CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP044054	Burkholderia multivorans strain FDAARGOS_623 chromosome 2, complete sequence	1 crisprs	DEDDh,csa3,cas3,WYL,DinG	0	7
NZ_CP044055	Burkholderia multivorans strain FDAARGOS_623 chromosome 3, complete sequence	2 crisprs	csa3,cas3,DinG	1	141
NZ_CP044053	Burkholderia multivorans strain FDAARGOS_623 chromosome 1, complete sequence	0 crisprs	csa3	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044054_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044054_1

3206065-3206135

Orphan

Consensus_repeat	Method
GCGCCCGTGTATGCGCCGCCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044054_1

>merge|NZ_CP044054|1|3206065-3206135|CRISPRCasFinder
GCGCCCGTGTATGCGCCGCCGCCTCCGCCGCCGGTTGTCTATCAGCCGGCGCCCGTGTATGCACCGCCGCC

>NZ_CP044054|1|1|3206065-3206135|CRISPRCasFinder
GCGCCCGTGTATGCGCCGCCGCC	TCCGCCGCCGGTTGTCTATCAGCCG
GCGCCCGTGTATGCACCGCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044054.1\|WP_053297115.1\|3206445_3208329_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173862
NZ_CP044054.1\|WP_006402610.1\|3218816_3219311_+\|RraA-family-protein	unknown	unknown	gnl\|CDD\|236487
NZ_CP044054.1\|WP_053297119.1\|3214334_3215744_+\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NZ_CP044054.1\|WP_035488290.1\|3201837_3202725_+\|ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|182518
NZ_CP044054.1\|WP_006402937.1\|3205343_3205676_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	unknown	unknown	gnl\|CDD\|131894
NZ_CP044054.1\|WP_053297120.1\|3217767_3218646_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380379
NZ_CP044054.1\|WP_035488288.1\|3213129_3214056_-\|patatin-like-phospholipase-family-protein	unknown	unknown	gnl\|CDD\|224666
NZ_CP044054.1\|WP_053297117.1\|3210608_3212231_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226641
NZ_CP044054.1\|WP_006408218.1\|3202728_3204735_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|131890
NZ_CP044054.1\|WP_053297109.1\|3194892_3196299_+\|tRNA-lysidine(34)-synthetase-TilS	unknown	unknown	gnl\|CDD\|182626
NZ_CP044054.1\|WP_006402938.1\|3204734_3205343_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	unknown	unknown	gnl\|CDD\|131889
NZ_CP044054.1\|WP_006397282.1\|3198231_3199452_+\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP044054.1\|WP_006401893.1\|3192890_3193772_+\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP044054.1\|WP_035488286.1\|3217294_3217759_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP044054.1\|WP_053297116.1\|3209514_3210612_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226690
NZ_CP044054.1\|WP_006409818.1\|3208395_3209439_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226642
NZ_CP044054.1\|WP_006408212.1\|3196641_3197892_+\|aspartate-kinase	unknown	unknown	gnl\|CDD\|235843
NZ_CP044054.1\|WP_006409815.1\|3212358_3213033_+\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|223862
NZ_CP044054.1\|WP_053297114.1\|3200042_3201572_+\|NADH-quinone-oxidoreductase-subunit-M	unknown	unknown	gnl\|CDD\|235622
NZ_CP044054.1\|WP_006408210.1\|3193874_3194846_+\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha	unknown	unknown	gnl\|CDD\|235580

Protein	Function_ID	Function_description	E-value
NZ_CP044054.1\|WP_053297115.1\|3206445_3208329_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173862	cd08497, PBP2_NikA_DppA_OppA_like_14, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP044054.1\|WP_006402610.1\|3218816_3219311_+\|RraA-family-protein	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	9.89225e-92
NZ_CP044054.1\|WP_053297119.1\|3214334_3215744_+\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NZ_CP044054.1\|WP_035488290.1\|3201837_3202725_+\|ubiquinol-oxidase-subunit-II	gnl\|CDD\|182518	PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional.	3.86008e-154
NZ_CP044054.1\|WP_006402937.1\|3205343_3205676_+\|cytochrome-o-ubiquinol-oxidase-subunit-IV	gnl\|CDD\|131894	TIGR02847, Cytochrome_bo3_ubiquinol_oxidase_subunit_4, cytochrome o ubiquinol oxidase subunit IV. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	4.64212e-38
NZ_CP044054.1\|WP_053297120.1\|3217767_3218646_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|380379	cd06124, cupin_NimR-like_N, AraC/XylS family transcriptional regulators similar to NimR, N-terminal cupin domain. This family contains mostly bacterial proteins containing an AraC/XylS family helix-turn-helix (HTH) DNA-binding domain C-terminal to a cupin domain, and may be possible transcriptional regulators. Included in this family is Escherichia coli HTH-type transcriptional regulator NimR (also called YeaM) that negatively regulates expression of the nimT operon and its own expression. Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	7.44616e-31
NZ_CP044054.1\|WP_035488288.1\|3213129_3214056_-\|patatin-like-phospholipase-family-protein	gnl\|CDD\|224666	COG1752, RssA, Predicted esterase of the alpha-beta hydrolase superfamily [General function prediction only].	1.06028e-63
NZ_CP044054.1\|WP_053297117.1\|3210608_3212231_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226641	COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only].	0
NZ_CP044054.1\|WP_006408218.1\|3202728_3204735_+\|cytochrome-o-ubiquinol-oxidase-subunit-I	gnl\|CDD\|131890	TIGR02843, Cytochrome_bo3_ubiquinol_oxidase_subunit_1, cytochrome o ubiquinol oxidase, subunit I. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	0
NZ_CP044054.1\|WP_053297109.1\|3194892_3196299_+\|tRNA-lysidine(34)-synthetase-TilS	gnl\|CDD\|182626	PRK10660, tilS, tRNA(Ile)-lysidine synthetase; Provisional.	3.52459e-71
NZ_CP044054.1\|WP_006402938.1\|3204734_3205343_+\|cytochrome-o-ubiquinol-oxidase-subunit-III	gnl\|CDD\|131889	TIGR02842, Cytochrome_bo3_ubiquinol_oxidase_subunit_3, cytochrome o ubiquinol oxidase, subunit III. Cytochrome o terminal oxidase complex is the component of the aerobic respiratory chain which reacts with oxygen, reducing it to water with the concomitant transport of 4 protons across the membrane. Also known as the cytochrome bo complex, cytochrome o ubiquinol oxidase contains four subunits, two heme b cofactors and a copper atom which is believed to be the oxygen active site. This complex is structurally related to the cytochrome caa3 oxidases which utilize cytochrome c as the reductant and contain heme a cofactors, as well as the intermediate form aa3 oxidases which also react directly with quinones as the reductant. [Energy metabolism, Electron transport].	6.25553e-98
NZ_CP044054.1\|WP_006397282.1\|3198231_3199452_+\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.01353e-89
NZ_CP044054.1\|WP_006401893.1\|3192890_3193772_+\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	2.54477e-54
NZ_CP044054.1\|WP_035488286.1\|3217294_3217759_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	8.85012e-11
NZ_CP044054.1\|WP_053297116.1\|3209514_3210612_+\|ABC-transporter-permease	gnl\|CDD\|226690	COG4239, COG4239, ABC-type uncharacterized transport system, permease component [General function prediction only].	3.88003e-166
NZ_CP044054.1\|WP_006409818.1\|3208395_3209439_+\|ABC-transporter-permease-subunit	gnl\|CDD\|226642	COG4174, COG4174, ABC-type uncharacterized transport system, permease component [General function prediction only].	0
NZ_CP044054.1\|WP_006408212.1\|3196641_3197892_+\|aspartate-kinase	gnl\|CDD\|235843	PRK06635, PRK06635, aspartate kinase; Reviewed.	0
NZ_CP044054.1\|WP_006409815.1\|3212358_3213033_+\|C40-family-peptidase	gnl\|CDD\|223862	COG0791, Spr, Cell wall-associated hydrolases (invasion-associated proteins) [Cell envelope biogenesis, outer membrane].	1.03839e-42
NZ_CP044054.1\|WP_053297114.1\|3200042_3201572_+\|NADH-quinone-oxidoreductase-subunit-M	gnl\|CDD\|235622	PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed.	0
NZ_CP044054.1\|WP_006408210.1\|3193874_3194846_+\|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha	gnl\|CDD\|235580	PRK05724, PRK05724, acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated.	0

>NZ_CP044054.1|WP_006402937.1|3205343_3205676_+|cytochrome-o-ubiquinol-oxidase-subunit-IV
MAHSHSSQLEEGHGSVGSYVAGFILSVLLTAASFGLVMGGVLSPHASLVALAVLAFVQIVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMSR
>NZ_CP044054.1|WP_006402938.1|3204734_3205343_+|cytochrome-o-ubiquinol-oxidase-subunit-III
MLQKTLSATLLEHDDHPPSHSVFGFWLYLMTDCVIFAALFATFAVLGNQYAGGPTAKDLFDIPGVAIETAALLLSSITYGFAMLAAYKQRRGALLGWLAVTFVLGAAFLAMELREFSHLIAEGAGPQRSAFLSAFFTLVGTHGLHVTAGLLWMIVLAGQIVARGGDLTDRDLRRLTCLSLFWHFLDIVWICVFTFVYLASVI
>NZ_CP044054.1|WP_006408218.1|3202728_3204735_+|cytochrome-o-ubiquinol-oxidase-subunit-I
MFGKLTLSAIPFDQPIIMGAGAFMGLVVLGILAALTITGRWKWLWTEWLTTVDHKKLGVMYIIVALIMLLRGFADAIMMRMQLALAYNAPGYLPPHHYDQIFTAHGVIMIFFMAMVFMVGLMNLIVPLQIGARDVAFPFINSLSFWMTAVSAILINISLVIGEFAQTGWLAYPPLSELQFSPGVGVDYYLWALQISGVGTLLTGVNFFVTIIKMRAPGMTLMKMPVFTWTALCTNVLIMASFPILTATLALLGLDRYLGMHFFTNEAGGNAMLYLNLIWAWGHPEVYILILPAFGIFSEVIATFSKKPLFGYKTMVYATCAIMVLSFLVWLHHFFTMGSGANVNAFFGIMTMIIAIPTGVKVFNWLFTMYRGRIRFTTPVLWTIGFMVTFTLGGMTGVMMAIPGADFVLHNSLFLIAHFHNVIIGGVLFGYLAGFNYWFPKAFGFKLNETLGKAAFWFWQVGFYVAFVPLYVLGFMGMTRRLNHYDNPAWHPWLLVAAFGAVLIAIGIACQLLQLVVSIRNRNLPAYRDTTGDPWGGRTLEWATTSPPAEYNFAVIPQVRTLDAYADMKARGDTRANPAAIRDIHMPSNTCAGLVIGVFSLVLGFALVWHIWWLAIAGLVGIVATLVIYSSRDNDGYYIPASTVRKTEDKQSSKRAIARVDDVELEAN
>NZ_CP044054.1|WP_035488290.1|3201837_3202725_+|ubiquinol-oxidase-subunit-II
MKRRASRGWATLMSIGAVLSLSGCNLDVLNPKGSVGAAEKSLIATSTWAMLIVVVPVILLTLWFAWRYRASNRNATYAPDWSHSTAIEVVIWTVPTLIILFLGVLTWKTTHELDPYKPLESSVKPIDVEVVALDWKWLFIYPELGIASVNQLAIPVGTPVNFRITSDSVMNSFFIPQLGGQVYAMAGMQTRLHLIADEPGNYAGTSANFSGRGFSDMKFRTLAEPREQFDAWVQKVKASPDRLDATVYGQVAQPSEKAPVRYFSSVDPRLFHNIIAKYNDGHVLDLKDAACGTKG
>NZ_CP044054.1|WP_053297114.1|3200042_3201572_+|NADH-quinone-oxidoreductase-subunit-M
MHDFPFLSLAIWAPILFGACLLRAGSDQHLQRTRLIALIGAIAGLAAVAPIVAGFDPHSAAMQFVENRNGLSAFGAGWRTGVDGASLWLVVLTAFTTLVVVVATWQAVTVRVAQYYASFLILSGLMIGVFVAQDGLLFFIFFEATLIPLYLLIGTWGREHRVYAAVKFFFISFAGSLLLLMAMLYLYAKSHTFDMAAWRTLQLGFAPQLLVFLGFFAAFAVKVPMWPVHTWLRDVYTDGPTGAALMLAMLKLGGYGFLRFALPITPDASHFFAPAVIALSLFAIVYASLLALAQTDFGKLLAYSTVAHMGIVTLGLFLFNRIGVEGAIVQLVSYGFVAGAMLLCASVLVDRTKQREMTAYGGVASAMPRFAMFAVLFAMANVGLPGTSGFVGEFMVIMGAIRVNFWIGAAAALTLIFSASYTLWMLKRVVWGRAPSASIAKLVDLSGREIAMFASLALIVLAVGIYPKPFTDAIDPTVGRLLADASRSKLPAGDDTAPAQPAYMAAAHD
>NZ_CP044054.1|WP_006397282.1|3198231_3199452_+|ISL3-family-transposase
MLDRKALEALGCWTGYRLERVEWPEGEGRTLSLYLKPVGKIMYCEQCGARCQRIHETTVRRVRDLPLFEYRVVLHVPRRRVWCERCGGPRLEKLAWLGRYQRVTERFAKACEKLLQAASVQAVAAFYDLGWHTVKSIDKMRLRARVSEPDWSTIRYLAMDEFALHKGHRYATVVVDPISRQVLWIGPGRSRETARAFFEQLPEGAAKRIEAVAIDMTTAYELEIREQCPQAEIVFDLYHVVAKYGREVIDRVRVDQANQLRHDKPARKVLKSSRWLLLRNRHNLKPDQAVHLKELLAANQALLCVYVLRDELKRLWFYRKPAWAQKAWEQWFEQAQQSGIAALQKFAERLQGYWHGIVTRCRHPLNTSIVEGINNTIKVIKRRAYGYRDDEYFFLKIRAAFPGNPR
>NZ_CP044054.1|WP_006408212.1|3196641_3197892_+|aspartate-kinase
MALIVHKYGGTSMGSVERIKNVAKRVAKWHQAGHQMVVVPSAMSGETNRLLGLAKEISSQPSPRELDMIASTGEQVSVGLLSIALQEIGVEAVSYAGWQVPIKTDSAFTKARIHSIDDERVKADLNAGKVVIITGFQGVDPDGHITTLGRGGSDTSAVAVAAALGAEECLIYTDVDGVYTTDPRVVEEARRLDRVTFEEMLEMASLGSKVLQIRSVEFAGKYQVKTRVLSSLTDPLIALDEEMRSGTLITFEEDETMEKAVISGIAFQRDEARIAVMGVPDKPGIAYQILGPVADANIDVDMIIQNQSVQGKTDFTFTVGRGDYQKAMDILTNQVKGHVNAEQVQGDPKVSKVSVVGVGMRSHVGVASKMFRTLSEEGINIQMISTSEIKISVLIDEKYMELAVRALHKAFELEQA
>NZ_CP044054.1|WP_053297109.1|3194892_3196299_+|tRNA-lysidine(34)-synthetase-TilS
MIPPNQYSADRVVLDAVGVALSGVPGGARIAIAYSGGLDSSVLLDAAVRVAGASRCVALHVHHGLSANADAWAAHAREQAARLGVAFEAMHVDVPRDSGVGIEASARERRYAALDAMCARHGAAALWLAQHADDQAETVLLQLLRGAGIAGLAAMAPRYRPDDASVERVRPLLRLLRAQLERYAAEHALSWIDDESNADTRYARNALRIDVLPALAVHFPGFRDALGRAAQHAAAAQRLLDDLAELDFVAAARDDGRALSRDALIAFDDVRGANLLRYWMRRLGLPGASAARLADMMRQLRDAHDAHALRVDHAGQCLRLYRDTVYWEAGDSAAPRDDGTGTPHADASLAWDGQEIWHLPGWRGTFVFARADAGSDDALPETLLRSAPLIARARAGGERMRMWPDGPSRTLKNLFQERGVPAWQRDVPLLFAGDRLIYVPRLGVNRDGVPQGGHAWRRIEWRPDLLIA
>NZ_CP044054.1|WP_006408210.1|3193874_3194846_+|acetyl-CoA-carboxylase-carboxyltransferase-subunit-alpha
MKTTFLDFEQPIAELEAKIEELRFVQDDSAVDISEEIERLSKKSQQLTKDLYANLTPWQVSQIARHPQRPYTLDYVAELFTDFHELHGDRAFADDLSIVGGLARFGGHPCMVIGHQKGRDTKERAARNFGMPRPEGYRKAERLMRLAEKFGLPIFTFVDTPGAYPGIGAEERGQSEAIGRNLYVMAELKTPIITTVIGEGGSGGALAIAVADTVMMLQFSTYSVISPEGCASILWKSAAKAPEAAEALGLTAHRLKALGLIDKIVNEPLGGAHRDPKGMAALLRRALADSLRQFQGMSIDALRERRFERLMAYGKFKETTPGA
>NZ_CP044054.1|WP_006401893.1|3192890_3193772_+|DNA-3-methyladenine-glycosylase-2-family-protein
MATARKAPVRRATPVAARPAARRAPAAKTDAARAVPNGALNGHVQPAAKHARAKGAEPAQPDHAMQAVDATRKARAADAAGDGEDDVVVRPAYWDKACADLVKRDRILKKLIPKFGPAHLVKRGDPFVTLARSVVGQQISVPSAQSLWARIQAACPKLAPQPVIRLGADKLIACGLSKRKTEYILDLAQHFVSGALHVDKWTSMEDEAVIAELTQIRGISRWTAEMFLIFNLSRPDVLPLDDPGLIRAISVNYFSGEPVTRSEAREVAANWEPWRTVATWYMWRSLDALDAGA
>NZ_CP044054.1|WP_053297115.1|3206445_3208329_+|ABC-transporter-substrate-binding-protein
MTMGSRWTAATRVRGRAAQALRTAGAAAAAFALHAALAATAAHAAYAIAQYGEPKYPPGFRHFDYVNPNAPKGGTLVLANPNRLTSFDKFNPYTLRGNVAPGIDLLFESLATGSLDEPASAYGLLADDIAVAPDRRSVTFHLNPRARFSNGDPVTADDVKYSFDTLKSKQAAPQFAAYFAEISRAVVVDPATVRFEFRSTNRELPLIAGGVPIFSHKWGLRADGSRIPFDQLAFEQPIGSGPYLIDHYDNGRTITYRRNPAYWGADLPVRVGTNNFDRIVYKLYGDGIARLEAFKAGEYDVLVEYIARNWVRRDVGKRFDSGELVKREFRQHNGAGMQGFFMNLRRPLFRDVRVRKALDLAFDFEWLNRQLFFGGYTRLDSYFADTDLQATGTPGEGELKLLEPLRAQLDPAVFGPMVTQPSTNPPGSLRANLLKARALLAEAGWTYRDGALRNANGDPFTFEILDDAGSAFAPVVTAYQRNLAKLGIDVRFRTADFALLQKRLDAFDYDMTTVRYPGVQVPGTEQLARFGSQFADTPGSDNLIGLKSPAVDTLLRALTAAQTREQLLDATHALDRVLMHGYYAIPQWYSTTHRIAYKRTLAYPQTLPLYYSAESWVVSTWWAKPDH
>NZ_CP044054.1|WP_006409818.1|3208395_3209439_+|ABC-transporter-permease-subunit
MWSYILKRLLLMIPTLVGVLTLTFVVIQFVPGGPVEQAVQELRKGATEQGATPFGMRAHTGVDPQQIAQLKALYGFDKPPLERYWLMLERFARFDLGDSYFRHQSVWSLIVQKLPVSISIGLWTFFLTYLISVPLGIAKAVRNGSPFDVATSLVVLVGYAIPGFVLGVLLLVLFGGGSFWQLFPLRGLTSDNFAQLSVAGKVLDYLWHIALPITASVVGSFAVVTMLTKNAFLDEIRRQYVLTARAKGLGERTVLWKHVFRNAMLPLIVGFPAAFIGAFFTGSLLIETLFSLDGLGLLSYESVVRRDYPVVLGTLYLFTLIGLATKLISDLCYVWVDPRIQFENLER
>NZ_CP044054.1|WP_053297116.1|3209514_3210612_+|ABC-transporter-permease
MSRVAAPSRVEAARAHVSPSPARRVWQRFRQQKLGYWSFVIFVVAFAASIAAPLWSNDKPLVVRYDGHYYFPLFHAYPETTFGGDFPTPADYLDPDVRKRLEAPGNFVVYPPNRYYYDTLNYFSKEPNPAPPSRENWLGTDAQGRDLFARLVYGFRVSVEFGLILTAIGTLLGIAAGAVQGFFGGRIDIVGQRLIEIWSSLPELYLLIIFASIFEPSFLLLIVLLSLFGWIGLADYVRAEFLRNRTQDYVRAARAMGLTNWQIIWRHVLPNSLTPVITFLPFRMSGAILALTSLDFLGLGVPPPTPSLGELLAQGKGNLDAWWISLSTFGVLVATLLLLTFMGDALRNALDTRIADSMRAAGGQR
>NZ_CP044054.1|WP_053297117.1|3210608_3212231_+|ABC-transporter-ATP-binding-protein
MNGATVSTHDEPLLALQHLNVRFGDTVAVDDVTFAIGRGERVALVGESGSGKSVTALSILRLLRDADVRGTIRFAGQDLGAKSEREMRALRGADIAMIFQEPMTALNPLYTIGAQIAETIVLHDGVSAAEARKRAIALLARTGIAEPDRRVDSYAHQLSGGQRQRAMIAMALACRPRLLLADEPTTALDVTIRAQIVDLLLELQREEAEKRGMAILLITHDLNLVRRFAERVAVMERGRLVESGPVERIFAEPQHPYTQRLLNSRPQRAVAPVMPIAPVLLDARHVSVQFARKRPGLAGWFGTTPVTAVSDVSVSVRQGETLGIVGESGSGKSTLAMALLGLQKTVHGDIEFQGRALSTYRGREQTALRANMQVVFQDPFSSLSPRHTIERIVGEGLELHRPDLTPDARRAKSVAVLREVGLDRTVLHRYPHEFSGGQRQRIAIARALVLEPRVLILDEPTSALDVSIQQQVLKLLANLQQKYNLGYVFISHDLEVIGAMAHRVAVMQGGMIVESGDVEQIFARPSHPYTQKLLKAVWKA
>NZ_CP044054.1|WP_006409815.1|3212358_3213033_+|C40-family-peptidase
MQHRSLTQACARTLAGLFIGALFAAAPGAFADEVSSFNQNVTNSTQIGSGSSLQQPNAQPSSGGAKSFLSGMAGKAGDVVVSALNMIGVRYRWGGNSPDSGLDCSGFVRYVFQDTLGMSLPRRAEEMSRVGEKVSMSNLKPGDLVFFNTMRRTFSHVGIYIGDNKFVHSPSTGSTVRVDDLDSSYWEKRFTGARRIETQFPMKADDLRQRVRATIGNDADNANN
>NZ_CP044054.1|WP_035488288.1|3213129_3214056_-|patatin-like-phospholipase-family-protein
MSSPRLSRRQFTIACASASLAACTSFGGKSRSDSASSATQPHDKPVKIGIALGGGAARGFSHIGVLKALEARGIAIDLVAGTSAGSVVGALYASGMNGLQINKIALDMDQASISDWALPFRSRGLLQGVALQNFLNKALNNRPIEKMPKPLGIVATDLQSGQPILFQQGNTGLAVRASCSVPSVFEPVKIGNREYVDGGLVSPVPASFARRMGANFVIAVDISARPDGAATNNPIEMLLQTFTIMGQTIKTYELDKYADVVIRPNLAAMGGSDFNQRNAAILAGEEAVARIMPELQRKLAAARGVPVA
>NZ_CP044054.1|WP_053297119.1|3214334_3215744_+|glutamate--tRNA-ligase
MTRPVRTRFAPSPTGFIHLGNIRSALYPWAFARKMKGTFVLRIEDTDVERSSKEAVDAILEGMEWLGLDFDEGPIYQMQRMDRYREVLAQMLEKGLAYPCYMSAEELDALRERQRAAGLKPRYDGTWRPEPGKVLPEPPPGVKPVLRFRNPLTGTVVWDDAVKGRVEISNEELDDLVIARPDGTPIYNFCVVVDDMDMGITHVIRGDDHVNNTPRQINILRALGGEPPVYAHLPTVLNEQGEKMSKRHGAMSVMAYRDAGYLPEAVVNYLARLGWSHGDAEIFSREQFVEWFDLEHLGKSPAQYDHNKLNWLNAHYIKEADNARLAALAKPFLAALAIDDAALAAGPALEAVIALMKDRATTVKEIAEGAAMFYRVPAPDADALAQHVTDAVRPALADLAAALKAANWTKDAISAALKATLAAHKLKMPQLAMPVRLLVAGTTHTPSIDAVLALFDRDVVVSRIEAALA
>NZ_CP044054.1|WP_035488286.1|3217294_3217759_+|GNAT-family-N-acetyltransferase
MLDPTDLRLLYQLRPAEPGDFPFAEALTHGNMGGYYKRHGLVWRSDLFYASWRESENFILEADGQRIGVLRVTEEGDSLHIRDVQIAAGHRGRGAGTYLLDMSHRWARARGLHELQLRVFVDNPAARLYRRMGYHVTGPRLAQLGSIRHMVRPV
>NZ_CP044054.1|WP_053297120.1|3217767_3218646_-|helix-turn-helix-transcriptional-regulator
MHPIVPADASNPYDVIDIPPEFAPTRAHPMRVRARHVDAGSRIPLHTHAWAQLAYASRGVLRVATTGTTWMVPPSRAIWVPPHVTHEVAIVEEAYLRTLYIDESIVPDGLAACRVVEVTGLLRELIVALDARDLSDGRERLLCGLVLDELSRAEPLPLAVPMPDEKRLRTLCESVLAQPANAESLEHWASEVGASTRTISRLFKQELGVSFSQWRQQALLARAIPLLNQGRPLSHIARELGYQSQSAFSAMFRRAFGESPRAFMLRGYEHRGTERVAPSDDMRDDDAHDTVR
>NZ_CP044054.1|WP_006402610.1|3218816_3219311_+|RraA-family-protein
MTFATTDLCDAHEDKLAAGTLRVLQPALRPYGGAARFAGPAATLKVFEDNTLVRAALEQDGGGRVLVVDGGASLRCALVGGNLGALAEKNGWAGIVVHGCVRDAAELRECKVGVLALATHPRKSDKRGAGERDVPVTVLGTRIAPGEWIYADDDGVLVSATSLT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

