860051_2860273_+	hypothetical protein	NA	NA	NA	NA
WP_077265874.1\|2860158_2860776_+	HNH endonuclease	A0A1W6DY33	Salmonella_phage	7.8e-38	47.0
WP_025269983.1\|2860772_2860964_+	DUF1382 family protein	A0A0P0ZC60	Stx2-converting_phage	6.0e-13	62.7
WP_064162449.1\|2860960_2861179_+	TraR/DksA family transcriptional regulator	A0A0K2FI84	Escherichia_phage	2.6e-12	52.2
WP_016244760.1\|2861182_2861428_+	excisionase family protein	A0A286S2A4	Klebsiella_phage	3.8e-36	93.4
WP_043906718.1\|2861470_2862730_+\|integrase	site-specific integrase	A0A286S1S8	Klebsiella_phage	2.3e-225	89.9
WP_043906717.1\|2862726_2863506_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	1.1e-60	82.7
WP_002911484.1\|2863558_2863954_+	membrane protein	NA	NA	NA	NA
WP_002911486.1\|2863993_2864737_+	carboxy-S-adenosyl-L-methionine synthase CmoA	F5B419	Synechococcus_phage	4.1e-25	30.0
WP_004151451.1\|2864733_2865738_+\|tRNA	tRNA 5-methoxyuridine(34)/uridine 5-oxyacetic acid(34) synthase CmoB	NA	NA	NA	NA
WP_004180440.1\|2865819_2866563_-	copper homeostasis protein CutC	NA	NA	NA	NA
WP_002911491.1\|2866639_2867209_-	VOC family protein	NA	NA	NA	NA
WP_004151452.1\|2867444_2869178_+\|tRNA	arginine--tRNA ligase	A0A2K9L6Z2	Tupanvirus	1.4e-87	33.8
2877156:2877171	attR	NA	NA	NA	NA

DBSCAN-SWA_6

3127365 : 3134270

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004214740.1\|3127365_3128844_+	two-component system sensor histidine kinase BaeS	W8CYF6	Bacillus_phage	1.4e-29	28.3
WP_004175198.1\|3128840_3129563_+	two-component system response regulator BaeR	W8CYM9	Bacillus_phage	8.3e-31	33.2
WP_004144192.1\|3129881_3131243_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	1.8e-207	94.8
WP_064162400.1\|3131488_3132382_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	2.1e-15	30.2
WP_064162372.1\|3132622_3133396_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-25	36.3
WP_064162399.1\|3133406_3134270_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-10	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044046

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 24241

Salmonella_phage(96.77%)