497061 : 559333

Ralstonia_phage(23.08%)

integrase,transposase,capsid,plate

attL 496913:496967|attR 509175:509229

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
496913:496967	attL	NA	NA	NA	NA
WP_053297393.1\|497061_498081_+\|integrase	site-specific integrase	A0A0A1I5U0	Burkholderia_phage	3.9e-50	38.0
WP_053297394.1\|498190_499354_+\|integrase	site-specific integrase	A0A1L7DQ84	Ralstonia_phage	6.6e-70	44.0
WP_053297395.1\|500912_503198_-	hypothetical protein	A0A1L7DQB4	Ralstonia_phage	8.6e-90	32.5
WP_053297396.1\|503499_503718_-	hypothetical protein	NA	NA	NA	NA
WP_140401763.1\|503780_503960_-	hypothetical protein	NA	NA	NA	NA
WP_053297397.1\|504325_505138_-	hypothetical protein	NA	NA	NA	NA
WP_053297398.1\|505339_505897_-	hypothetical protein	NA	NA	NA	NA
WP_105767083.1\|506009_506624_-	recombinase family protein	NA	NA	NA	NA
WP_053297411.1\|507661_508447_+	hypothetical protein	NA	NA	NA	NA
WP_053297399.1\|509416_510247_-	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
509175:509229	attR	NA	NA	NA	NA
WP_053297400.1\|510743_511658_+	aldose epimerase	NA	NA	NA	NA
WP_006400996.1\|511790_512483_+	peptidoglycan DD-metalloendopeptidase family protein	A0A1W6JQH9	Corynebacterium_phage	2.3e-06	37.2
WP_053297401.1\|512849_514469_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	4.7e-66	34.5
WP_006405071.1\|514534_514858_+	DUF2288 domain-containing protein	NA	NA	NA	NA
WP_053297402.1\|514868_516230_+	MATE family efflux transporter	NA	NA	NA	NA
WP_006401003.1\|516929_517736_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_106918434.1\|517735_517855_-	hypothetical protein	NA	NA	NA	NA
WP_006401004.1\|517885_518347_-	phosphohistidine phosphatase	NA	NA	NA	NA
WP_150331747.1\|520111_521371_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331746.1\|521755_522856_+	Fic family protein	NA	NA	NA	NA
WP_150331745.1\|522865_528139_+	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	4.3e-60	22.5
WP_150331744.1\|528145_530935_+	DEAD/DEAH box helicase family protein	A0A1B1IUI1	uncultured_Mediterranean_phage	2.6e-40	28.1
WP_150331879.1\|536231_537875_+	chromosome segregation protein SMC	NA	NA	NA	NA
WP_150331743.1\|537924_538692_+	HNH endonuclease	NA	NA	NA	NA
WP_150331742.1\|539300_539510_-	hypothetical protein	NA	NA	NA	NA
WP_006404120.1\|539552_541076_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_006404121.1\|541088_541856_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_150331741.1\|541865_542063_-	hypothetical protein	NA	NA	NA	NA
WP_150331740.1\|542451_542898_-	hypothetical protein	NA	NA	NA	NA
WP_150331739.1\|543040_544048_-	hypothetical protein	NA	NA	NA	NA
WP_150331738.1\|544059_544962_-	hypothetical protein	NA	NA	NA	NA
WP_150331737.1\|545106_545904_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_150331736.1\|546038_547241_-	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_150331735.1\|547225_548518_-	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_150331734.1\|548529_550638_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.9e-63	30.0
WP_150331733.1\|550775_552659_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_012492775.1\|552665_553238_-	hypothetical protein	NA	NA	NA	NA
WP_053299177.1\|553259_553640_-	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_150331732.1\|553678_554782_-	hypothetical protein	NA	NA	NA	NA
WP_077181108.1\|555534_555792_+	hypothetical protein	NA	NA	NA	NA
WP_105775161.1\|555909_556878_+	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	9.7e-59	42.9
WP_105775162.1\|556874_557075_+	hypothetical protein	NA	NA	NA	NA
WP_105775163.1\|557145_558141_+	YqaJ viral recombinase family protein	A6XMH8	Bacillus_virus	3.0e-55	39.8
WP_150331731.1\|558152_558368_+	hypothetical protein	NA	NA	NA	NA
WP_150331730.1\|558418_559333_+\|capsid	phage capsid protein	NA	NA	NA	NA

DBSCAN-SWA_2

850251 : 858510

Yaba_monkey_tumor_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400714.1\|850251_851160_+	alpha/beta hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	6.2e-15	26.8
WP_006400715.1\|851175_852099_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	2.3e-41	34.0
WP_081000594.1\|852142_853486_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_006400717.1\|853567_854470_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	1.8e-51	39.2
WP_006400718.1\|854678_855035_-	competence protein ComE	NA	NA	NA	NA
WP_006400719.1\|855110_856103_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	6.9e-28	30.9
WP_050804584.1\|856151_857117_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.2e-16	27.5
WP_006400721.1\|857109_858510_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.3e-77	37.7

DBSCAN-SWA_3

1130568 : 1139538

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035949390.1\|1130568_1132107_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	6.1e-23	30.7
WP_006401596.1\|1132142_1132682_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_006401597.1\|1132678_1133365_+	deoxynucleoside kinase	S5MMC6	Bacillus_phage	3.3e-13	28.9
WP_053297603.1\|1133411_1134227_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	9.7e-36	32.9
WP_053297604.1\|1134330_1136193_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.2e-60	38.5
WP_053297605.1\|1136196_1137327_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.8e-25	39.0
WP_006401601.1\|1137591_1139538_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	51.2

DBSCAN-SWA_4

1400926 : 1458682

Pseudomonas_phage(22.22%)

tRNA,transposase,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406930.1\|1400926_1402225_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006400499.1\|1402307_1403390_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	8.7e-08	44.8
WP_012214221.1\|1403400_1404243_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006400503.1\|1404310_1404622_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_006400504.1\|1404635_1405232_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_006406932.1\|1405450_1406242_+	dioxygenase	NA	NA	NA	NA
WP_006400506.1\|1406415_1408014_-	APC family permease	NA	NA	NA	NA
WP_006400508.1\|1408436_1408640_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_035948474.1\|1408751_1410002_-	Hsp70 family protein	NA	NA	NA	NA
WP_006400510.1\|1410158_1410764_-	nitroreductase family protein	NA	NA	NA	NA
WP_006400511.1\|1410909_1412193_-	MFS transporter	NA	NA	NA	NA
WP_006400513.1\|1412405_1413026_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_053297720.1\|1413081_1413654_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_006406939.1\|1413704_1414595_-	methyltransferase	NA	NA	NA	NA
WP_053297723.1\|1414684_1415818_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_053297725.1\|1415927_1416425_-	Water stress and hypersensitive response domain-containing protein	NA	NA	NA	NA
WP_080746586.1\|1416706_1416940_+	hypothetical protein	NA	NA	NA	NA
WP_006406942.1\|1417068_1419240_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	1.1e-49	26.4
WP_053297727.1\|1419366_1420395_-	transporter	NA	NA	NA	NA
WP_053297729.1\|1420606_1421593_-	hypothetical protein	NA	NA	NA	NA
WP_006406946.1\|1421714_1422560_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_053297731.1\|1422858_1426788_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_006400525.1\|1426784_1427774_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_053297732.1\|1427778_1428738_+	OmpA family protein	NA	NA	NA	NA
WP_006406949.1\|1428813_1429035_-	hypothetical protein	NA	NA	NA	NA
WP_053297734.1\|1429066_1429600_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_053297735.1\|1429739_1432022_-	hypothetical protein	NA	NA	NA	NA
WP_053297736.1\|1432014_1432851_-	DUF3304 domain-containing protein	NA	NA	NA	NA
WP_053297737.1\|1433040_1434081_-	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_053297738.1\|1434080_1436642_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.8e-57	26.9
WP_006409504.1\|1436710_1437832_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_053297739.1\|1437870_1440540_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	2.2e-89	31.7
WP_006406957.1\|1440584_1441685_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_035946276.1\|1441648_1443484_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006406959.1\|1443562_1444048_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006400546.1\|1444110_1444614_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006400547.1\|1444685_1446176_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006406960.1\|1446191_1446707_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006406961.1\|1446742_1447375_-	hypothetical protein	NA	NA	NA	NA
WP_012214251.1\|1447750_1448362_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006409507.1\|1448464_1449811_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_006406963.1\|1449807_1450590_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_035489411.1\|1450675_1450993_-	hypothetical protein	NA	NA	NA	NA
WP_150331676.1\|1451623_1452103_-	hypothetical protein	NA	NA	NA	NA
WP_081336710.1\|1452305_1452647_-	hypothetical protein	NA	NA	NA	NA
WP_006404121.1\|1453356_1454124_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_006404120.1\|1454136_1455660_-\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_081000539.1\|1456563_1456728_-	RHS repeat-associated core domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	1.4e-15	72.7
WP_035489409.1\|1456720_1457146_-	SMI1/KNR4 family protein	NA	NA	NA	NA
WP_150331618.1\|1457448_1458682_+\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5