portal,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004109830.1\|2546_2780_-	hypothetical protein	J9Q7F7	Salmonella_phage	3.4e-34	93.5
WP_004109835.1\|2896_3214_-	hypothetical protein	J9Q7R3	Salmonella_phage	1.8e-46	93.3
WP_004109839.1\|3275_4022_-	Ig domain-containing protein	J9Q7Y4	Salmonella_phage	3.7e-106	83.0
WP_102007214.1\|4089_4482_-	hypothetical protein	J9Q6D8	Salmonella_phage	1.0e-46	67.5
WP_021313126.1\|4483_4957_-	hypothetical protein	J9Q711	Salmonella_phage	1.9e-76	93.6
WP_004109848.1\|4947_5292_-	hypothetical protein	J9Q7F6	Salmonella_phage	7.4e-54	92.1
WP_023279432.1\|5389_6223_-	hypothetical protein	J9Q7R2	Salmonella_phage	2.4e-130	83.4
WP_023279433.1\|6222_6657_-	hypothetical protein	J9Q7Y3	Salmonella_phage	2.9e-63	84.0
WP_014342134.1\|6704_7133_-	Ig domain-containing protein	J9Q6D6	Salmonella_phage	7.9e-29	71.6
WP_004109857.1\|7211_8090_-	hypothetical protein	J9Q710	Salmonella_phage	4.7e-153	94.2
WP_023279435.1\|8116_9016_-	hypothetical protein	J9Q7F4	Salmonella_phage	6.1e-124	82.6
WP_112295219.1\|9038_10628_-\|portal	phage portal protein	J9Q7R1	Salmonella_phage	1.4e-275	88.7
WP_004109863.1\|10645_11902_-\|terminase	terminase	J9Q7Y2	Salmonella_phage	9.4e-248	97.4
WP_004109866.1\|11904_12546_-	DNA-binding protein	J9Q6D4	Salmonella_phage	5.0e-96	88.2
WP_004109869.1\|12721_12988_-	hypothetical protein	J9Q757	Salmonella_phage	1.3e-37	90.9
WP_026005938.1\|12997_13897_-	hypothetical protein	J9Q7I6	Salmonella_phage	4.2e-165	97.0
WP_060528000.1\|13893_14148_-	hypothetical protein	J9Q7U0	Salmonella_phage	3.4e-40	95.2
WP_019704584.1\|14140_14779_-	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	1.4e-109	97.6
WP_112295220.1\|14775_15444_-	ParB N-terminal domain-containing protein	J9Q6L1	Salmonella_phage	1.5e-106	91.4
WP_021313132.1\|15443_16124_-	ParB N-terminal domain-containing protein	J9Q756	Salmonella_phage	2.1e-108	89.3
WP_021313133.1\|16207_17767_+	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	1.2e-279	92.9
WP_014342145.1\|17769_18045_+	hypothetical protein	J9Q7T9	Salmonella_phage	4.0e-26	68.1
WP_019704582.1\|18095_18533_-	hypothetical protein	A0A1V0E7W1	Vibrio_phage	9.5e-14	36.4
WP_014342147.1\|18688_19219_+	transcriptional regulator	J9Q6L0	Salmonella_phage	3.5e-71	84.5
WP_100098059.1\|19222_19531_+	hypothetical protein	NA	NA	NA	NA
WP_047066281.1\|19852_20503_+	hypothetical protein	J9Q754	Salmonella_phage	2.9e-107	92.1
WP_004109904.1\|20553_20757_+	hypothetical protein	J9Q7I3	Salmonella_phage	4.1e-28	95.5
WP_042935000.1\|21349_21832_-	hypothetical protein	J9Q805	Salmonella_phage	2.5e-71	78.1
WP_080031187.1\|22036_22318_-	ABC transporter	J9Q753	Salmonella_phage	6.9e-42	83.9
WP_021313142.1\|22320_22695_-	hypothetical protein	NA	NA	NA	NA
WP_004109918.1\|22822_23230_-	hypothetical protein	NA	NA	NA	NA
WP_080031186.1\|23349_23661_-	hypothetical protein	J9Q7T7	Salmonella_phage	2.0e-29	66.0
WP_080031185.1\|23797_24010_-	hypothetical protein	J9Q804	Salmonella_phage	1.2e-25	74.3
WP_150340956.1\|24022_24241_-	hypothetical protein	J9Q6K7	Salmonella_phage	1.9e-26	80.6

DBSCAN-SWA_2

28189 : 36176

Salmonella_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112295224.1\|28189_29746_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	7.1e-104	42.5
WP_150340958.1\|29742_30960_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_112295226.1\|31076_34193_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	2.0e-25	24.0
WP_064173661.1\|34254_34470_-	hypothetical protein	J9Q747	Salmonella_phage	1.2e-14	69.8
WP_114071303.1\|34598_35177_-	hypothetical protein	J9Q7H6	Salmonella_phage	1.5e-54	57.0
WP_014342167.1\|35304_35460_-	DUF3927 family protein	H6WZJ7	Escherichia_phage	1.7e-05	61.2
WP_019704567.1\|35459_35885_-	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	9.8e-56	80.9
WP_150340959.1\|35987_36176_-	hypothetical protein	J9Q800	Salmonella_phage	6.7e-09	54.2

DBSCAN-SWA_3

39736 : 107895

Salmonella_phage(89.47%)