DBSCAN-SWA_5

1880948 : 1978455

106

Burkholderia_phage(78.95%)

tRNA,terminase,plate,capsid,tail,portal,integrase,protease,head,holin

attL 1908403:1908450|attR 1946701:1946748

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297846.1\|1880948_1882343_+\|tRNA	tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE	NA	NA	NA	NA
WP_006407251.1\|1882783_1883032_-	DUF2795 domain-containing protein	NA	NA	NA	NA
WP_006411849.1\|1883432_1883975_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_088923780.1\|1884431_1884776_+	hypothetical protein	NA	NA	NA	NA
WP_053297845.1\|1884967_1885522_+	YaeQ family protein	NA	NA	NA	NA
WP_006407247.1\|1885546_1885960_-	lactoylglutathione lyase	NA	NA	NA	NA
WP_081000632.1\|1886083_1886401_-	hypothetical protein	NA	NA	NA	NA
WP_053297844.1\|1886338_1887436_+	bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada	A0A167R6J9	Powai_lake_megavirus	5.5e-18	42.7
WP_150331873.1\|1887453_1888404_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_006407243.1\|1888485_1888701_+	hypothetical protein	NA	NA	NA	NA
WP_081000631.1\|1888697_1890299_+	glutamate--cysteine ligase	NA	NA	NA	NA
WP_081000630.1\|1890262_1890454_-	hypothetical protein	NA	NA	NA	NA
WP_053297841.1\|1890383_1890695_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_150331648.1\|1890698_1890965_+	hypothetical protein	NA	NA	NA	NA
WP_053297840.1\|1891057_1892704_+	L-lactate permease	NA	NA	NA	NA
WP_006407237.1\|1892840_1893566_+	phosphonate utilization associated transcriptional regulator	NA	NA	NA	NA
WP_006407236.1\|1893684_1895073_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_053297839.1\|1895142_1896273_-	2-aminoethylphosphonate--pyruvate transaminase	NA	NA	NA	NA
WP_053297838.1\|1896319_1898047_-	putative 2-aminoethylphosphonate ABC transporter permease subunit	NA	NA	NA	NA
WP_006407233.1\|1898043_1899135_-	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-27	34.3
WP_053297837.1\|1899226_1900282_-	putative 2-aminoethylphosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053297836.1\|1900491_1901730_+	phosphonoacetate hydrolase	NA	NA	NA	NA
WP_045593739.1\|1901754_1903209_+	phosphonoacetaldehyde dehydrogenase	NA	NA	NA	NA
WP_006407229.1\|1903275_1904184_-	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_006401782.1\|1904598_1905423_-	glycosyltransferase	NA	NA	NA	NA
WP_053298915.1\|1905409_1906480_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_053298912.1\|1907060_1908254_+	heptosyltransferase	NA	NA	NA	NA
1908403:1908450	attL	NA	NA	NA	NA
WP_150331647.1\|1908568_1909648_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4J8E5	uncultured_Caudovirales_phage	3.1e-29	30.7
WP_150331872.1\|1909648_1909915_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_150331871.1\|1910085_1910634_-\|plate	Baseplate J family protein	A0A1S5NNJ0	Burkholderia_phage	6.1e-58	70.3
WP_150331646.1\|1910648_1913441_-	hypothetical protein	E5E3N5	Burkholderia_phage	0.0e+00	95.8
WP_150331645.1\|1913443_1913707_-	hypothetical protein	E5E3N6	Burkholderia_phage	1.3e-34	91.7
WP_053296749.1\|1913703_1914063_-	hypothetical protein	E5E3N7	Burkholderia_phage	1.3e-40	73.9
WP_053296750.1\|1914067_1914262_-	hypothetical protein	K4NXL1	Burkholderia_phage	1.8e-20	79.4
WP_053296751.1\|1914305_1914509_-	hypothetical protein	E5E3N9	Burkholderia_phage	7.0e-28	98.5
WP_105752298.1\|1914513_1914708_-	hypothetical protein	E5E3P0	Burkholderia_phage	1.3e-26	92.2
WP_006401793.1\|1914798_1915047_-	ogr/Delta-like zinc finger family protein	E5E3P1	Burkholderia_phage	1.0e-36	89.0
WP_006416695.1\|1915056_1915335_-	hypothetical protein	E5E3P2	Burkholderia_phage	2.4e-47	100.0
WP_088925274.1\|1915338_1915533_-	hypothetical protein	E5E3P3	Burkholderia_phage	8.2e-26	95.3
WP_150331644.1\|1915658_1916120_+	helix-turn-helix domain-containing protein	K4NXA8	Burkholderia_phage	6.0e-59	80.4
WP_150331643.1\|1916175_1916922_+	alpha/beta hydrolase	E5E3P5	Burkholderia_phage	1.1e-73	60.1
WP_150331642.1\|1916974_1917427_+	hypothetical protein	NA	NA	NA	NA
WP_105848052.1\|1917512_1918658_-	phage late control D family protein	E5E3P7	Burkholderia_phage	3.4e-196	98.9
WP_150331641.1\|1918654_1919083_-\|tail	phage tail protein	E5E3P8	Burkholderia_phage	6.1e-74	98.6
WP_150331640.1\|1919096_1922348_-	hypothetical protein	A0A1S5NRM8	Burkholderia_phage	0.0e+00	80.6
WP_150331639.1\|1922344_1922467_-\|tail	GpE family phage tail protein	E5E3Q0	Burkholderia_phage	3.8e-13	90.0
WP_150331638.1\|1922463_1922775_-\|tail	phage tail assembly protein	E5E3Q1	Burkholderia_phage	1.5e-45	97.1
WP_150331637.1\|1922807_1923317_-\|tail	phage major tail tube protein	E5E3Q2	Burkholderia_phage	2.7e-92	98.8
WP_105848056.1\|1923346_1924519_-\|tail	phage tail sheath protein	E5E3Q3	Burkholderia_phage	1.4e-224	98.7
WP_105752289.1\|1924630_1925380_-	site-specific DNA-methyltransferase	E5E3Q4	Burkholderia_phage	9.6e-139	96.0
WP_081000537.1\|1925357_1925540_-	Com family DNA-binding transcriptional regulator	E5E3Q5	Burkholderia_phage	3.2e-24	91.7
WP_081000536.1\|1925911_1926097_+	hypothetical protein	NA	NA	NA	NA
WP_088923694.1\|1926140_1926977_-\|tail	phage tail protein	E5E3Q6	Burkholderia_phage	4.5e-145	89.3
WP_088923693.1\|1926986_1928597_-\|tail	phage tail protein	E5E3Q7	Burkholderia_phage	2.8e-252	95.0
WP_088923692.1\|1928599_1929154_-\|tail	phage tail protein I	E5E3Q8	Burkholderia_phage	3.4e-93	92.4
WP_043206375.1\|1929146_1930052_-\|plate	baseplate assembly protein	A0A1S5NR72	Burkholderia_phage	3.4e-154	93.4
WP_043206376.1\|1930048_1930426_-	hypothetical protein	E5E3R0	Burkholderia_phage	2.3e-64	98.4
WP_105766424.1\|1930422_1931055_-\|plate	phage baseplate assembly protein V	E5E3R1	Burkholderia_phage	2.3e-117	99.0
WP_043206378.1\|1931472_1931922_-	phage virion morphogenesis protein	E5E3R3	Burkholderia_phage	2.1e-64	89.9
WP_043206379.1\|1931921_1932332_-\|tail	phage tail protein	E5E3R4	Burkholderia_phage	1.2e-71	96.3
WP_150331636.1\|1932328_1932820_-	hypothetical protein	E5E3R5	Burkholderia_phage	7.3e-63	93.9
WP_150331635.1\|1932816_1933617_-	DUF3380 domain-containing protein	E5E3R7	Burkholderia_phage	8.4e-133	91.0
WP_048805728.1\|1933609_1933930_-\|holin	phage holin family protein	E5E3R8	Burkholderia_phage	2.3e-49	99.1
WP_048805729.1\|1933929_1934304_-	membrane protein	E5E3R9	Burkholderia_phage	6.0e-57	98.4
WP_048805730.1\|1934306_1934519_-\|tail	tail protein	E5E3S0	Burkholderia_phage	5.2e-34	98.6
WP_065495429.1\|1934518_1934761_-	hypothetical protein	E5E3S1	Burkholderia_phage	3.3e-32	93.8
WP_048805732.1\|1934760_1935237_-\|head	head completion/stabilization protein	E5E3S2	Burkholderia_phage	3.4e-81	97.5
WP_065495427.1\|1935340_1936027_-\|terminase	terminase endonuclease subunit	E5E3S3	Burkholderia_phage	5.2e-123	97.8
WP_150331634.1\|1936023_1937049_-\|capsid	phage major capsid protein, P2 family	E5E3S4	Burkholderia_phage	1.6e-192	99.7
WP_048805735.1\|1937085_1937907_-\|capsid	GPO family capsid scaffolding protein	E5E3S5	Burkholderia_phage	8.9e-146	99.6
WP_088925282.1\|1938056_1939823_+\|terminase	terminase ATPase subunit family protein	E5E3S6	Burkholderia_phage	0.0e+00	99.1
WP_053298901.1\|1939822_1940875_+\|portal	phage portal protein	E5E3S7	Burkholderia_phage	6.6e-202	97.7
WP_105768781.1\|1941321_1941789_-	very short patch repair endonuclease	I6NSG0	Burkholderia_phage	4.1e-31	50.4
WP_105768782.1\|1941739_1942597_-	hypothetical protein	I6NTM1	Burkholderia_phage	8.4e-115	66.2
WP_150331633.1\|1942593_1943751_-	DNA (cytosine-5-)-methyltransferase	I6NLI4	Burkholderia_phage	1.7e-147	66.2
WP_150331632.1\|1943750_1943957_-	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_150331631.1\|1944081_1945188_-	DUF3396 domain-containing protein	E5E3X7	Burkholderia_phage	2.2e-115	55.6
WP_150331630.1\|1945974_1946517_-	PAAR domain-containing protein	A4JWV5	Burkholderia_virus	9.5e-64	69.9
WP_053297823.1\|1946966_1947371_+	PaaI family thioesterase	NA	NA	NA	NA
1946701:1946748	attR	NA	NA	NA	NA
WP_006407226.1\|1947379_1948246_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_053297822.1\|1948265_1949279_-	D-2-hydroxyacid dehydrogenase family protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	8.7e-10	23.2
WP_006401839.1\|1949702_1950752_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006401840.1\|1950896_1953494_-	DNA topoisomerase III	A0A2P1ELA0	Moumouvirus	3.4e-18	24.7
WP_006407224.1\|1953698_1954079_-	thioredoxin family protein	NA	NA	NA	NA
WP_053297833.1\|1954116_1955409_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	5.7e-22	35.6
WP_006410713.1\|1955640_1956144_+	peptide deformylase	A0A067XQZ3	Caulobacter_phage	1.1e-13	32.1
WP_053297821.1\|1956178_1957162_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.6e-08	37.2
WP_006407221.1\|1957283_1957925_+	LysE family translocator	NA	NA	NA	NA
WP_053297820.1\|1958022_1958880_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_006407219.1\|1959063_1960467_+	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_006401849.1\|1960463_1961054_+	DUF4390 domain-containing protein	NA	NA	NA	NA
WP_053297819.1\|1961043_1963497_+	PAS domain-containing sensor histidine kinase	NA	NA	NA	NA
WP_006401851.1\|1963497_1964199_+	response regulator	NA	NA	NA	NA
WP_006401852.1\|1964662_1965397_+	7-cyano-7-deazaguanine synthase QueC	A0A1B0Z0B4	Vibrio_phage	2.1e-50	43.5
WP_006407217.1\|1965471_1966104_+	7-carboxy-7-deazaguanine synthase	R4TAH8	Halovirus	1.9e-07	33.6
WP_006401854.1\|1966123_1966576_+	6-carboxytetrahydropterin synthase QueD	A0A088FAL2	Vibrio_phage	2.0e-14	31.4
WP_006401855.1\|1966801_1967587_+	2-dehydro-3-deoxyglucarate aldolase	NA	NA	NA	NA
WP_006407216.1\|1967583_1968357_+	sel1 repeat family protein	NA	NA	NA	NA
WP_006401857.1\|1968399_1969548_-	rod shape-determining protein RodA	NA	NA	NA	NA
WP_053297817.1\|1969559_1971887_-	penicillin-binding protein 2	NA	NA	NA	NA
WP_053297816.1\|1971989_1972502_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_053297815.1\|1972498_1973584_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_004189550.1\|1973709_1974753_-	rod shape-determining protein	NA	NA	NA	NA
WP_006407213.1\|1975117_1975417_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_053297814.1\|1975487_1976978_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_006407211.1\|1976982_1978455_+\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA

DBSCAN-SWA_6

2735167 : 2802394

Burkholderia_virus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089339361.1\|2735167_2736348_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-55	40.8
WP_006405790.1\|2738194_2739241_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_006405789.1\|2739194_2740301_+	ABC transporter permease	NA	NA	NA	NA
WP_006405788.1\|2740297_2741950_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-20	35.1
WP_006405787.1\|2741946_2742273_+	hypothetical protein	NA	NA	NA	NA
WP_006405786.1\|2742605_2745314_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_006405785.1\|2745541_2746282_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_088928016.1\|2746425_2747334_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_006405783.1\|2747376_2748489_-	HoxN/HupN/NixA family nickel/cobalt transporter	NA	NA	NA	NA
WP_006405782.1\|2748561_2749677_-	DUF4331 family protein	NA	NA	NA	NA
WP_006405781.1\|2749858_2751175_-	MFS transporter	Q6JIH2	Burkholderia_virus	5.2e-39	31.8
WP_006405780.1\|2751171_2752491_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_006405779.1\|2752543_2752840_+	hypothetical protein	NA	NA	NA	NA
WP_006405778.1\|2752842_2753664_+	alpha/beta hydrolase	A0A2P1JTI7	Mycobacterium_phage	3.2e-18	28.5
WP_006405777.1\|2753716_2754049_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_006405775.1\|2754419_2754806_+	response regulator	NA	NA	NA	NA
WP_006405774.1\|2754896_2757044_+	PAS domain S-box protein	NA	NA	NA	NA
WP_006405773.1\|2757033_2757708_+	response regulator transcription factor	NA	NA	NA	NA
WP_150377820.1\|2757658_2757910_-	hypothetical protein	NA	NA	NA	NA
WP_006405771.1\|2757910_2758966_+	alpha/beta hydrolase	M1PGN2	Moumouvirus	5.1e-61	39.6
WP_006405769.1\|2759125_2759803_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-32	34.7
WP_006405768.1\|2759838_2760999_-	NAD-dependent formate dehydrogenase	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.3e-17	27.8
WP_006405767.1\|2761175_2766785_-	AAA family ATPase	M1I1I7	Paramecium_bursaria_Chlorella_virus	3.2e-05	21.7
WP_006405766.1\|2766863_2767511_-	response regulator transcription factor	NA	NA	NA	NA
WP_006405765.1\|2767782_2768250_+	MEKHLA domain-containing protein	NA	NA	NA	NA
WP_006405764.1\|2768367_2768745_+	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_006405763.1\|2769150_2769810_+	response regulator	NA	NA	NA	NA
WP_006405762.1\|2769897_2772873_+	sensor histidine kinase	A0A1V0SGX0	Hokovirus	2.8e-40	28.7
WP_006405761.1\|2772977_2774234_-	MFS transporter	NA	NA	NA	NA
WP_006405760.1\|2774372_2775245_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006405759.1\|2775317_2776262_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006405758.1\|2776627_2778064_+	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_006405757.1\|2778097_2779078_+	NAD(P)H-quinone oxidoreductase	NA	NA	NA	NA
WP_006405756.1\|2779201_2779963_-	glycine/betaine ABC transporter	NA	NA	NA	NA
WP_006405755.1\|2779990_2780914_-	DMT family transporter	NA	NA	NA	NA
WP_006405754.1\|2780970_2781624_-	oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB	NA	NA	NA	NA
WP_006405753.1\|2781667_2782891_-	hypothetical protein	NA	NA	NA	NA
WP_006405752.1\|2782952_2783960_-	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_080559078.1\|2784093_2784921_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006405751.1\|2784554_2785562_-	DUF72 domain-containing protein	NA	NA	NA	NA
WP_006405750.1\|2785772_2786123_-	BON domain-containing protein	NA	NA	NA	NA
WP_006405749.1\|2786163_2786457_+	hypothetical protein	NA	NA	NA	NA
WP_123806786.1\|2786525_2786705_-	hypothetical protein	NA	NA	NA	NA
WP_006405747.1\|2786854_2787760_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006405746.1\|2787746_2787956_+	hypothetical protein	NA	NA	NA	NA
WP_006405745.1\|2788000_2788426_+	DUF3331 domain-containing protein	NA	NA	NA	NA
WP_006405744.1\|2788987_2789992_+	chemotaxis protein CheB	NA	NA	NA	NA
WP_080559079.1\|2790315_2790582_-	hypothetical protein	NA	NA	NA	NA
WP_006404120.1\|2790624_2792148_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4
WP_006404121.1\|2792160_2792928_+	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	6.7e-71	53.8
WP_150331854.1\|2793065_2793854_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.4e-78	58.8
WP_150331853.1\|2793850_2794867_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	1.5e-70	41.9
WP_150331852.1\|2794942_2795398_-	ParB N-terminal domain-containing protein	NA	NA	NA	NA
WP_080559084.1\|2796092_2797127_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_150331851.1\|2797592_2798867_-	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_150331850.1\|2798956_2799466_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_150331849.1\|2799609_2800366_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_150331848.1\|2801169_2802394_+\|transposase	IS3 family transposase	Q8W6R2	Burkholderia_virus	3.7e-124	76.5

DBSCAN-SWA_7

2812013 : 2855787

uncultured_virus(25.0%)

plate,transposase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331841.1\|2812013_2813276_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	4.4e-43	45.5
WP_011881602.1\|2813299_2814559_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331840.1\|2814697_2816020_-	hypothetical protein	NA	NA	NA	NA
WP_150331839.1\|2817128_2817497_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_150331838.1\|2817493_2817844_-	hypothetical protein	NA	NA	NA	NA
WP_150331837.1\|2817845_2818172_-	hypothetical protein	NA	NA	NA	NA
WP_150331836.1\|2818247_2819054_-	DUF4942 domain-containing protein	NA	NA	NA	NA
WP_150331835.1\|2819120_2820212_-	hypothetical protein	NA	NA	NA	NA
WP_150331888.1\|2820208_2821123_-\|capsid	phage capsid protein	NA	NA	NA	NA
WP_150331834.1\|2821401_2822397_-	endonuclease	A6XMH8	Bacillus_virus	1.3e-55	39.8
WP_150331833.1\|2822467_2822668_-	hypothetical protein	NA	NA	NA	NA
WP_150331832.1\|2822664_2823633_-	DUF932 domain-containing protein	A0A0H4INH5	Stenotrophomonas_phage	2.6e-59	43.6
WP_077181108.1\|2823750_2824008_-	hypothetical protein	NA	NA	NA	NA
WP_150331831.1\|2824760_2825864_+	hypothetical protein	NA	NA	NA	NA
WP_150331830.1\|2825902_2826283_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_150331829.1\|2826304_2826877_+	hypothetical protein	NA	NA	NA	NA
WP_150331828.1\|2826884_2828768_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_150331827.1\|2828905_2831014_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.8e-64	30.0
WP_065494660.1\|2831024_2832368_+	DUF2169 domain-containing protein	NA	NA	NA	NA
WP_150331826.1\|2832360_2834118_+	DUF4150 domain-containing protein	NA	NA	NA	NA
WP_150331825.1\|2834121_2834607_+	hypothetical protein	NA	NA	NA	NA
WP_150331824.1\|2835307_2835883_+	hypothetical protein	A0A2H4J2R8	uncultured_Caudovirales_phage	1.1e-49	59.1
WP_150331618.1\|2836469_2837704_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5
WP_150331887.1\|2838129_2839080_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_150331823.1\|2839235_2840027_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_150331822.1\|2840051_2841047_+	aldo/keto reductase	NA	NA	NA	NA
WP_150331821.1\|2841030_2841876_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_150331820.1\|2841896_2842919_+	aldo/keto reductase	NA	NA	NA	NA
WP_150331819.1\|2842915_2844118_+	MFS transporter	NA	NA	NA	NA
WP_150331886.1\|2844429_2844624_-	hypothetical protein	NA	NA	NA	NA
WP_150331618.1\|2844679_2845914_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.7e-103	65.5
WP_089339361.1\|2846047_2847227_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.6e-55	40.8
WP_150331818.1\|2847237_2847444_-	hypothetical protein	NA	NA	NA	NA
WP_150331817.1\|2847440_2847986_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_011881602.1\|2849245_2850505_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331816.1\|2850588_2851479_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081052463.1\|2852470_2852887_+\|transposase	transposase	NA	NA	NA	NA
WP_036047966.1\|2852883_2853225_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	9.0e-36	66.7
WP_006404120.1\|2854263_2855787_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	2.2e-150	53.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044055

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044055_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044055_1

209319-209428

Orphan

Consensus_repeat	Method
CTCGCGCGACGTCGCGCCGATCTCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044055_1

>merge|NZ_CP044055|1|209319-209428|CRISPRCasFinder
ATCGCGCGACGTCGCGAAGATCTCGCGCGACGTCGCGCCGATCTCGGTCGTGGTCGCTGCCGTCTCGTTCGCGGTCGCCTGCTGCTCGCGCGACGTCGCGGCGATCTCGG

>NZ_CP044055|1|1|209319-209428|CRISPRCasFinder
ATCGCGCGACGTCGCGAAGATCTCGC	GCGACGTCGCGCCGATCTCGGTCGTGGTCGCTGCCGTCTCGTTCGCGGTCGCCTGCTG
CTCGCGCGACGTCGCGGCGATCTCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044055.1\|WP_006404214.1\|213760_215194_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143465
NZ_CP044055.1\|WP_006404206.1\|203608_205909_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|223716
NZ_CP044055.1\|WP_053297863.1\|205905_206637_-\|purine-binding-chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|223905
NZ_CP044055.1\|WP_053297866.1\|215222_216863_-\|acetolactate-synthase-large-subunit	unknown	unknown	gnl\|CDD\|236239
NZ_CP044055.1\|WP_088924489.1\|202586_203612_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	unknown	unknown	gnl\|CDD\|237135
NZ_CP044055.1\|WP_035487939.1\|217227_217545_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|162974
NZ_CP044055.1\|WP_125902498.1\|198884_199094_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044055.1\|WP_006404212.1\|211740_211953_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044055.1\|WP_006404211.1\|210422_211556_-\|hybrid-sensor-histidine-kinase/response-regulator	unknown	unknown	gnl\|CDD\|381117
NZ_CP044055.1\|WP_053297867.1\|217882_219169_-\|DUF445-domain-containing-protein	unknown	unknown	gnl\|CDD\|225347
NZ_CP044055.1\|WP_053297865.1\|208119_208632_-\|chemotaxis-protein-CheW	unknown	unknown	gnl\|CDD\|366716
NZ_CP044055.1\|WP_006404199.1\|197252_197654_+\|OsmC-family-protein	unknown	unknown	gnl\|CDD\|224679
NZ_CP044055.1\|WP_006404200.1\|197747_198629_-\|Dyp-type-peroxidase	unknown	unknown	gnl\|CDD\|273607
NZ_CP044055.1\|WP_045593508.1\|199073_200936_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044055.1\|WP_150331589.1\|206683_208123_-\|MCP-methyltransferase	unknown	unknown	gnl\|CDD\|224271
NZ_CP044055.1\|WP_006404219.1\|220493_220820_-\|non-heme-iron-oxygenase-ferredoxin-subunit	unknown	unknown	gnl\|CDD\|239604
NZ_CP044055.1\|WP_006398012.1\|217548_217848_+\|putative-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|188241
NZ_CP044055.1\|WP_006404213.1\|211976_213560_-\|Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|223104
NZ_CP044055.1\|WP_053297862.1\|201090_202332_-\|voltage-gated-chloride-channel-family-protein	unknown	unknown	gnl\|CDD\|239654
NZ_CP044055.1\|WP_053297868.1\|219283_220504_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|170080

Protein	Function_ID	Function_description	E-value
NZ_CP044055.1\|WP_006404214.1\|213760_215194_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143465	cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like. Aldehyde dehydrogenase ALDH21A1 (gene name RNP123) was first described in the moss Tortula ruralis and is believed to play an important role in the detoxification of aldehydes generated in response to desiccation- and salinity-stress, and ALDH21A1 expression represents a unique stress tolerance mechanism. So far, of plants, only the bryophyte sequence has been observed, but similar protein sequences from bacteria and archaea are also present in this CD.	0
NZ_CP044055.1\|WP_006404206.1\|203608_205909_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|223716	COG0643, CheA, Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms].	1.26495e-117
NZ_CP044055.1\|WP_053297863.1\|205905_206637_-\|purine-binding-chemotaxis-protein-CheW	gnl\|CDD\|223905	COG0835, CheW, Chemotaxis signal transduction protein [Cell motility and secretion / Signal transduction mechanisms].	5.36437e-26
NZ_CP044055.1\|WP_053297866.1\|215222_216863_-\|acetolactate-synthase-large-subunit	gnl\|CDD\|236239	PRK08322, PRK08322, acetolactate synthase large subunit.	0
NZ_CP044055.1\|WP_088924489.1\|202586_203612_-\|chemotaxis-response-regulator-protein-glutamate-methylesterase	gnl\|CDD\|237135	PRK12555, PRK12555, chemotaxis-specific protein-glutamate methyltransferase CheB.	0
NZ_CP044055.1\|WP_035487939.1\|217227_217545_+\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|162974	TIGR02683, Uncharacterized_protein_HI_1419, putative addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.	2.01765e-43
NZ_CP044055.1\|WP_006404211.1\|210422_211556_-\|hybrid-sensor-histidine-kinase/response-regulator	gnl\|CDD\|381117	cd17575, REC_WspR-like, phosphoacceptor receiver (REC) domain of WspR response regulator and similar proteins. The GGDEF response regulator WspR is part of the Wsp system that is homologous to chemotaxis systems and also includes the membrane-bound receptor protein WspA. In response to growth on surfaces, WspR is phosphorylated by the Wsp signal transduction complex and is activated, functioning as a diguanylate cyclase (DGC) that catalyzes c-di-GMP synthesis. WspR is a hybrid response regulator-diguanylate cyclase, containing an N-terminal REC domain and a C-terminal GGDEF domain. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	9.79085e-63
NZ_CP044055.1\|WP_053297867.1\|217882_219169_-\|DUF445-domain-containing-protein	gnl\|CDD\|225347	COG2733, COG2733, Predicted membrane protein [Function unknown].	1.60583e-136
NZ_CP044055.1\|WP_053297865.1\|208119_208632_-\|chemotaxis-protein-CheW	gnl\|CDD\|366716	pfam01584, CheW, CheW-like domain. CheW proteins are part of the chemotaxis signaling mechanism in bacteria. CheW interacts with the methyl accepting chemotaxis proteins (MCPs) and relays signals to CheY, which affects flageller rotation. This family includes CheW and other related proteins that are involved in chemotaxis. The CheW-like regulatory domain in CheA binds to CheW, suggesting that these domains can interact with each other.	3.83041e-20
NZ_CP044055.1\|WP_006404199.1\|197252_197654_+\|OsmC-family-protein	gnl\|CDD\|224679	COG1765, COG1765, Predicted redox protein, regulator of disulfide bond formation [Posttranslational modification, protein turnover, chaperones].	3.14463e-16
NZ_CP044055.1\|WP_006404200.1\|197747_198629_-\|Dyp-type-peroxidase	gnl\|CDD\|273607	TIGR01413, Probable_deferrochelatase/peroxidase_EfeN, Dyp-type peroxidase family. A defined member of this superfamily is Dyp, a dye-decolorizing peroxidase that lacks a typical heme-binding region. A distinct, uncharacterized branch (TIGR01412) of this superfamily has a typical twin-arginine dependent signal sequence characteristic of exported proteins with bound redox cofactors.	1.51576e-81
NZ_CP044055.1\|WP_045593508.1\|199073_200936_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.00407e-158
NZ_CP044055.1\|WP_150331589.1\|206683_208123_-\|MCP-methyltransferase	gnl\|CDD\|224271	COG1352, CheR, Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms].	1.50192e-67
NZ_CP044055.1\|WP_006404219.1\|220493_220820_-\|non-heme-iron-oxygenase-ferredoxin-subunit	gnl\|CDD\|239604	cd03528, Rieske_RO_ferredoxin, Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the insertions that give other Rieske proteins unique structural features are missing. CARDO catalyzes dihydroxylation at the C1 and C9a positions of carbazole. Rieske ferredoxins are found as subunits of membrane oxidase complexes, cis-dihydrodiol-forming aromatic dioxygenases, bacterial assimilatory nitrite reductases, and arsenite oxidase. Rieske ferredoxins are also found as soluble electron carriers in bacterial dioxygenase and monooxygenase complexes.	7.85115e-45
NZ_CP044055.1\|WP_006398012.1\|217548_217848_+\|putative-addiction-module-antidote-protein	gnl\|CDD\|188241	TIGR02684, conserved_hypothetical_protein, probable addiction module antidote protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the downstream member of a gene pair. It is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module. [Mobile and extrachromosomal element functions, Other].	2.49547e-40
NZ_CP044055.1\|WP_006404213.1\|211976_213560_-\|Na+/H+-antiporter	gnl\|CDD\|223104	COG0025, NhaP, NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic ion transport and metabolism].	6.9324e-74
NZ_CP044055.1\|WP_053297862.1\|201090_202332_-\|voltage-gated-chloride-channel-family-protein	gnl\|CDD\|239654	cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins. This ClC family presents in bacteria, where it facilitates acid resistance in acidic soil. Mutation of this gene (sycA) in Rhizobium tropici CIAT899 causes serious deficiencies in nodule development, nodulation competitiveness, and N2 fixation on Phaseolus vulgaris plants, due to its reduced ability for acid resistance. This family is part of the ClC chloride channel superfamiy. These proteins catalyse the selective flow of Cl- ions across cell membranes and Cl-/H+ exchange transport. These proteins share two characteristics that are apparently inherent to the entire ClC chloride channel superfamily: a unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge.	4.61383e-177
NZ_CP044055.1\|WP_053297868.1\|219283_220504_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|170080	PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional.	1.94427e-82