integrase,tail

attL 61096:61115|attR 76965:76984

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019704564.1\|39736_39970_-	hypothetical protein	J9Q7H5	Salmonella_phage	2.7e-31	84.2
WP_023279507.1\|40167_40761_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	5.9e-99	85.3
WP_065809999.1\|40945_41779_-	hypothetical protein	J9Q7Z9	Salmonella_phage	8.6e-64	56.4
WP_032423056.1\|41904_42453_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	3.2e-75	74.4
WP_050485941.1\|42449_43031_-	hypothetical protein	A0A1B0VMI8	Pseudomonas_phage	4.2e-33	50.4
WP_039817735.1\|43253_43673_-	hypothetical protein	J9Q743	Salmonella_phage	1.7e-52	74.8
WP_023279503.1\|43736_44381_-	AAA family ATPase	J9Q7H4	Salmonella_phage	4.7e-94	77.6
WP_150340960.1\|44380_44857_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	2.4e-71	79.0
WP_019704560.1\|44853_45267_-	hypothetical protein	J9Q7Z8	Salmonella_phage	2.3e-54	76.6
WP_023279500.1\|45268_46372_-	thymidylate synthase	J9Q6J6	Salmonella_phage	6.7e-181	80.1
WP_023279499.1\|46565_47441_-	nucleoside triphosphate pyrophosphohydrolase family protein	J9Q742	Salmonella_phage	1.2e-140	85.1
WP_014342181.1\|47518_48661_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	9.0e-213	95.8
WP_065809998.1\|48791_51095_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	90.8
WP_040247361.1\|51170_51740_-	hypothetical protein	J9Q7Z7	Salmonella_phage	1.1e-94	89.9
WP_072196422.1\|51749_52460_-	hypothetical protein	J9Q6J5	Salmonella_phage	3.9e-73	59.7
WP_048333494.1\|52485_54402_-	AAA family ATPase	J9Q741	Salmonella_phage	1.8e-298	84.3
WP_072196416.1\|54398_54632_-	hypothetical protein	J9Q7H1	Salmonella_phage	4.4e-18	66.1
WP_021313776.1\|54631_55717_-	exonuclease	J9Q7S9	Salmonella_phage	1.1e-183	84.8
WP_021313777.1\|55905_56400_-	GNAT family N-acetyltransferase	J9Q6J3	Salmonella_phage	1.0e-59	67.1
WP_042935022.1\|56475_57120_-	hypothetical protein	J9Q739	Salmonella_phage	4.9e-99	80.7
WP_100091244.1\|57216_57429_-	hypothetical protein	NA	NA	NA	NA
WP_032423053.1\|57440_58538_+	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	1.2e-73	47.3
WP_014342074.1\|58968_59181_-	hypothetical protein	J9Q7S8	Salmonella_phage	4.3e-28	80.0
WP_039817757.1\|59180_59516_-	hypothetical protein	J9Q7Z5	Salmonella_phage	3.6e-37	67.6
WP_023279494.1\|59512_59692_-	hypothetical protein	NA	NA	NA	NA
WP_150340961.1\|60224_61301_-	recombinase	J9Q736	Salmonella_phage	1.9e-196	95.8
61096:61115	attL	NA	NA	NA	NA
WP_019704549.1\|61303_61570_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.7e-34	84.1
WP_021313784.1\|61569_62514_-	exonuclease	J9Q7S6	Salmonella_phage	2.8e-172	93.6
WP_042935032.1\|62574_63582_-	hypothetical protein	J9Q7Z3	Salmonella_phage	2.3e-143	87.6
WP_064164595.1\|63701_64133_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.4e-65	91.6
WP_014342082.1\|64305_64605_-	lipoprotein	NA	NA	NA	NA
WP_048292514.1\|64616_65036_-	hypothetical protein	A0A291AWZ9	Escherichia_phage	6.3e-47	62.6
WP_150340962.1\|65236_65680_-	hypothetical protein	J9Q7S4	Salmonella_phage	7.6e-59	82.3