>NZ_CP044055.1|WP_053297865.1|208119_208632_-|chemotaxis-protein-CheW
MTRAESQSGAHALFLMFELDGERYALDAAGIDAVLPLATAKAVPGAPDWIAGLLIHDGEPVPVIDVPMLALGRRAHALRSTRLVMVRYRGAAADGGRRIGLIVERATQTMRIDRAAFRASGMTTPRTRWLGSVASTRDGIVQLVSVADLLDDVARLHLFDGLSGREEDSA
>NZ_CP044055.1|WP_150331589.1|206683_208123_-|MCP-methyltransferase
MRDFDSRFRGWLLRETGIDPDSLGNDFLIRAVTERVHALLAADGERLPSSVRPPVTPEALDAYWQRLNGCADERRALIELFVVPETWFFRDREAFATVARLAVQRVAASPSRVVRVLSAPCSTGEEPYSVAMALLDAGLEPDDFAIDAIDLSARAIEHARVGSYGRNAFRGTTTDFRARYFTPAADGWVLDERVRACVQFRQANLVEPLSDTGIRYDFVFCRNVLIYFDREVQDRVIRSLDACMTEDGMLFVGPAETGVAMRHGMRSARIPLAFAFHRERVGAPADGCATRRATPMPAAAPYRRAERFAPAPSAWSEPVPLAFAAPAAPIGGLAAMHAVDVDTAMADGPAVARPHAADLAAPARPVAAMPVTDTPADDAHTPTLEDAQALANAGAFDEAERVLAQFSARVGPHADAFYLLGLIADARGRAADASDFYRKALYLRPTHHEALTHLATLLDAGGDRAGAQWLLERARRSAG
>NZ_CP044055.1|WP_053297863.1|205905_206637_-|purine-binding-chemotaxis-protein-CheW
MNRDAAATDDTTIDVDDCWNRIGTLGDRSCERLADCLRCLNCPVYAYHAAKLLERPLGRAEMAEAAQRMRASDVAHPPRDGADTRDAALAFRVADEWLALPIRVLREIAGTRPIHSLPHRRHPAVRGVVNIRGTLRIAISIGALLGLDAGGAERGRGDGRTDGRTDGRFTRLLVAAHHGEPVVFPVDEVEGVLRFGASDWVPVPATVGRASAGLSRGVLSWRGKSVGLLDDDRLFDAVTRSMR
>NZ_CP044055.1|WP_006404206.1|203608_205909_-|hybrid-sensor-histidine-kinase/response-regulator
MSNDDDLSHLSLLELYREETRTQTQALSERLLALEAGEPDAAALEACMRAAHSLKGAARIVGVPLGVDIAGRMEECFVAAQAGTITLSAAHVDVLLAGVDLLVRVGDPHAAPVSPAEIDAFAAALTGADGAHTMRMPAAAPTPPVVASREHDAAANEPAGASIAVPPPGVPRAAAEPAQANRTAGAGAMRRVRADTLNRLLSLSGESLVESRWLKPFAESMLRVKRAQRDAARALDLVYEQFADELDAGVLASMNEVRHMLNDLQRSFAERMDEFDRFERRSTHIAEQLYDEALQCRMRPFGDATRAYPRIVRDLARSLGKQVRFSIVGEATQVDRDILDLLDAPLGHLLRNAIDHGVESPEVRRARGKPAEASVTLEARHSAGSLLVSVIDDGPGVDMDALRAAIVRQHLTDDETAARLSDPELLEFLLLPGFSMRDAVTDVSGRGVGLDAVQEMVRSVRGAVRIFNEPGAGMRFVLQLPLTLSVIRSLLVEVGGEPYAFPLAHVRRTLELAHEDIDVLEGQPHFPFDGRRAGLVAAHQLLDAGEPDASRASTAVVVVGGEPELYGVAVDRFLGERMLVVQPLDSRLHKIQNIAAGALLENGDPVLIVDVEDLIRSVDKLVRGGQLAKLTRDPQLAYADRRRRVLVVDDSLTVRELERKLLEKRGYDVTVAVDGMDGWNAVRGEAFDLVVTDVDMPRMDGIELVTLIKNDPLLQRVPVMIVSYKDRDEDRRRGLDAGADYYLAKSSFHDEALLDAVHDLIGDARG
>NZ_CP044055.1|WP_088924489.1|202586_203612_-|chemotaxis-response-regulator-protein-glutamate-methylesterase
MNIGIVNDLPLAVEALRRVLAQRPDHRVLWVAADGDEAVDFCVAHPPDLVLMDLVMPRLDGVAATRAIMARAPCAILIVTASVSANTSSVYEAMGAGALDAVDTPTLALGLSADAPPQPLLAKIDQIGRLLDSRAPAFVPLRPPVGAQRQPTLVAIGASAGGPTALATLLRMLPADFPAAIVIVQHVDQAFALGMAEWLDGHTRLPVRVARHGCTPRAGEVLLAATNDHLCLSSRGVLGYTREPAETPYRPSIDVFFDSVAECWRGDALGVLLTGMGRDGALGLKAMRAKGCYTIAQDEATSAVYGMPKAAAAIGAASAILPLDRIAPQLIARVARRAARP
>NZ_CP044055.1|WP_053297862.1|201090_202332_-|voltage-gated-chloride-channel-family-protein
MFFSTSADFFATVRYVCRWLALSVLLGALAGSASALFLVALDWATGTRVAHPWLLWGLPAAGFATGWVYHRFGQPVARGNNLLIDEIHDPKALVPKRMAPLVLAATVVTHLFGGSAGREGTAVQMGGALADRVTHAFRLDREHRRVLLMGGIAAGFSSVFGTPLAGAVFGLEVLAIGRLRYDALLACVASAIVADVVCRAWGVHHTVYAVPFVPAVSAAGLAATVLAGIAFGAVGRLFAHATHALAAGFRRAIRYAPLQPVLGGVLVAAAATALNVPQYLGLGIPTIEAAFRGPLPVYDFAGKFAFTVVTLASGFKGGEVTPLFYIGATLGNALGHVLALPVPVLAALGFVAVFAGAANTPIASTIMAIELFGADIGVYAIVACVVAYLFSGHAGIYRAQRVAVGKGTQAGQE
>NZ_CP044055.1|WP_045593508.1|199073_200936_+|ABC-transporter-ATP-binding-protein
MTRKTTHLGGHAFRAVFGFTFRYWRRQPARIAVVASFALLAALADVLTPLFAGRLVDALSAGLADRAAAWHAALVAFGTLAALGIGATLLRQGVYLNIITLTLKMMSEIAAASFHRVQRFSTDWHANSFAGSTVRKITRGIWALDLLNDTVLIALLPSVTMLVGATVLLGTHWPVMGLVVGAGSLLYITVTVAVSLGIVAPAARLGNLWDTRMGGALADAVSCNAVVKAFGAETREEARLARVIGKWRQRTRRTWVRGTLNGGLQGAMLVAMQAAMIGVALRLWANDEASVGDIAFALTMFFMLQGYLRDVGMHIRNLQRSVNDMEELVALERQPLGIEDRPNAPAIRIGEGEIRFEHVTFRYDNHPEPLYDDFSMRIAPGERVGLVGHSGSGKTTFIKLIQRLYDVSGGRIVIDGQDIAQVRQDSLRSQIAIVQQEPVLFHRTLAENIAYARPDASRADIERAARLASAHDFIAALPDGYDTLVGERGIKLSGGERQRVAIARAFLADAPILILDEATSSLDSESEVLIQQAMERLMVGRTTLVVAHRLSTVRALDRLLVLDRGKVIEEGSHDALIRIDGGVYRRLFERQALELAKGLADPPRRVADDKAGPLGQRATA
>NZ_CP044055.1|WP_125902498.1|198884_199094_-|hypothetical-protein
MGGFSGHVLLPGASRDGTFRFGERRKRNSRNRVHRAAKRKTGLSGQCAGRRTSETSGSRRGRRAESAVP
>NZ_CP044055.1|WP_006404200.1|197747_198629_-|Dyp-type-peroxidase
MSDVQHGILAPIDTAARYLTFTNSNDGNVAAALAALRECVDGRDTVVGFGHSLAAYIGRPIPGLTDYPAFAVNDRTLPATPADIWVWLRGDDRGDLVLRSRAIERALAPAFVLQDAVDGFRYSNDRDLSGYEDGTENPVGDAARAAAIVSGQGAGLDGGSFVAVQQWLHDFDRMERIAPHDMDHIVGRRRSDNEELDDAPAFAHVKRTAQESFEPEAFMLRRSSPWSDARRAGLYFVAFGRSFRAFDVQMRRMSGADDGIVDGLFRFTRPLTGAYFWCPPMKDGKLDLSAFGL
>NZ_CP044055.1|WP_006404199.1|197252_197654_+|OsmC-family-protein
MSLIHAAATLDADAPDYVVRVQAGSHALTGDEGEREGGRNVGPAPYEFVLAGLAQCTAATLRMYMQRKQWPAVRIDVHTELHADREGLQYVRRTVALDGTLDDAQRQRLAEICEKTPVTLFIKRGTRIETTLR
>NZ_CP044055.1|WP_006404211.1|210422_211556_-|hybrid-sensor-histidine-kinase/response-regulator
MKESIGDSAFETVFMKESSGESASDCLQSGLSVLLVDDQPFVGEVIRRALRSEHDIDLHVCTDAHRALTVARDVKPTVILQDLVMPEIDGLDLVRAWRADADTARVPIIVLSAKEEPIVKREAFIAGANDYLVKLPDAMELTARIRYHSNSYLMSRQRDEALDFLSHDMRSPQTSILALLDVYRAEHGDMPAIMERIAGHARRALALADGFIHLTRAQSERRAHELVSLNEIVLDAADQLWEKANGFGSRVVAHVPDTDCVTMGDRMMLTRAVANLIDNALKYGPAGTDVHCTLAADDGAWLIGVEDAGRGIAPEQRAAATESFVRLESAHGAARSGFGLGLAFVRATAARHRGQILMRNSARGFMVALRLPAQAQR
>NZ_CP044055.1|WP_006404212.1|211740_211953_-|hypothetical-protein
MRLDLGAPVRRARRVACRALVGRPRRRPVRPVAPPAAHARRRSGNDPIYSIPTASAHLTKLNHSEIDAVL
>NZ_CP044055.1|WP_006404213.1|211976_213560_-|Na+/H+-antiporter
MSPVSAFKLILLSFLAIVALEYAAKRLRLPPAAALLVGGIGIAFIPGLPPINLDPDLVLVVFLPPLLMDGAYFSVWQEFKRNVGGILLLAIGAVAFTTFAVGVAVHWAVPSLPWAACFALGAIVSPPDAVAAKAVLERVALPRRLMVLLEGESLLNDAAGLVLFRFAVAAALTGAFSLQHAVVGFAELGLGGVVVGFVIGRLVVWFLKLLDDDYLVITVAVLAGWIAYIAGEMVEVSGVIATVTAGMIVGWHQHEVFSAAVRTRGTAFWQVIVFLLEALVFVLIGLSLRGAMLRLGGLDQVLATMLPPVGAVLAAVVLSRFVWIYAVEALKWPVRGIMRRGDGPDWKAATVMSWAGMRGVVTLAIALSLPDAMPGRDVILVAAFAVILVTVLLQGTTIGPLIRLLRLPQRHERAAHHLSEPQAWARVEAAQLAAIQPLVRDENGVVIHPRLLEQYTYRAALTERLKDEPEFPASARTAHYDVVLAAIAAGRAELLRLHRTDRIHDEMLHALERDLDLQEVAAYHARG
>NZ_CP044055.1|WP_006404214.1|213760_215194_-|aldehyde-dehydrogenase-family-protein
MLKETYPYYLANEAVYANTDLEVTDKYSGKVATRVALADAKAIDAAIGAAVDATKPMRELPAYQRQAVLDHCVARFRERFDELAEALCIEAGKPINDAKGEVTRLIDTFRVASEEAVRIDGEVLNLEISARAQGYTGYTRRVPIGPCSFISPFNFPLNLAAHKVAPALAAGCPFVLKPASRTPVGALIIGEVLAETDLPKGAFSVLPAHRDGADLFTTDDRFRLLSFTGSPAVGWALKEKAGKKKVVLELGGNAAAIVDADQRDRLDYVVERLAFGAFYQSGQSCIGVQRILAHADIYDALRDKLIAKTRALKMGDPKDPSTFVGPMISESESRRLSGWMDAAVAAGAKIVAGGKVDGAMFEATLLENVGRDQDLYRKEAFGPIAILEKFDRFDDALARVNDSDFGLQAGVFTDSLAHTQQAWDELEVGGVVINDVPSFRVDNMPYGGVKDSGLGREGIRYAIEDMTEPRLLVVRRR
>NZ_CP044055.1|WP_053297866.1|215222_216863_-|acetolactate-synthase-large-subunit
MKASDLFVKALEAEGVEYVFGIPGEENLDLLESLRRSKIRLVLTRHEQAAGFMAATYGRLTGRTGVCLATLGPGATNFVTAAAYAQLGGMPMLMITGQKPIKSSKQGHFQIVDVVGMMQPLTKFTRQIVSIGNIPSAVREAFRRAEEERPGAAHLELPEDIAHEEGDGKPIPRSFSRRPIAEQKAVAYAVDAIQAARHPLLMIGAGGNRKTTCKMLLEFVDKTGIPFFTTQMGKGVIDETHPLWLGNATLSDGDFVHRAIEHADCIINVGHDVIEKPPFFMRADDKTVIHVNFLGAQVDPVYFPQIEVVGDIANAVWQMKEAIAPQPHWDFERFAMIKEHFDAHLQKGQHDPRFPMYPVRIVNDLYNALPVDGIVCLDNGMYKIWFARYWRAHEPNSLLLDNALASMGAGLPSAIATKIVHPPRKVIAVCGDGGFMMNSQELETAVRLGLDIVVMILRDDAFGMIRWKQENMNFPDFAMTLKNPDFVSYAQSYGAHGHRVESADALEPLLRECFASPGVHVIDVPVDYSDNERVLNREIKRLSAQL
>NZ_CP044055.1|WP_035487939.1|217227_217545_+|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MPYLAPTFSIRTTAVFDAWFAGLQDRTAKRRIQARIDRLSMGNLGNWKSVGSPVYEIRIDHGPGYRVYFVRRRTIWVVLLCGGDKSTQRDDIRAAHAMLEHLDLE
>NZ_CP044055.1|WP_006398012.1|217548_217848_+|putative-addiction-module-antidote-protein
MSKISTRPWDSAEHLKTDDDMAEYFEACLQEGGDDPAFIAHALGVIARARGMSQVARDAGLSREGLYKALSHDGNPSFGTILKVIKALGLQLHGAKAHA
>NZ_CP044055.1|WP_053297867.1|217882_219169_-|DUF445-domain-containing-protein
MTSDKALELKRSKRRALWLLLAAVAVFVTTIFLPRGPWIDGVKAVAEAAMVGALADWFAVVALFRRVPIPFVSRHTEIIPQNKDKIADNLAVFVREKFLGPDALAAQIRQHDPAQRLGAWLGEPANTEALGGYATKLMSFVLDMTDDARIQSFVHDAFRAAIDRIDLSQSAGAILDTLTKDGRHQALLDDAIAQIVAVLGKDENRDVIAGFIVEWLKTQYPKVEKIMPTHWLGENGAELVANAVSRVLEAVAADPEHELRQRFDRIVHSLTERLKHDRAFIDKGDEIKRYIRDGDAFNAYLKDLWVQLRAWLKADLARPDSALHRQAATLGGWLGARLAESPALRASLNEHVERAVHEMAPDFADFLMRHIRDTVRNWDAREMSRQIELNIGKDLQYIRINGTLVGGLIGFGLYLVSLVPRWAGDWLH
>NZ_CP044055.1|WP_053297868.1|219283_220504_-|FAD-dependent-oxidoreductase
MSADPFVIVGAGHAARRTAEALRARDPDVRIVMIGAERELPYDRPALSKDALLGDGGEQRAFVRDAGWYDAQRIALRLGTRVDAIERDAQRVRLDDGSSLPYVRLVLATGSRVRPFAGPVDDGVALHYVRTVADARALRAQLAPGRRVAVLGGGFIGLEVAAAARQLGCDVTVIDPAARLLQRALPEVVGTYARQLHDGRGVAFRLATTPRAVRRAAGGGAIVDTDAGDVQCDVVVVGIGVVPNVELAHAAGLDVDNGIRVDAGCRTADPAIFAAGEVTMHFNPLLGRHVRIESWQVAENQPAVAAANALGADDTYAELPWLWSDQYECNLQMLGLFGSEHAMVVRGDPASGAFTAFGLAHDGRIVAVAAANAGRDIGASRRLIAAGATPDPARLADPAVNLKAFL
>NZ_CP044055.1|WP_006404219.1|220493_220820_-|non-heme-iron-oxygenase-ferredoxin-subunit
MTEATLAEWHPLGTLDEFSEDEPAARVAGQKPIAVFRIGDELFAMHDLCSHGHARLSEGYVEDGCVECPLHQGLIDIRTGAPKCAPITEPVRTYPIRIVDGQVEVNVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044055_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044055_2

886473-886777

Orphan

Consensus_repeat	Method
ATCGGCGGCGCGCTCGGCGGCGG	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP044055_2

>merge|NZ_CP044055|2|886473-886777|CRISPRCasFinder
ATCGCCCCCGCTCTCGTCGTCGCCGCACTCGCCGGCGCGACTGCGCTGCCGGCGGCAGCTAACGATTTGAACAACGCGCTTGGCGGCGCGCTCGGCGGGGTAGCCGGCGCGGCGGTCGGCGGCGCGGTCGGCGGCAGCACGGGTTCCGTGATCGGCGGCGCGCTCGGCGGCGGCGCAGGTGGCGCGATTACGTCGAACCGTCGCGAGCGTACCGGCGCGATCATCGGCGGCGCGCTCGGCGGCGGTGCGGGCACCGCGGCCGGCAACGCCATGGGCGGCCGTACGGGCGGCCTGCTCGGCGCGGC

>NZ_CP044055|2|2|886473-886777|CRISPRCasFinder
ATCGCCCCCGCTCTCGTCGTCGC	CGCACTCGCCGGCGCGACTGCGCTGCCGGCGGCAGCTAACGATTTGAACAACGCG
CTTGGCGGCGCGCTCGGCGGGGT	AGCCGGCGCGGCGGTCGGCGGCGCGGTCGGCGGCAGCACGGGTTCCGTG
ATCGGCGGCGCGCTCGGCGGCGG	CGCAGGTGGCGCGATTACGTCGAACCGTCGCGAGCGTACCGGCGCGATC
ATCGGCGGCGCGCTCGGCGGCGG	TGCGGGCACCGCGGCCGGCAACGCCATGGGCGGCCGT
ACGGGCGGCCTGCTCGGCGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044055.1\|WP_006406755.1\|887498_888335_+\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP044055.1\|WP_053298147.1\|877098_878082_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP044055.1\|WP_081000663.1\|886990_887350_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044055.1\|WP_053298166.1\|895269_896352_-\|hemin-degrading-factor	unknown	unknown	gnl\|CDD\|226243
NZ_CP044055.1\|WP_053298154.1\|892393_893236_-\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP044055.1\|WP_053298151.1\|883688_885134_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP044055.1\|WP_006397321.1\|879108_879591_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP044055.1\|WP_053298153.1\|889426_891571_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP044055.1\|WP_035947416.1\|880685_881264_+\|membrane-protein	unknown	unknown	unknown
NZ_CP044055.1\|WP_045593484.1\|894358_895273_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP044055.1\|WP_053298150.1\|883016_883664_+\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP044055.1\|WP_053298156.1\|896399_898667_-\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP044055.1\|WP_053298165.1\|880083_880614_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP044055.1\|WP_006406752.1\|885326_885746_+\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP044055.1\|WP_053298152.1\|888415_889318_-\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP044055.1\|WP_006406742.1\|878940_879090_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP044055.1\|WP_053298148.1\|878140_878779_-\|2-hydroxychromene-2-carboxylate-isomerase	unknown	unknown	gnl\|CDD\|239320
NZ_CP044055.1\|WP_006406758.1\|891582_892194_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP044055.1\|WP_053298155.1\|893255_894347_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP044055.1\|WP_053298149.1\|881529_882732_-\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460

Protein	Function_ID	Function_description	E-value
NZ_CP044055.1\|WP_006406755.1\|887498_888335_+\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP044055.1\|WP_053298147.1\|877098_878082_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.8306e-49
NZ_CP044055.1\|WP_053298166.1\|895269_896352_-\|hemin-degrading-factor	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	1.19269e-138
NZ_CP044055.1\|WP_053298154.1\|892393_893236_-\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	3.88099e-157
NZ_CP044055.1\|WP_006397321.1\|879108_879591_-\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	5.09771e-70
NZ_CP044055.1\|WP_053298153.1\|889426_891571_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP044055.1\|WP_053298151.1\|883688_885134_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	2.8756e-38
NZ_CP044055.1\|WP_045593484.1\|894358_895273_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	1.74978e-74
NZ_CP044055.1\|WP_053298150.1\|883016_883664_+\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	3.28946e-47
NZ_CP044055.1\|WP_053298156.1\|896399_898667_-\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	2.70585e-115
NZ_CP044055.1\|WP_053298165.1\|880083_880614_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	6.0791e-10
NZ_CP044055.1\|WP_006406752.1\|885326_885746_+\|HIT-domain-containing-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.38166e-47
NZ_CP044055.1\|WP_053298152.1\|888415_889318_-\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	1.36782e-80
NZ_CP044055.1\|WP_006406742.1\|878940_879090_-\|hypothetical-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.44162e-11
NZ_CP044055.1\|WP_053298148.1\|878140_878779_-\|2-hydroxychromene-2-carboxylate-isomerase	gnl\|CDD\|239320	cd03022, DsbA_HCCA_Iso, DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).	5.31931e-59
NZ_CP044055.1\|WP_006406758.1\|891582_892194_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.7377e-63
NZ_CP044055.1\|WP_053298155.1\|893255_894347_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	4.52499e-77
NZ_CP044055.1\|WP_053298149.1\|881529_882732_-\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0

>NZ_CP044055.1|WP_006406752.1|885326_885746_+|HIT-domain-containing-protein
MSYDDNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAASIRMTQRVAAAVRAALAPDGLFIGQFNGAAAGQTVPHVHFHVIPRTEGVALRMHARDVADAATLESIAQRIRAHIA
>NZ_CP044055.1|WP_053298151.1|883688_885134_-|serine-hydrolase
MTIPLRPLIRRGIALALIAAIGYAGYQLSRLAPIATGYAAKALCSGVFVSGRPAASVIDVDIMAGVHPLLKLVRPSIDAEHHRAHATFAGFAARDAEFRPGLGCTLALGPAAAALPAALPPLPAAPAATAVPASLAIASASASASSTTSAPNGVDMRKLHTALDRAFDEPDPARPRRTRAVVVMWRGRVIAERYAPGFTGDTPLPGWSMTKTVTAVLIGMLVGQHRLSPDTAALLPEWRGAGDPRAAITLDDLLRMTSGLQFNEDYDDPLSDVAVMLFTQRDTARFASNKPLAAAPGTRWDYSSGTSEIVARVMRVALGGSTDDYLSFPRRALFAPLGMRSAVFEPDASGTLAAASFMYASARDWARFGQFLLQDGVWDGQRLLPEGWVRYLARATPQSSRAAFGAHLWVKVPEPFDDRDPHARALPADAFHAVGHEGQFVSVVPSRDLVVVRLGLSRPESAWNHEAFLARVLDAIPASGT
>NZ_CP044055.1|WP_053298150.1|883016_883664_+|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEREDWGAGFRSTDDPAYLALNPNGLVPVIRDGDFVLWESNAILRYLANRYGDRLGNGAVAPSLYPTDPQARARVDQWIDWQGTDLNRSWVGAFLGLVRKSPDHQDPAAIAQSIANWTKHMRVLNGQLDATGAFVAGEHFTIADIAIGLSVNRWFGTPFERPELPAVKRYADRLATREGFKTYAGSANP
>NZ_CP044055.1|WP_053298149.1|881529_882732_-|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGAGADTLGVFFERPGSETKPGTAGWYNSAAFERFATEKGLYARSINGDAFSDQVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKSVTFRGIDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLFKDSLYGATPHLDDEGRLRADYKELDPQIQKKVVELWDQVTNENLYELTDFAGYKTDFLRLFGFEIAGVDYDADVNPDVKIPRIIDTTA
>NZ_CP044055.1|WP_035947416.1|880685_881264_+|membrane-protein
MKRTHVVMGCAALLVALPIAAYALVKPLRVAMPALVPGVSCVHAQICIDDASKLADAQQLYRDGYARAAAAVGAFGDAPRVVFCSTRACADAFGLGERAALTLGTVGVVIAPRGWHAYFVAHELIHHRQAETLGNLAVLTKPRWLIEGMAYSLSGDPRHPLKEPFEAWRARFDAWHAALGTRPLWDAARAVE
>NZ_CP044055.1|WP_053298165.1|880083_880614_+|GNAT-family-N-acetyltransferase
MTESVTVRRVGANEAIAYVDALSDVLIDCVEGGASVSFMLPIARSTAVAFWTGVAQSVANGERILLVAEDASGRVVGTVQIVTAQPENQPHRADIAKMLVARHARRQGVAARLLAAADAAARDAGKTVLVLDTVTGGDAERLYERAGWQRVGVVPNFALMPDGAPCATTFFHKQLA
>NZ_CP044055.1|WP_006397321.1|879108_879591_-|SRPBCC-family-protein
MMHSHTTRISRHVNAPRNRVYRALLDPHAVEQWKVPDGMTCRVHAFDAREGGALRVSLTADAAAPAGKTDAHTDTYHGRFVTLVPDRQVVEIDVFETDDPMLRGAMTITITLSDEDGGTRVDAVHDGVPPGVPAADNETGWRMALARLAALVEDGGRPHA
>NZ_CP044055.1|WP_006406742.1|878940_879090_-|hypothetical-protein
MSDEDAGTRVDAVHGGVPPGVPASDNETGWRMALARLAALVEDGGRPHA
>NZ_CP044055.1|WP_053298148.1|878140_878779_-|2-hydroxychromene-2-carboxylate-isomerase
MNAARTATWYFDFVSPFAYLQQEQFDGLPPAAAFEPTPIVLGALLAHWGQKAPAEIATKRIFTYRHAQYRADKLGIPFRMPPAHPFNPIRPLRLAIAMGGSMDAIGRIFRHIWRDGQDVATPDGFAALCEAVGFPEGVTAVDAQPVKDALRANTDRAIAHGVFGVPTFELDGDLFWGEDATDMFVDCATSRAWLDSPEVRRISTLPEGIRRG
>NZ_CP044055.1|WP_053298147.1|877098_878082_+|LysR-family-transcriptional-regulator
MTAKSDDSRDAQGASHIPTVPVDGAGYRFELMETFVRIVEAGSLSAAAAQMHTTQPTVSRRLQALERSLGVRLLQRTTHAMRLTVDGERCFTRAKELLAHWAAFEADLRGAQEEPDGLLRVAVPHAFGQERFVAPLARFLRDYPRVSVEWLLQDDVRDFVGSGIDCAIQVGEPTDPGVVAIRLTKVPRFVVAAPSVLNGADVPADPDALAALPWLALRTYYRTELTLTHAVTGDTRRIAIRPRITTANLYALRSAALLGVGACVGSSWMLADDLARGDLVHLARDWQAAPLPVYITYPHAQFYPSRLVRFVAMMRDAVPALVEGRDA
>NZ_CP044055.1|WP_081000663.1|886990_887350_-|hypothetical-protein
MLDGPGAGRDVRRHAAARGPERSIRYAGSTDDSEVVFDRPIKCCDGLHSISHCSPDASGASRQPRRHIRLRARRRRNGRSQSTPGRRHTHAPVEERREIQGEEENAARDSRASHREPLK
>NZ_CP044055.1|WP_006406755.1|887498_888335_+|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTHTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGQAELTLQGTKHTLTPGGYAFIPPGADWTLHNVSDAAVRFHWIRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP044055.1|WP_053298152.1|888415_889318_-|3'-kinase
MLGWLNFIEESTPHRPTQRHTHRRADAPVRLYHFRMFAAHLRSWSLTPDGGPILTASGGVLPVVWRGRPAMLKIATCEEERRGNALMTWWDGHGAAQVWAHDDDAILLERAQPQPALADFSAAGHDDDAIRIACDVVAQLHAYRAPDPPSLVALRDWFASLLASDATDAILRRSQATAAALLAEPPVDEAVLHGDIHHRNVLHFGDRGWRAIDPKALRGARAFDYANLFCNPSHDIAVDRTRFERRVAIVADAARLDARTLLRWILAWCGLSAIWLIEDDQPADTRLQVAALAAHALDSR
>NZ_CP044055.1|WP_053298153.1|889426_891571_+|PBP1A-family-penicillin-binding-protein
MTDRTDSRPTPPAPPPRRRVWRMLAGALLGLMLAGAGIAGWTIHRIWTQLPSVEQLAVYRPALPLRIFSRDGELLAEYGVERREFVPLERMPARMRDALLAAEDAQFYRHGAIDIGGLARATFANVVTGQPAQGGSTITMQVARNFYLTRDKVLSRKLAEILMAVKLERAYGKDKLLELYMNEIYLGERAYGFAAAAHVYFGKPLDALSVGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMLALGKLDDATYRAAVDAPIALSPQAPPGIVAAPYVAERARQMMVERFRDDAYTLGLDVTTTISMRDQRAAEAALERTLRRQRTTRDAQRTLEGALVSLDAATGDMLALVGGADFSRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTPAETGARPWRPRNYGNHYEGFIAVRRGLVRSKNLVAVSLMQAADPQYVQQHAMRFGFDARRNPASLPLALGAGAVTPLELASAYGVFANGGTRVEPRLILSVKQRHGGVLYDAPAPSGTRVVSARNAFVMDSMLRDVVRAGTARGALALRRDDTAGKTGTSNGSKDVWFAGYSSGIVAVAWLGYDTPRSMGRATGATLALPVWLDYMKTAVDGRTPAEAVEPPDVARVDGDFVYAEYTRGACTADVPAFVRSRFACDGAARAEAASAGFAASAASTAANGGAMSVAPTPAPVDAAERARVLDLFRTDD
>NZ_CP044055.1|WP_006406758.1|891582_892194_+|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPQYLVITLVAATVASRLARHVARMKTLFVAVDALGLAAFTIIGCDVGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILRRELYASVAFFTGALYVALQHVGIDARVATIVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP044055.1|WP_053298154.1|892393_893236_-|heme-ABC-transporter-ATP-binding-protein
MLTVQHLRVARRHRVILHDLSLTIEPGRVTALLGRNGAGKSTLLKALAGELAGSAAPNGVRVTGRIALNGEPLAQIDAQRLARLRAVLPQAAQPAFPFSVDEIVLLGRYPHARGRGGALSRRDRGIAWHALARAGADTLLGRDVTTLSGGELARVQFARVLAQLWPSDDEAGRDARDASPTRYLLLDEPTAALDLAHQHRLLDTVRAIAREWRIGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPHDVMTPEHIARCYGFAVKRIDSGDGTPPVMVPA
>NZ_CP044055.1|WP_053298155.1|893255_894347_-|iron-ABC-transporter-permease
MSARLSSIRASSVAAGAHGARRIGTQRRFAPVALGALAVLVGAMSVVALCVGAYRISPADAWAALAGDPAAQQARAVLLGIRAPRVVLALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATAAIVLGPALFAAHAGAAALPAAAFVGALAIAALVYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSTLAAVAPCAVLGCALLMRERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIVGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTLAAPAEIPLGVLTALLGAPFFLALLWKSRGSLGA
>NZ_CP044055.1|WP_045593484.1|894358_895273_-|ABC-transporter-substrate-binding-protein
MSARTFDPRRRAVLAGAAASALAATVPARAIAAVQSAPKRVVVIGGALAETAFALGGEHARGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAAIAQVARAGVAVQTFDERHNAESVRAKIAGIAQALDMRDAGVALLRQFDRDWQAARATVAAHVPGGAQPPRVLFVLNHTGNQALVAGRRTAADAMIRYAGARNAMQGFDHYKPLTSEALAAAAPDVVLISDEGLAAVGGRAALLGAPGFAATPAGRAQRIVSLDALLLLGFGPRLPLAVTTLHRRLSDTLA
>NZ_CP044055.1|WP_053298166.1|895269_896352_-|hemin-degrading-factor
MMQSPVSAPSVRTSTSLRDAFVKLKRERRLRNRDVAQALGVSEGEALAAFVGEHVVRLDARFPELFEEMPRLGRVMALTRNDAAVHEKDGAYAQMSHDGPVGLALGDIDLRIFYRQWASAFAVRDDTPHGPLKSLQFFDAQGHAIHKVYLRAHSDHAEYDAFVARWRAASQQPGLDVAPAAPKKPERADSAIDVVGFRAAWDAMTDTHQFFGITQRFGVSRLQALRLADPQHAYPLDAARALRHVLERAAQSGQPIMVFVGNAGMIQIHTGPIANVREVGAWINVLDPGFNLHVREDMIATAWVVKKPTSDGIVTSVELFDRNGEHVALLFGERKPGQPERDDWRALVASLAPAARGDAR
>NZ_CP044055.1|WP_053298156.1|896399_898667_-|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MHRSTLARQPIFAALIGAVGLSAATAHADSSPSHAAASSVMADAAAARAGSALLDPVTVTATRTATAASRTAASVSVIDADDLDEQQATNIKDALRYEPGITVRRTAYRPGSAALGGGRDGDSSINIRGLEGNRVMLMEDGIRLPNAFSFGPLEAGRGDYTDLDTLKRIEIVRGPASALYGSDGLTGAVNFITKDPQDLLSIYRKPIYFSFRPSYDSTDRSIGATVSAAGGNDRIQGMIIADGRRGHEIDTRGSNNAAGTLRTTSNPQHVYSESLLGKLVLTPTVRDTIRLTAETVQRRVGTDVLSAIVAPATLGLTTSDRLERNRFSADYAFRDDASRWLQNAHVQFYYQEATQDQYAFETRGTLPSRSRDNRYRERTFGGSAFAESGFSTGPLAHKLLGGVDGSLSRITNLRDGTVPGVGETFPNKAFPDTDYTLFGAFVQDQIGYGRLLVTPGLRFDTYRLKPAGNDPLFTGRAVSTHANELSPRVAVLYEIAPALIPYLQYAHGFRAPTPDQVNSSFSNPVYGYTSIGNPNLKPETSDTFEAGLRGRAGTGYGTIRYSAAAFTGRYRNFIARTTIAGSGRPTDPFVFQYVNFADARVHGIEGRADWAMPNGITLRTALALTRGSTQNNGAASQPLNTVNPFSAVFGVRYEPTERWFVQTDLLFQAAKRDKDIDRSDCSKRACFAPPSSFVVDLRGGYRFNKHVSATVGIRNLFDRKYWNWSDVRGIAADSPVLDAYTSPGRTVAVSMKVDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044055_2	2.4\|886718\|37\|NZ_CP044055\|CRISPRCasFinder	886718-886754	37	NZ_CP044332	Methylocystis parvus strain BRCS2 plasmid unnamed1, complete sequence	200298-200334	11	0.703

1. spacer 2.4|886718|37|NZ_CP044055|CRISPRCasFinder matches to NZ_CP044332 (Methylocystis parvus strain BRCS2 plasmid unnamed1, complete sequence) position: , mismatch: 11, identity: 0.703

tgcgggcaccgcggccggcaacgccatgggcggccgt	CRISPR spacer
ctccgcggccgggaccggcaacgccatgggcggcttc	Protospacer
. * *  .*** *.********************. .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3623

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404010.1\|667_1858_-	O-succinylhomoserine sulfhydrylase	NA	NA	NA	NA
WP_006399595.1\|2090_3623_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.6e-87	41.7

DBSCAN-SWA_2

8279 : 9131

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404015.1\|8279_9131_-	site-specific DNA-methyltransferase	R4THJ7	Phaeocystis_globosa_virus	3.6e-33	33.8

DBSCAN-SWA_3

40887 : 41211

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035956001.1\|40887_41211_-	helix-turn-helix transcriptional regulator	A0A2H4J145	uncultured_Caudovirales_phage	7.5e-08	44.8

DBSCAN-SWA_4

48751 : 49906

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331592.1\|48751_49906_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.3e-25	32.0

DBSCAN-SWA_5

56696 : 63582

Escherichia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298815.1\|56696_57233_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	2.9e-12	41.6
WP_053298816.1\|57445_58084_+	hypothetical protein	NA	NA	NA	NA
WP_006404061.1\|58133_58874_-	peptidoglycan DD-metalloendopeptidase family protein	S5VY01	Leptospira_phage	2.5e-06	35.9
WP_006404062.1\|59254_59575_+	hypothetical protein	NA	NA	NA	NA
WP_006404063.1\|59671_60016_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_006404064.1\|60215_61628_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	2.4e-42	29.8
WP_053298817.1\|61723_62365_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_053298818.1\|62361_63582_-	NAD-dependent protein deacetylase	S5M4R0	Bacillus_phage	2.5e-11	23.7

DBSCAN-SWA_6

85131 : 86562

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298826.1\|85131_86562_+	deoxyribodipyrimidine photo-lyase	A0A1V0SIL2	Klosneuvirus	4.6e-49	27.8

DBSCAN-SWA_7

90263 : 94809

Micromonas_sp._RCC1109_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409488.1\|90263_91307_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	8.0e-43	31.4
WP_006409487.1\|91303_92425_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	1.6e-33	33.4
WP_053298828.1\|92399_93167_-	4-oxalocrotonate decarboxylase	NA	NA	NA	NA
WP_053298874.1\|93163_93961_-	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_150331591.1\|94023_94809_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	2.2e-53	45.2

DBSCAN-SWA_8

109101 : 116834

Vibrio_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080596176.1\|109101_111516_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	4.9e-35	32.0
WP_053298881.1\|111605_113468_-	DNA primase	A0A1S5RF71	Helicobacter_phage	4.6e-49	33.8
WP_006404124.1\|113535_113982_-	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	4.8e-21	45.2
WP_004190342.1\|114154_114367_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_053298882.1\|114442_115663_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_053298894.1\|115793_116834_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.5e-93	52.9

DBSCAN-SWA_9

126180 : 132118

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298885.1\|126180_128934_-	DNA polymerase I	A0A218MKQ4	uncultured_virus	4.0e-73	32.0
WP_006399443.1\|128935_129694_+	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	3.0e-23	38.4
WP_140401781.1\|129635_129908_+	hypothetical protein	NA	NA	NA	NA
WP_006404136.1\|130050_130320_+	hypothetical protein	NA	NA	NA	NA
WP_053298886.1\|130487_130979_+	DUF523 domain-containing protein	NA	NA	NA	NA
WP_081000731.1\|131734_132118_+	type II toxin-antitoxin system death-on-curing family toxin	A0A222YZ88	Escherichia_phage	1.7e-19	43.2

DBSCAN-SWA_10

142905 : 143607

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404145.1\|142905_143607_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.4e-19	31.3

DBSCAN-SWA_11

155651 : 156383

Bordetella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404159.1\|155651_156383_+	metallophosphoesterase	A0A291L9W7	Bordetella_phage	4.2e-38	38.9

DBSCAN-SWA_12

177608 : 182413

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399390.1\|177608_179021_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	2.3e-77	39.5
WP_035488198.1\|179082_180456_-	undecaprenyl-phosphate glucose phosphotransferase	NA	NA	NA	NA
WP_006404181.1\|180886_182413_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	5.6e-45	27.4

DBSCAN-SWA_13

197747 : 213560

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404200.1\|197747_198629_-	Dyp-type peroxidase	S4VXK8	Pandoravirus	1.6e-15	29.6
WP_125902498.1\|198884_199094_-	hypothetical protein	NA	NA	NA	NA
WP_045593508.1\|199073_200936_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.7e-28	26.7
WP_053297862.1\|201090_202332_-	voltage-gated chloride channel family protein	A0A1X9I5Z9	Streptococcus_phage	1.9e-35	34.1
WP_088924489.1\|202586_203612_-	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_006404206.1\|203608_205909_-	hybrid sensor histidine kinase/response regulator	Q56AR1	Bacillus_thuringiensis_phage	3.4e-09	27.9
WP_053297863.1\|205905_206637_-	purine-binding chemotaxis protein CheW	NA	NA	NA	NA
WP_150331589.1\|206683_208123_-	MCP methyltransferase	NA	NA	NA	NA
WP_053297865.1\|208119_208632_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_006404210.1\|208628_210305_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-13	29.5
WP_006404211.1\|210422_211556_-	hybrid sensor histidine kinase/response regulator	NA	NA	NA	NA
WP_006404212.1\|211740_211953_-	hypothetical protein	NA	NA	NA	NA
WP_006404213.1\|211976_213560_-	Na+/H+ antiporter	A0A2H4J178	uncultured_Caudovirales_phage	5.9e-13	32.0

DBSCAN-SWA_14

217227 : 217848

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035487939.1\|217227_217545_+	type II toxin-antitoxin system RelE/ParE family toxin	A4JWV2	Burkholderia_virus	3.7e-23	50.5
WP_006398012.1\|217548_217848_+	putative addiction module antidote protein	A0A141GEX5	Brucella_phage	2.4e-16	46.4

DBSCAN-SWA_15

243781 : 245763

Serratia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081000636.1\|243781_244243_-	TIGR02594 family protein	A0A249Y3Q7	Serratia_phage	9.4e-28	43.4
WP_006404243.1\|244467_245763_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.0e-59	36.2

DBSCAN-SWA_16

255114 : 260207

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404257.1\|255114_255864_+	glucose 1-dehydrogenase	W8CYX9	Bacillus_phage	4.6e-08	39.1
WP_150331588.1\|255929_257258_+	MFS transporter	NA	NA	NA	NA
WP_053297883.1\|257294_258140_+	transketolase	G9E5U1	Micromonas_pusilla_virus	2.8e-09	34.2
WP_035947847.1\|258136_259135_+	transketolase family protein	NA	NA	NA	NA
WP_006404261.1\|259295_260207_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	8.5e-73	47.1