WP_150340963.1\|65676_69195_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	93.1
WP_071994325.1\|69169_69373_-	hypothetical protein	J9Q6I7	Salmonella_phage	3.3e-25	80.6
WP_019704545.1\|69375_70608_-	AAA domain-containing protein	J9Q733	Salmonella_phage	1.3e-212	86.6
WP_065809995.1\|70704_72984_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	2.1e-245	62.8
WP_032423001.1\|73100_73313_-	hypothetical protein	NA	NA	NA	NA
WP_014342091.1\|73586_73967_+	transcriptional regulator	NA	NA	NA	NA
WP_032422994.1\|73961_75062_-\|integrase	site-specific integrase	A0A1P8DTG6	Proteus_phage	1.2e-17	28.4
WP_150340964.1\|75268_75838_+	hypothetical protein	NA	NA	NA	NA
WP_150340965.1\|75821_76049_+	hypothetical protein	NA	NA	NA	NA
WP_150340966.1\|76450_77227_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	1.7e-90	66.1
76965:76984	attR	NA	NA	NA	NA
WP_064165103.1\|77470_78187_-	hypothetical protein	NA	NA	NA	NA
WP_150340967.1\|79983_80262_-	C-type natriuretic protein	J9Q7S1	Salmonella_phage	6.9e-26	67.4
WP_087636937.1\|80258_80411_-	hypothetical protein	J9Q7Z1	Salmonella_phage	7.1e-17	84.0
WP_050484095.1\|80655_81123_-	hypothetical protein	J9Q7R9	Salmonella_phage	3.4e-49	63.9
WP_150340968.1\|81202_81991_-	hypothetical protein	J9Q7Z0	Salmonella_phage	5.3e-71	51.1
WP_039817658.1\|82279_83446_+	hypothetical protein	NA	NA	NA	NA
WP_150340969.1\|83487_84606_-	DNA primase	J9Q720	Salmonella_phage	5.3e-202	91.3
WP_032440528.1\|84758_86099_-	AAA family ATPase	J9Q7G4	Salmonella_phage	5.4e-241	96.0
WP_023279420.1\|86163_86889_-	hypothetical protein	J9Q7R8	Salmonella_phage	2.5e-128	88.8
WP_150340970.1\|87079_87490_-	hypothetical protein	NA	NA	NA	NA
WP_150340971.1\|87482_88217_-	hypothetical protein	J9Q719	Salmonella_phage	7.0e-17	41.3
WP_019704530.1\|88253_88616_-	hypothetical protein	J9Q7G3	Salmonella_phage	1.5e-44	97.9
WP_115694729.1\|88615_89281_-	AAA family ATPase	J9Q7R7	Salmonella_phage	2.9e-102	83.7
WP_150340972.1\|89600_90158_+	hypothetical protein	A0A2H4J5U3	uncultured_Caudovirales_phage	4.3e-35	43.2
WP_023279423.1\|90218_90404_-	hypothetical protein	J9Q7G2	Salmonella_phage	1.3e-17	68.3
WP_032422981.1\|90354_90606_-	hypothetical protein	J9Q7R6	Salmonella_phage	9.9e-24	72.3
WP_014342120.1\|90608_91301_-	membrane protein	J9Q7Y7	Salmonella_phage	7.0e-120	89.6
WP_004109805.1\|91314_91638_-	hypothetical protein	J9Q6E7	Salmonella_phage	2.3e-49	95.3
WP_032422978.1\|91733_93179_-\|tail	tail fiber domain-containing protein	A0A0H4TGH1	Klebsiella_phage	4.4e-39	37.5
WP_150340973.1\|93231_105369_-	DUF1983 domain-containing protein	J9Q713	Salmonella_phage	6.3e-30	59.1
WP_019704527.1\|105385_105997_-\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.1e-76	72.1
WP_004109817.1\|105984_106782_-\|tail	tail protein	J9Q7R4	Salmonella_phage	5.4e-140	85.3
WP_004109820.1\|106774_107473_-\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	1.2e-122	87.4
WP_032423010.1\|107559_107895_-\|tail	tail protein	J9Q6E1	Salmonella_phage	2.6e-51	84.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP044045