DBSCAN-SWA_17

263309 : 265172

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297885.1\|263309_265172_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-10	31.9

DBSCAN-SWA_18

268593 : 269361

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397959.1\|268593_269361_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.4e-12	30.9

DBSCAN-SWA_19

278827 : 283129

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297894.1\|278827_280360_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.8e-12	34.9
WP_053297895.1\|280467_281538_+	FUSC family protein	NA	NA	NA	NA
WP_006404277.1\|281525_281786_+	hypothetical protein	NA	NA	NA	NA
WP_006397943.1\|281791_283129_+	argininosuccinate synthase	A0A140XAJ5	Dickeya_phage	8.1e-56	84.1

DBSCAN-SWA_20

303559 : 305716

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297900.1\|303559_305716_-	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	5.4e-17	26.4

DBSCAN-SWA_21

311566 : 315540

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006411799.1\|311566_312235_-	O-methyltransferase	S5YRC3	Mycobacterium_phage	9.7e-34	42.5
WP_053297904.1\|312368_313664_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A0B5JD48	Pandoravirus	2.6e-14	28.5
WP_053297905.1\|313719_314895_-	phosphotransferase	NA	NA	NA	NA
WP_006404298.1\|314928_315540_-	nicotinamide mononucleotide transporter	I6W764	Vibriophage	6.4e-08	23.7

DBSCAN-SWA_22

324600 : 325581

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297910.1\|324600_325581_+	alpha/beta fold hydrolase	A0A1D8EUH4	Mycobacterium_phage	1.1e-06	28.7

DBSCAN-SWA_23

339008 : 342794

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331584.1\|339008_340388_+	FAD-containing oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	3.4e-57	30.8
WP_006404326.1\|340540_341419_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_081000643.1\|341465_341660_+	hypothetical protein	NA	NA	NA	NA
WP_006404328.1\|341711_342794_+	ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	2.9e-27	33.6

DBSCAN-SWA_24

363098 : 364433

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297932.1\|363098_364433_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	2.2e-45	31.6

DBSCAN-SWA_25

384428 : 386050

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404373.1\|384428_385193_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-09	22.1
WP_053297944.1\|385189_386050_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.5e-12	26.1

DBSCAN-SWA_26

396864 : 440339

Burkholderia_phage(91.49%)

plate,integrase,terminase,transposase,head,tail,capsid

attL 400597:400615|attR 436264:436282

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408809.1\|396864_398664_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-31	30.0
WP_053297952.1\|398660_400391_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-30	33.5
400597:400615	attL	NA	NA	NA	NA
WP_150331581.1\|400689_401922_-\|head	phage head morphogenesis protein	B5TA65	Burkholderia_phage	7.7e-210	84.9
WP_105822516.1\|401922_402183_-	hypothetical protein	B5TA66	Burkholderia_phage	6.2e-29	83.7
WP_150331580.1\|402227_403760_-	DUF935 family protein	B5TA67	Burkholderia_phage	7.5e-247	88.1
WP_150331579.1\|403749_405366_-\|terminase	phage terminase large subunit	B5TA68	Burkholderia_phage	3.0e-312	95.3
WP_105822513.1\|405372_405870_-	DUF1804 family protein	B5TA69	Burkholderia_phage	1.3e-83	96.4
WP_105822512.1\|405873_406164_-	hypothetical protein	B5TA70	Burkholderia_phage	2.2e-30	74.0
WP_150331604.1\|406150_406381_-	hypothetical protein	B5TA71	Burkholderia_phage	5.0e-30	91.4
WP_105822511.1\|406491_406953_-	hypothetical protein	NA	NA	NA	NA
WP_150331578.1\|406949_407621_-	transglycosylase SLT domain-containing protein	B5TA73	Burkholderia_phage	1.5e-98	79.3
WP_150331577.1\|407617_407935_-	hypothetical protein	B5TA74	Burkholderia_phage	2.4e-38	70.2
WP_105799267.1\|408051_408324_-	hypothetical protein	NA	NA	NA	NA
WP_045602010.1\|408320_408803_-	DUF2778 domain-containing protein	NA	NA	NA	NA
WP_150377823.1\|408841_409540_-	hypothetical protein	NA	NA	NA	NA
WP_150331575.1\|409564_410101_-	hypothetical protein	B5TA76	Burkholderia_phage	8.3e-60	66.9
WP_045602013.1\|410144_410645_-	helix-turn-helix transcriptional regulator	K4NXA8	Burkholderia_phage	1.3e-11	35.3
WP_045602015.1\|410709_410901_+	DNA-binding protein	B5TA78	Burkholderia_phage	6.0e-21	76.3
WP_150331574.1\|410897_411944_+	hypothetical protein	B5TA79	Burkholderia_phage	4.8e-136	76.5
WP_150331573.1\|412461_414087_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	B5TA80	Burkholderia_phage	8.3e-305	95.4
WP_045602021.1\|414096_415089_+	AAA family ATPase	B5TA81	Burkholderia_phage	2.4e-174	93.9
WP_105822537.1\|415096_415285_+	hypothetical protein	B5TA82	Burkholderia_phage	1.1e-14	69.4
WP_105822505.1\|415281_415587_+	hypothetical protein	B5TA83	Burkholderia_phage	1.6e-39	87.1
WP_105822504.1\|415573_416161_+	hypothetical protein	B5TA84	Burkholderia_phage	4.9e-82	91.2
WP_105822503.1\|416157_416784_+	DUF3164 family protein	B5TA85	Burkholderia_phage	1.1e-103	93.3
WP_045602029.1\|416794_417187_+	hypothetical protein	B5TA86	Burkholderia_phage	1.8e-67	94.6
WP_045602031.1\|417249_417522_+	HU family DNA-binding protein	B5TA87	Burkholderia_phage	1.1e-36	93.3
WP_150331572.1\|417597_417882_+	hypothetical protein	B5TA88	Burkholderia_phage	1.0e-08	66.0
WP_105842239.1\|418045_418369_+	hypothetical protein	B5TA89	Burkholderia_phage	2.0e-48	87.6
WP_045602036.1\|418370_418811_+	regulatory protein GemA	B5TA90	Burkholderia_phage	9.4e-70	92.5
WP_105822501.1\|418807_419206_+	hypothetical protein	B5TA91	Burkholderia_phage	5.5e-69	98.5
WP_150331571.1\|419419_420574_+	hypothetical protein	B5TA92	Burkholderia_phage	1.5e-191	88.4
WP_105822499.1\|420608_420965_+	DUF2190 family protein	B5TA94	Burkholderia_phage	3.2e-44	83.1
WP_150331570.1\|421016_421964_+\|capsid	phage capsid protein	B5TA95	Burkholderia_phage	2.0e-165	93.0
WP_150331569.1\|422037_422415_+	hypothetical protein	B5TA96	Burkholderia_phage	1.2e-09	62.3
WP_150331568.1\|422411_422915_+	DUF1320 family protein	B5TA97	Burkholderia_phage	2.3e-88	92.8
WP_105822496.1\|422911_423346_+	virion morphogenesis protein	B5TA98	Burkholderia_phage	1.7e-55	75.7
WP_150331567.1\|423345_423966_+	hypothetical protein	B5TA99	Burkholderia_phage	1.5e-52	54.9
WP_105822493.1\|424272_425751_+\|tail	phage tail protein	B5TAA1	Burkholderia_phage	1.2e-220	76.0
WP_105842231.1\|425798_426170_+	hypothetical protein	B5TAA2	Burkholderia_phage	1.1e-47	73.2
WP_150331566.1\|426259_426808_+	hypothetical protein	B5TAA3	Burkholderia_phage	1.9e-64	70.1
WP_150331565.1\|426856_429532_+\|tail	phage tail tape measure protein	B5TAA4	Burkholderia_phage	5.3e-216	61.1
WP_150331564.1\|429535_430912_+	multidrug DMT transporter	B5TAA5	Burkholderia_phage	2.0e-195	76.9
WP_150331563.1\|430915_432082_+	hypothetical protein	B5TAA6	Burkholderia_phage	5.4e-181	78.5
WP_150331562.1\|432078_432594_+\|plate	baseplate assembly protein	B5TAA7	Burkholderia_phage	2.6e-50	58.5
WP_105799272.1\|432679_433267_+\|tail	phage tail protein	B5TAA8	Burkholderia_phage	2.3e-79	70.6
WP_150331561.1\|433263_434385_+\|plate	baseplate J/gp47 family protein	B5TAA9	Burkholderia_phage	7.3e-151	72.9
WP_150331560.1\|434384_434981_+	DUF2313 domain-containing protein	B5TAB0	Burkholderia_phage	1.2e-59	61.2
WP_150331559.1\|434993_435839_+	hypothetical protein	B5TAB2	Burkholderia_phage	1.6e-12	44.1
WP_150331558.1\|435841_436276_+\|tail	tail fiber assembly protein	A4JWL9	Burkholderia_virus	4.0e-28	50.9
WP_053297953.1\|436441_437425_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
436264:436282	attR	NA	NA	NA	NA
WP_053297954.1\|437582_440339_-	hsp70 family protein	G8DDB7	Micromonas_pusilla_virus	8.4e-07	28.0

DBSCAN-SWA_27

470455 : 472543

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297969.1\|470455_472543_+	filamentous hemagglutinin N-terminal domain-containing protein	A0A0R6PJK4	Moraxella_phage	6.4e-23	31.6

DBSCAN-SWA_28

509159 : 512218

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053297988.1\|509159_509693_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.0e-25	44.1
WP_053298004.1\|509733_510231_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_053297989.1\|510388_512218_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	9.2e-143	44.4

DBSCAN-SWA_29

533215 : 534937

Ostreococcus_tauri_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298007.1\|533215_534937_-	ubiquinone-dependent pyruvate dehydrogenase	E4WLQ6	Ostreococcus_tauri_virus	3.6e-24	21.5

DBSCAN-SWA_30

544227 : 558777

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298016.1\|544227_547233_-	response regulator	A0A1V0SGX0	Hokovirus	1.3e-40	29.6
WP_006404485.1\|547336_548011_-	response regulator transcription factor	NA	NA	NA	NA
WP_006404487.1\|548309_548516_-	hypothetical protein	NA	NA	NA	NA
WP_045593093.1\|548618_551708_-	response regulator	A0A1V0SGX0	Hokovirus	7.7e-33	36.9
WP_053298017.1\|552384_553257_+	response regulator	NA	NA	NA	NA
WP_006404491.1\|553295_553796_+	molybdopterin-dependent oxidoreductase	NA	NA	NA	NA
WP_053298018.1\|553792_555598_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	4.5e-25	23.6
WP_053298019.1\|555655_556075_-	YjbQ family protein	NA	NA	NA	NA
WP_006397679.1\|556095_556422_-	thioredoxin family protein	NA	NA	NA	NA
WP_053298020.1\|556615_557344_+	flavin reductase family protein	NA	NA	NA	NA
WP_053298021.1\|557340_558777_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.2e-26	28.1

DBSCAN-SWA_31

561925 : 563669

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298023.1\|561925_562705_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	9.0e-39	38.6
WP_053298032.1\|562829_563669_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.4e-13	30.2

DBSCAN-SWA_32

570428 : 571823

Cafeteria_roenbergensis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298027.1\|570428_571823_+	ATP-dependent RNA helicase DbpA	E3T5E1	Cafeteria_roenbergensis_virus	7.4e-44	31.4

DBSCAN-SWA_33

577814 : 578768

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397631.1\|577814_578768_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	7.2e-06	27.2

DBSCAN-SWA_34

584730 : 586751

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298036.1\|584730_586353_-	chaperonin GroEL	A0A240F779	uncultured_virus	5.1e-177	61.2
WP_006404526.1\|586433_586751_-	co-chaperone GroES	A0A221S322	uncultured_virus	3.0e-17	46.8

DBSCAN-SWA_35

590372 : 592748

Halovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065495767.1\|590372_592748_+	DNA polymerase II	L7TKF2	Halovirus	7.0e-26	25.6

DBSCAN-SWA_36

604622 : 605822

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410219.1\|604622_605822_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.4e-22	32.8

DBSCAN-SWA_37

621058 : 623217

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298051.1\|621058_621844_-	3-oxoadipate enol-lactonase	A0A249XTE1	Mycobacterium_phage	1.4e-07	35.2
WP_053298052.1\|621861_623217_-	3-carboxy-cis,cis-muconate cycloisomerase	A0A1B3B081	Gordonia_phage	8.6e-05	28.7

DBSCAN-SWA_38

627237 : 627867

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404580.1\|627237_627867_+	GTP cyclohydrolase I FolE	A0A2I7S8W4	Vibrio_phage	1.0e-45	46.0

DBSCAN-SWA_39

639671 : 640394

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298060.1\|639671_640394_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	9.6e-11	38.8

DBSCAN-SWA_40

653684 : 655926

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404640.1\|653684_654713_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.3e-16	74.5
WP_006404641.1\|654726_655926_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.3e-33	28.8

DBSCAN-SWA_41

663986 : 667823

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397552.1\|663986_664649_-	AAA family ATPase	K7R2R7	Vibrio_phage	4.2e-21	29.8
WP_006404647.1\|666015_666372_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	5.7e-17	48.2
WP_150331552.1\|666636_666993_-	hypothetical protein	NA	NA	NA	NA
WP_006404649.1\|667271_667823_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	1.5e-16	31.5

DBSCAN-SWA_42

671573 : 672512

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404652.1\|671573_672512_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.3e-17	34.8

DBSCAN-SWA_43

701469 : 703038

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404670.1\|701469_703038_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.6e-13	36.6

DBSCAN-SWA_44

709327 : 713470

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298084.1\|709327_713470_-	PAS domain S-box protein	W8CYF6	Bacillus_phage	3.0e-16	28.1

DBSCAN-SWA_45

719012 : 720161

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298086.1\|719012_720161_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	1.3e-22	34.8

DBSCAN-SWA_46

734365 : 735913

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298094.1\|734365_735913_+	L-arabinose ABC transporter ATP-binding protein AraG	G3M9Y6	Bacillus_virus	2.0e-13	27.2

DBSCAN-SWA_47

764915 : 766046

Edwardsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407846.1\|764915_766046_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VT43	Edwardsiella_phage	3.1e-80	47.0

DBSCAN-SWA_48

792150 : 793671

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407878.1\|792150_793671_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	4.5e-42	28.9

DBSCAN-SWA_49

798413 : 800422

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006407882.1\|798413_799406_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-15	32.9
WP_150331548.1\|799306_800422_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.6e-15	27.8

DBSCAN-SWA_50

832423 : 843626

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298132.1\|832423_834043_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	4.6e-13	29.2
WP_053298133.1\|834015_835125_-	N-acylglucosamine 2-epimerase	NA	NA	NA	NA
WP_006407913.1\|835237_835933_+	methyltransferase	G3MA03	Bacillus_virus	9.2e-19	44.2
WP_053298134.1\|836017_837472_+	hypothetical protein	NA	NA	NA	NA
WP_053298135.1\|837919_838399_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_081000661.1\|838493_841793_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.3e-114	38.0
WP_081000662.1\|842021_842210_-	hypothetical protein	NA	NA	NA	NA
WP_035489106.1\|842198_843626_+	DUF1254 domain-containing protein	A0A1J0FA30	Only_Syngen_Nebraska_virus	1.2e-20	24.1

DBSCAN-SWA_51

853630 : 858264

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298138.1\|853630_854920_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-26	37.9
WP_053298139.1\|854916_855804_+	proline/glycine betaine ABC transporter permease	NA	NA	NA	NA
WP_006406659.1\|855958_856840_+	glycine betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053298140.1\|856968_858264_+	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	3.6e-101	54.0

DBSCAN-SWA_52

892393 : 893236

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298154.1\|892393_893236_-	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.1e-05	24.2

DBSCAN-SWA_53

906193 : 907582

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035945687.1\|906193_907582_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	2.6e-142	65.1

DBSCAN-SWA_54

911246 : 912053

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006408756.1\|911246_912053_-	2,5-didehydrogluconate reductase DkgB	A0A2H4PQR8	Staphylococcus_phage	4.3e-36	34.2

DBSCAN-SWA_55

915827 : 917303

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298161.1\|915827_917303_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	1.2e-73	33.7

DBSCAN-SWA_56

921379 : 926964

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397279.1\|921379_922702_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.9e-73	41.5
WP_006397278.1\|922727_923513_-	IclR family transcriptional regulator	NA	NA	NA	NA
WP_035489202.1\|923768_924971_+	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_053298168.1\|925419_926964_+	PAS domain-containing methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.2e-40	52.7

DBSCAN-SWA_57

937586 : 938447

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397264.1\|937586_938447_+	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	1.3e-19	29.8

DBSCAN-SWA_58

962022 : 963201

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298181.1\|962022_963201_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.0e-30	35.2

DBSCAN-SWA_59

994385 : 995480

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105775558.1\|994385_995480_+	2-aminoethylphosphonate ABC transport system ATP-binding subunit PhnT	G3M9Y6	Bacillus_virus	3.6e-25	32.2

DBSCAN-SWA_60

999990 : 1000542

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298200.1\|999990_1000542_+	HD domain-containing protein	A0A2K9L4U0	Tupanvirus	3.2e-22	35.1

DBSCAN-SWA_61

1015662 : 1017003

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402847.1\|1015662_1017003_-	MHS family MFS transporter	Q6JIH2	Burkholderia_virus	3.6e-35	31.7

DBSCAN-SWA_62

1020541 : 1024837

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405922.1\|1020541_1022131_+	S8/S53 family peptidase	A0A1V0SLL0	Klosneuvirus	4.0e-86	42.0
WP_006410336.1\|1022203_1023880_+	peptidase S1	NA	NA	NA	NA
WP_053298207.1\|1023958_1024837_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	7.7e-63	48.0

DBSCAN-SWA_63

1046685 : 1048751

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006396259.1\|1046685_1047426_+	response regulator	W8CYM9	Bacillus_phage	5.7e-27	33.9
WP_006396260.1\|1047422_1048751_+	HAMP domain-containing protein	A0A1V0SGX0	Hokovirus	3.6e-11	27.9