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

6509 : 35700

Escherichia_phage(30.0%)

transposase,integrase

attL 15757:15796|attR 31385:31424

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002431311.1\|6509_8051_-\|transposase	IS21-like element ISEc12 family transposase	K4I413	Acidithiobacillus_phage	1.3e-129	46.4
WP_071579738.1\|8631_9180_-	conjugal transfer entry exclusion protein TraS	NA	NA	NA	NA
WP_071579737.1\|9192_12042_-	conjugal transfer mating pair stabilization protein TraG	NA	NA	NA	NA
WP_029498355.1\|12041_13409_-	conjugal transfer protein TraH	NA	NA	NA	NA
WP_023158001.1\|13398_13842_-	F-type conjugal transfer protein TrbF	NA	NA	NA	NA
WP_023158002.1\|13887_14445_-	type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	NA	NA	NA	NA
WP_023158003.1\|14416_14656_-	type-F conjugative transfer system pilin chaperone TraQ	NA	NA	NA	NA
WP_015065535.1\|14666_15419_-	type-F conjugative transfer system pilin assembly protein TraF	NA	NA	NA	NA
WP_100097831.1\|15439_15736_-	hypothetical protein	NA	NA	NA	NA
15757:15796	attL	NA	NA	NA	NA
WP_001067855.1\|15819_16524_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_023277723.1\|16676_16838_+	DUF4158 domain-containing protein	A0A1B0V7H9	Salmonella_phage	4.7e-11	72.7
WP_123196132.1\|16759_17044_-\|transposase	transposase	NA	NA	NA	NA
WP_000845039.1\|17012_18026_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_000237816.1\|18198_18651_+	NAD(+)--rifampin ADP-ribosyltransferase Arr-2	NA	NA	NA	NA
WP_022631163.1\|18731_19985_-	group II intron reverse transcriptase/maturase	H7BVN7	unidentified_phage	3.0e-12	29.7
WP_022631510.1\|20705_21260_+	AAC(6')-Ib family aminoglycoside 6'-N-acetyltransferase	NA	NA	NA	NA
WP_015632396.1\|21670_22450_+	16S rRNA (guanine(1405)-N(7))-methyltransferase RmtF1	NA	NA	NA	NA
WP_071567851.1\|23799_23994_-	hypothetical protein	NA	NA	NA	NA
WP_031281281.1\|24098_24731_-	type B chloramphenicol O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	2.6e-28	40.9
WP_000376623.1\|25513_26014_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001297012.1\|26319_26433_-	hypothetical protein	NA	NA	NA	NA
WP_001389365.1\|26520_27285_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_074466331.1\|27326_27548_+	resolvase	NA	NA	NA	NA
WP_023356273.1\|27627_27867_+	hypothetical protein	NA	NA	NA	NA
WP_022631505.1\|27866_28277_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_015632391.1\|28280_31274_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	1.3e-258	46.6
WP_001393253.1\|33682_34015_+	cupin fold metalloprotein, WbuC family	NA	NA	NA	NA
31385:31424	attR	NA	NA	NA	NA
WP_150340955.1\|34061_34937_-	CTX-M family class A extended-spectrum beta-lactamase	A0A1B0VBP7	Salmonella_phage	8.3e-126	82.4
WP_001067855.1\|34995_35700_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

DBSCAN-SWA_2

72724 : 84816

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004152355.1\|72724_73426_-	DNA methylase	A0A2I7RE86	Vibrio_phage	7.1e-27	36.7
WP_040245863.1\|73862_74093_-	hypothetical protein	NA	NA	NA	NA
WP_004152354.1\|74153_74825_-	mediator of plasmid stability	NA	NA	NA	NA
WP_032414078.1\|74827_75799_-	StbA family protein	A0A222YXF2	Escherichia_phage	1.1e-73	46.8
WP_032663686.1\|76030_76462_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	7.9e-29	52.5
WP_004152351.1\|76461_77733_+	Y-family DNA polymerase	F1C5A5	Cronobacter_phage	3.6e-154	63.7
WP_004152350.1\|78133_79030_+	RepB family plasmid replication initiator protein	Q71TL8	Escherichia_phage	3.3e-69	53.8
WP_004152349.1\|79351_80557_+	ParA family protein	Q1MVJ3	Enterobacteria_phage	7.3e-205	89.0
WP_004152348.1\|80553_81528_+	ParB/RepB/Spo0J family partition protein	Q1MVJ4	Enterobacteria_phage	1.4e-105	62.3
WP_004197751.1\|81699_81885_+	hypothetical protein	NA	NA	NA	NA
WP_004152347.1\|81904_82237_+	hypothetical protein	NA	NA	NA	NA
WP_004227314.1\|82461_82677_+	hypothetical protein	NA	NA	NA	NA
WP_004152345.1\|82788_84816_+	SAM-dependent DNA methyltransferase	A0A220A2U5	Liberibacter_phage	2.1e-26	26.6

DBSCAN-SWA_3

89391 : 126321

Escherichia_phage(35.0%)

transposase,integrase

attL 82586:82601|attR 108645:108660

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
82586:82601	attL	NA	NA	NA	NA
WP_004152342.1\|89391_90660_+\|transposase	ISL3-like element ISKpn25 family transposase	Q6V7R1	Burkholderia_virus	5.2e-60	34.7
WP_004152341.1\|90779_91253_+	YkgJ family cysteine cluster protein	NA	NA	NA	NA
WP_004164986.1\|91417_91612_+	hypothetical protein	NA	NA	NA	NA
WP_004152340.1\|92466_93249_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	4.6e-51	90.2
WP_004152339.1\|93248_93581_-	hypothetical protein	NA	NA	NA	NA
WP_004152338.1\|93587_93944_-	hypothetical protein	NA	NA	NA	NA
WP_004152337.1\|94011_94341_-	hypothetical protein	NA	NA	NA	NA
WP_004152336.1\|94368_94677_-	hypothetical protein	NA	NA	NA	NA
WP_004153649.1\|94722_94929_-	hypothetical protein	NA	NA	NA	NA
WP_016162066.1\|95574_96144_+	hypothetical protein	NA	NA	NA	NA
WP_001568023.1\|96284_97313_+	hypothetical protein	NA	NA	NA	NA
WP_001568022.1\|97457_100262_-	hypothetical protein	NA	NA	NA	NA
WP_014839879.1\|100846_102439_-\|transposase	IS66-like element ISKox1 family transposase	A0A0P0ZEB3	Stx2-converting_phage	1.2e-175	61.6
WP_004189161.1\|102469_102820_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	5.2e-39	63.8
WP_015632382.1\|102816_103257_-	IS66 family insertion sequence hypothetical protein	Q6H9S5	Enterobacteria_phage	2.6e-19	60.3
WP_001531258.1\|103937_104720_-	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	6.1e-136	96.5
WP_032441952.1\|104716_105739_-\|transposase	IS21-like element ISSen3 family transposase	A0A2L1IVA1	Escherichia_phage	8.7e-175	85.6
WP_001568019.1\|106768_108496_-	AAA family ATPase	NA	NA	NA	NA
WP_001568018.1\|108941_109190_+	hypothetical protein	NA	NA	NA	NA
108645:108660	attR	NA	NA	NA	NA
WP_015632385.1\|109186_109759_+	hypothetical protein	NA	NA	NA	NA
WP_001568016.1\|109789_110284_+	hypothetical protein	NA	NA	NA	NA
WP_001568015.1\|110327_110627_+	hypothetical protein	NA	NA	NA	NA
WP_001568014.1\|110516_110825_-	hypothetical protein	NA	NA	NA	NA
WP_022631396.1\|110950_111187_+	hypothetical protein	NA	NA	NA	NA
WP_001567366.1\|111318_111867_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_001567367.1\|111913_112348_+	cell envelope integrity protein TolA	NA	NA	NA	NA
WP_101313273.1\|112576_114108_-\|transposase	IS3-like element ISKpn38 family transposase	A0A1B1P773	Bacillus_phage	9.0e-51	39.8
WP_019725650.1\|114420_114744_-	hypothetical protein	NA	NA	NA	NA
WP_019725651.1\|114816_115812_-	hypothetical protein	A0A2H4UVR4	Bodo_saltans_virus	2.1e-32	34.9
WP_015065500.1\|116108_116759_-	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	1.8e-77	60.6
WP_001695382.1\|116805_117147_-	recombinase family protein	A0A219Y912	Aeromonas_phage	3.4e-19	50.0
WP_001067855.1\|117259_117964_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_124044795.1\|118083_118497_-	chloramphenicol acetyltransferase	A0A1I9LJQ7	Stx_converting_phage	5.7e-77	100.0
WP_069346845.1\|119170_119827_-	hypothetical protein	A0A2L1IV26	Escherichia_phage	1.7e-06	100.0
WP_000493286.1\|120062_120392_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	2.4e-09	44.2
WP_000780222.1\|120372_120654_+	helix-turn-helix transcriptional regulator	A0A2I6TC97	Escherichia_phage	1.3e-08	38.0
WP_001067855.1\|122946_123651_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_040154863.1\|123971_125234_-\|transposase	IS1380-like element ISEc9 family transposase	A0A1B0VDR3	Salmonella_phage	1.3e-39	100.0
WP_077890461.1\|125415_125646_-	DUF4158 domain-containing protein	Q1MVP5	Enterobacteria_phage	3.6e-20	100.0
WP_001067855.1\|125616_126321_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP044043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17723 : 65202