DBSCAN-SWA_64

1056032 : 1057640

Pike_perch_iridovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298215.1\|1056032_1057640_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.3e-20	55.3

DBSCAN-SWA_65

1083285 : 1084383

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080596181.1\|1083285_1084383_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-27	34.4

DBSCAN-SWA_66

1091465 : 1097575

Escherichia_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298227.1\|1091465_1092437_-	SDR family oxidoreductase	A0A2C9DSV6	Western_grey_kangaroopox_virus	2.3e-07	32.6
WP_006396302.1\|1092474_1093251_-	hydroxypyruvate isomerase family protein	NA	NA	NA	NA
WP_006396303.1\|1093312_1094638_-	MFS transporter	NA	NA	NA	NA
WP_053298228.1\|1094741_1095383_-	aldolase	A0A077SK32	Escherichia_phage	4.6e-41	48.6
WP_006405979.1\|1095379_1096666_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	4.7e-93	48.2
WP_053298229.1\|1096684_1097575_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.4e-80	58.8

DBSCAN-SWA_67

1108863 : 1116586

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065496056.1\|1108863_1109802_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.5e-11	32.9
WP_053298232.1\|1109798_1110977_-	ABC transporter permease	NA	NA	NA	NA
WP_006411484.1\|1110973_1111897_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_053298233.1\|1112064_1112994_+	2-hydroxyacid dehydrogenase	A0A285PXZ1	Cedratvirus	6.5e-20	32.7
WP_006405990.1\|1113048_1113531_+	peroxiredoxin	NA	NA	NA	NA
WP_053298234.1\|1113598_1116586_-	non-ribosomal peptide synthetase	A0A2K9KZV5	Tupanvirus	1.6e-51	28.7

DBSCAN-SWA_68

1137222 : 1143916

Staphylococcus_phage(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406013.1\|1137222_1138167_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-21	32.2
WP_006406015.1\|1138596_1140297_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	2.2e-50	29.7
WP_053298241.1\|1140319_1141789_-	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_006396347.1\|1141819_1142404_-	transcriptional regulator BetI	NA	NA	NA	NA
WP_081000669.1\|1142449_1142707_-	hypothetical protein	NA	NA	NA	NA
WP_006396349.1\|1142719_1143916_+	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	1.7e-12	28.1

DBSCAN-SWA_69

1151602 : 1152877

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410995.1\|1151602_1152877_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.0e-104	53.9

DBSCAN-SWA_70

1166356 : 1171447

Serratia_phage(50.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298249.1\|1166356_1167544_+	ADP-ribosylglycohydrolase family protein	A0A1S6UB21	Serratia_phage	2.8e-60	44.5
WP_053298250.1\|1167731_1168607_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_053298251.1\|1168765_1169683_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006406040.1\|1169691_1169934_-	hypothetical protein	NA	NA	NA	NA
WP_006406041.1\|1169911_1171447_+\|holin	choline-sulfatase	A0A2K9L727	Tupanvirus	7.7e-26	29.1

DBSCAN-SWA_71

1178127 : 1178811

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409129.1\|1178127_1178811_+	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	1.4e-19	32.5

DBSCAN-SWA_72

1198670 : 1201004

Mollivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406070.1\|1198670_1199447_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	1.2e-06	27.6
WP_053298266.1\|1199465_1201004_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-18	29.3

DBSCAN-SWA_73

1220289 : 1223366

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406089.1\|1220289_1221558_+	diguanylate cyclase	G3MA91	Bacillus_virus	3.5e-16	35.5
WP_053298282.1\|1221635_1222115_+	OmpA family protein	NA	NA	NA	NA
WP_053298275.1\|1222238_1223366_-	alanine--glyoxylate aminotransferase family protein	A0A0N9QIZ2	Chrysochromulina_ericina_virus	3.0e-83	41.9

DBSCAN-SWA_74

1228443 : 1229918

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406097.1\|1228443_1229217_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.7e-13	30.3
WP_006396443.1\|1229216_1229918_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-16	30.0

DBSCAN-SWA_75

1241464 : 1242766

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406107.1\|1241464_1242766_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	9.3e-65	37.6

DBSCAN-SWA_76

1245913 : 1247831

Clostridium_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298285.1\|1245913_1246990_-	Abi family protein	A3QSC6	Clostridium_virus	4.4e-20	28.8
WP_006406114.1\|1247057_1247831_-	slipin family protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	5.8e-22	29.2

DBSCAN-SWA_77

1251981 : 1253688

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410597.1\|1251981_1253688_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	6.3e-53	32.8

DBSCAN-SWA_78

1259361 : 1260900

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298291.1\|1259361_1260900_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.6e-31	29.9

DBSCAN-SWA_79

1270489 : 1274769

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406136.1\|1270489_1271197_+	response regulator	W8CYM9	Bacillus_phage	2.0e-29	32.3
WP_053298297.1\|1271267_1272398_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_081000674.1\|1272411_1274769_-	BamA/TamA family outer membrane protein	A0A1V0SFX9	Hokovirus	4.2e-07	23.8

DBSCAN-SWA_80

1280360 : 1283260

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298299.1\|1280360_1281269_+	PenA family class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	8.7e-78	58.4
WP_081000675.1\|1281290_1281470_+	hypothetical protein	NA	NA	NA	NA
WP_081000677.1\|1281481_1281802_-	hypothetical protein	NA	NA	NA	NA
WP_053298300.1\|1281889_1283260_-	HAMP domain-containing protein	Q8QNA2	Ectocarpus_siliculosus_virus	1.2e-06	32.4

DBSCAN-SWA_81

1305148 : 1307377

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298308.1\|1305148_1307377_+	type I secretion system permease/ATPase	F2Y2R6	Organic_Lake_phycodnavirus	9.5e-17	28.8

DBSCAN-SWA_82

1312299 : 1314075

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298314.1\|1312299_1314075_-	response regulator	Q8QNA2	Ectocarpus_siliculosus_virus	7.8e-14	29.7

DBSCAN-SWA_83

1317610 : 1318558

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298317.1\|1317610_1318558_+	3-phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	1.6e-21	30.3

DBSCAN-SWA_84

1341185 : 1341404

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006406207.1\|1341185_1341404_+	DUF1653 domain-containing protein	A0A1P8CX21	Bacillus_phage	6.2e-06	55.1

DBSCAN-SWA_85

1364723 : 1366691

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298342.1\|1364723_1366691_+	asparagine synthase (glutamine-hydrolyzing)	G8DDK6	Micromonas_pusilla_virus	3.2e-24	29.5

DBSCAN-SWA_86

1386593 : 1392719

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298348.1\|1386593_1389236_-	glycosyltransferase	M1HPG6	Paramecium_bursaria_Chlorella_virus	1.3e-73	40.4
WP_053298349.1\|1389268_1390690_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.2e-74	38.2
WP_006408420.1\|1390725_1391715_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	6.7e-39	34.7
WP_006408419.1\|1391711_1392719_-	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	1.9e-73	42.9

DBSCAN-SWA_87

1396280 : 1397771

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298351.1\|1396280_1397771_+	hypothetical protein	B2ZXU0	Ralstonia_phage	1.7e-06	33.9

DBSCAN-SWA_88

1407038 : 1408559

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298356.1\|1407038_1408559_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-18	30.1

DBSCAN-SWA_89

1417354 : 1418038

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409924.1\|1417354_1418038_-	Fe2+-dependent dioxygenase	Q5GQB0	Synechococcus_phage	3.4e-18	32.6

DBSCAN-SWA_90

1422133 : 1423429

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035487510.1\|1422133_1423429_-	aspartate carbamoyltransferase	Q84489	Paramecium_bursaria_Chlorella_virus	2.5e-46	38.0

DBSCAN-SWA_91

1441272 : 1446406

Rhodococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035947687.1\|1441272_1442148_+	zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	2.7e-36	34.8
WP_053298373.1\|1442567_1443302_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_053298374.1\|1443520_1445023_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_053298375.1\|1445065_1446406_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	4.2e-20	26.7

DBSCAN-SWA_92

1462242 : 1463595

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012216741.1\|1462242_1463595_+	nitrate/sulfonate/bicarbonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-31	38.5

DBSCAN-SWA_93

1469618 : 1472300

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298388.1\|1469618_1472300_+	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	3.0e-86	31.8

DBSCAN-SWA_94

1476994 : 1479523

Ralstonia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331536.1\|1476994_1479523_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.6e-76	33.0

DBSCAN-SWA_95

1484743 : 1485025

Ralstonia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105757250.1\|1484743_1485025_+	PAAR domain-containing protein	A4PE23	Ralstonia_virus	5.0e-08	40.7

DBSCAN-SWA_96

1495579 : 1501329

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298491.1\|1495579_1496341_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.9e-11	32.7
WP_053298398.1\|1496380_1496860_-	redox-sensitive transcriptional activator SoxR	NA	NA	NA	NA
WP_053298399.1\|1496939_1498142_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053298492.1\|1498155_1501329_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.2e-59	22.6

DBSCAN-SWA_97

1505880 : 1507326

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331529.1\|1505880_1507326_+	MFS transporter	Q6JIH2	Burkholderia_virus	3.0e-80	42.3

DBSCAN-SWA_98

1513259 : 1513910

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012216771.1\|1513259_1513910_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.1e-42	47.1

DBSCAN-SWA_99

1538390 : 1541453

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403201.1\|1538390_1539098_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	5.3e-14	40.0
WP_006403202.1\|1539559_1540708_+	metallophosphoesterase	NA	NA	NA	NA
WP_053298415.1\|1540841_1541453_+	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2K9L4C1	Tupanvirus	6.4e-24	36.0

DBSCAN-SWA_100

1549632 : 1550430

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298419.1\|1549632_1550430_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.8e-08	25.4

DBSCAN-SWA_101

1587610 : 1589170

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006409765.1\|1587610_1589170_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.6e-08	28.9

DBSCAN-SWA_102

1598089 : 1599780

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298443.1\|1598089_1598920_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-24	33.3
WP_053298444.1\|1598916_1599780_-	ABC transporter permease	G3M9Y4	Bacillus_virus	1.5e-18	26.9

DBSCAN-SWA_103

1615459 : 1621116

Planktothrix_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403272.1\|1615459_1616314_+	peptidoglycan DD-metalloendopeptidase family protein	A0A292GJG6	Xanthomonas_phage	1.1e-13	39.3
WP_053298497.1\|1616524_1617421_+	class A beta-lactamase	A0A1B0VBP7	Salmonella_phage	1.3e-60	47.7
WP_035487593.1\|1617528_1618401_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-25	28.7
WP_053298450.1\|1618426_1618753_-	type 1 fimbrial protein	NA	NA	NA	NA
WP_006403276.1\|1619080_1619335_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_006403280.1\|1619452_1620214_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-22	35.6
WP_006403282.1\|1620210_1621116_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-06	25.6

DBSCAN-SWA_104

1643020 : 1652199

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006410280.1\|1643020_1645783_-	magnesium-translocating P-type ATPase	M1HLC0	Paramecium_bursaria_Chlorella_virus	1.1e-35	23.8
WP_053298459.1\|1646473_1648117_-	S8 family peptidase	A0A127AWU5	Bacillus_phage	1.4e-17	32.0
WP_081000693.1\|1648072_1648258_+	hypothetical protein	NA	NA	NA	NA
WP_006410345.1\|1648384_1649281_+	glutamate/aspartate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006410349.1\|1649265_1649511_-	hypothetical protein	NA	NA	NA	NA
WP_006410350.1\|1649759_1650602_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_065496445.1\|1650696_1652199_+	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	4.4e-34	39.1

DBSCAN-SWA_105

1672938 : 1674252

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403394.1\|1672938_1674252_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.7e-74	39.3

DBSCAN-SWA_106

1730447 : 1732637

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298484.1\|1730447_1732637_+	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	1.6e-08	23.2

DBSCAN-SWA_107

1749719 : 1754980

uncultured_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331524.1\|1749719_1750979_+\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-44	45.0
WP_150331601.1\|1752271_1754980_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	2.4e-54	23.6

DBSCAN-SWA_108

1768250 : 1779975

Bacillus_virus(20.0%)

integrase

attL 1759785:1759801|attR 1779318:1779334

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1759785:1759801	attL	NA	NA	NA	NA
WP_053298505.1\|1768250_1770200_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.7e-22	32.8
WP_006412370.1\|1770374_1770677_-	DUF4148 domain-containing protein	NA	NA	NA	NA
WP_006396970.1\|1770955_1771216_-	hypothetical protein	NA	NA	NA	NA
WP_053298506.1\|1771321_1773010_-	metallophosphoesterase family protein	NA	NA	NA	NA
WP_053298507.1\|1773164_1774436_-\|integrase	tyrosine-type recombinase/integrase	A0A142KCU7	Gordonia_phage	2.1e-05	29.3
WP_053298508.1\|1774673_1775051_+	DUF4377 domain-containing protein	NA	NA	NA	NA
WP_053298509.1\|1775076_1776465_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_081000694.1\|1776444_1776672_+	hypothetical protein	NA	NA	NA	NA
WP_053298510.1\|1776705_1777542_+	FkbM family methyltransferase	A0A218MM68	uncultured_virus	2.2e-19	29.9
WP_053298511.1\|1777848_1778052_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	2.7e-19	67.2
WP_006396979.1\|1778155_1778422_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_053298512.1\|1778550_1779975_-	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.4e-28	31.3
1779318:1779334	attR	NA	NA	NA	NA

DBSCAN-SWA_109

1793230 : 1799192

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045593355.1\|1793230_1795198_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	E5EQ50	Micromonas_sp._RCC1109_virus	4.2e-101	43.9
WP_053298521.1\|1795350_1795818_+	OsmC family protein	NA	NA	NA	NA
WP_006397003.1\|1795888_1797289_-	alpha,alpha-trehalose-phosphate synthase (UDP-forming)	NA	NA	NA	NA
WP_006403490.1\|1797557_1799192_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-18	30.3

DBSCAN-SWA_110

1804955 : 1806737

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081000695.1\|1804955_1806737_-	amino acid ABC transporter permease/ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-29	39.7

DBSCAN-SWA_111

1813552 : 1815031

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403507.1\|1813552_1815031_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	3.8e-22	37.2

DBSCAN-SWA_112

1829866 : 1831426

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403522.1\|1829866_1831426_+	D-xylose ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	3.1e-14	28.2

DBSCAN-SWA_113

1863346 : 1868701

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298571.1\|1863346_1865308_-	response regulator	A0A1V0SGX0	Hokovirus	8.6e-22	27.6
WP_053298545.1\|1865736_1866915_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_006411120.1\|1866901_1868701_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.0e-08	56.9

DBSCAN-SWA_114

1900316 : 1901114

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006397115.1\|1900316_1901114_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.3e-05	28.6

DBSCAN-SWA_115

1936400 : 1947760

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298583.1\|1936400_1938380_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.2e-08	29.5
WP_053298584.1\|1938402_1940055_-	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	1.8e-33	27.0
WP_053298585.1\|1940230_1940974_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_053298586.1\|1941120_1944288_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.4e-61	22.8
WP_006403628.1\|1944315_1945545_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_053298587.1\|1945541_1947050_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_006403630.1\|1947061_1947760_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	7.0e-35	35.6

DBSCAN-SWA_116

1971961 : 1972762

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298599.1\|1971961_1972762_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-28	33.0

DBSCAN-SWA_117

1981691 : 1982759

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298605.1\|1981691_1982759_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-27	35.6

DBSCAN-SWA_118

1987541 : 1988581

Acidithiobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045593318.1\|1987541_1988117_-	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	2.0e-56	62.1
WP_053298663.1\|1988113_1988581_-	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	9.5e-36	52.6

DBSCAN-SWA_119

2023997 : 2025605

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298618.1\|2023997_2025605_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	6.2e-42	26.6

DBSCAN-SWA_120

2057350 : 2058949

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298667.1\|2057350_2058949_-	aromatic amino acid lyase	A0A1V0S940	Catovirus	3.8e-52	32.5

DBSCAN-SWA_121

2065855 : 2066443

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298639.1\|2065855_2066443_+	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	4.4e-22	35.9

DBSCAN-SWA_122

2084875 : 2091105

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298668.1\|2084875_2086819_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.7e-23	34.6
WP_150331512.1\|2086844_2087834_-	isoaspartyl peptidase/L-asparaginase	NA	NA	NA	NA
WP_006403766.1\|2087830_2088775_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_053298669.1\|2089083_2091105_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	8.6e-25	26.5

DBSCAN-SWA_123

2118291 : 2119866

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298655.1\|2118291_2119866_+	sigma-70 family RNA polymerase sigma factor	G8CLC7	Synechococcus_phage	2.8e-31	38.2

DBSCAN-SWA_124

2131559 : 2132781

Enterobacteria_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105775252.1\|2131559_2132781_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	8.0e-18	37.7

DBSCAN-SWA_125

2153399 : 2155223

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331510.1\|2153399_2155223_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	3.2e-135	43.7

DBSCAN-SWA_126

2164098 : 2169589

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298685.1\|2164098_2165697_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	3.5e-37	31.7
WP_150331599.1\|2165758_2166463_-	hypothetical protein	NA	NA	NA	NA
WP_053298686.1\|2166610_2167510_-	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	2.1e-31	48.3
WP_053298687.1\|2167635_2168190_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_053298689.1\|2168254_2169589_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.2e-20	23.7

DBSCAN-SWA_127

2173920 : 2176669

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399794.1\|2173920_2174286_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.9e-07	32.2
WP_006403847.1\|2174316_2175273_-	chemotaxis protein CheX	NA	NA	NA	NA
WP_006409692.1\|2175329_2175932_-	hypothetical protein	NA	NA	NA	NA
WP_053298690.1\|2175928_2176669_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.2e-05	35.6

DBSCAN-SWA_128

2182537 : 2186618

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298767.1\|2182537_2184067_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.6e-15	25.5
WP_006399779.1\|2184260_2184665_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_006403857.1\|2184800_2186618_+	sulfoacetaldehyde acetyltransferase	A9YVT5	Ostreococcus_tauri_virus	2.7e-22	22.7

DBSCAN-SWA_129

2190311 : 2196964

Rhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150331508.1\|2