Salmonella_phage(20.0%)

transposase,integrase

attL 47556:47606|attR 70153:70203

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000016982.1\|17723_18530_-\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	5.8e-57	100.0
WP_001159868.1\|18530_18836_-	type II toxin-antitoxin system toxin CcdB	NA	NA	NA	NA
WP_000813634.1\|18837_19056_-	type II toxin-antitoxin system antitoxin CcdA	NA	NA	NA	NA
WP_000151784.1\|19622_20135_+	hypothetical protein	NA	NA	NA	NA
WP_000545987.1\|20168_21302_-	DUF3800 domain-containing protein	NA	NA	NA	NA
WP_000905949.1\|21468_22242_-	hypothetical protein	NA	NA	NA	NA
WP_000528931.1\|22254_22755_-	hypothetical protein	NA	NA	NA	NA
WP_001261278.1\|23019_23250_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001034046.1\|23246_23663_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001542068.1\|23707_27532_-	hypothetical protein	NA	NA	NA	NA
WP_001261286.1\|27882_28113_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_001034044.1\|28109_28526_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_001128474.1\|28600_30166_+	AAA family ATPase	NA	NA	NA	NA
WP_000361402.1\|30150_31173_+	helicase UvrD	NA	NA	NA	NA
WP_000973519.1\|32503_34705_-	ferric aerobactin receptor IutA	NA	NA	NA	NA
WP_000750130.1\|34786_36064_-	NADPH-dependent L-lysine N(6)-monooxygenase	NA	NA	NA	NA
WP_001015721.1\|36060_37803_-	aerobactin synthase IucC	NA	NA	NA	NA
WP_000011908.1\|37802_38750_-	N(6)-hydroxylysine O-acetyltransferase	NA	NA	NA	NA
WP_000602863.1\|38750_40475_-	aerobactin synthase IucA	NA	NA	NA	NA
WP_000095526.1\|40610_41804_+	MFS transporter	NA	NA	NA	NA
WP_001318207.1\|42183_42564_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	1.9e-26	55.0
WP_001332402.1\|42635_42908_-	hypothetical protein	NA	NA	NA	NA
WP_000968139.1\|43806_44664_-	iron/manganese ABC transporter permease subunit SitD	NA	NA	NA	NA
WP_001101723.1\|44660_45518_-	iron/manganese ABC transporter permease subunit SitC	NA	NA	NA	NA
WP_000983710.1\|45514_46342_-	iron/manganese ABC transporter ATP-binding protein SitB	A0A1M7XV31	Cedratvirus	3.6e-14	27.0
WP_000949004.1\|46341_47256_-	iron/manganese ABC transporter substrate-binding protein SitA	NA	NA	NA	NA
WP_001324213.1\|47378_47570_-	hypothetical protein	NA	NA	NA	NA
47556:47606	attL	NA	NA	NA	NA
WP_001138014.1\|48375_51342_-\|transposase	Tn3-like element TnAs1 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	100.0
WP_001161490.1\|51345_51906_-	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.1e-59	100.0
WP_000454193.1\|52081_52432_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_000845039.1\|52634_53648_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_001083725.1\|53792_54290_+	trimethoprim-resistant dihydrofolate reductase DfrA12	A0A0A0PL85	Bacillus_phage	7.5e-23	40.9
WP_001336345.1\|54401_54692_+	DUF1010 domain-containing protein	NA	NA	NA	NA
WP_001206356.1\|54697_55489_+	ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA2	NA	NA	NA	NA
WP_000679427.1\|55652_56000_+	quaternary ammonium compound efflux SMR transporter QacE delta 1	NA	NA	NA	NA
WP_000259031.1\|55993_56833_+	sulfonamide-resistant dihydropteroate synthase Sul1	A0A0B5J4J5	Pandoravirus	5.0e-11	27.2
WP_001993321.1\|56762_56942_-	hypothetical protein	NA	NA	NA	NA
WP_004883563.1\|56960_57233_+	hypothetical protein	NA	NA	NA	NA
WP_000427620.1\|57414_58419_-\|transposase	IS110-like element IS4321 family transposase	NA	NA	NA	NA
WP_000184001.1\|58646_59852_+	chromate efflux transporter	NA	NA	NA	NA
WP_000130000.1\|59862_60168_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_024143553.1\|60183_60366_-	hypothetical protein	NA	NA	NA	NA
WP_001389365.1\|60394_61159_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_001336397.1\|61349_61706_-	hypothetical protein	NA	NA	NA	NA
WP_001137892.1\|61651_62236_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_000004159.1\|62235_63474_-	MFS transporter	NA	NA	NA	NA
WP_000219391.1\|63470_64376_-	Mph(A) family macrolide 2'-phosphotransferase	NA	NA	NA	NA
WP_001067855.1\|64497_65202_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
70153:70203	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044047

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044046

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP044045

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP044043

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection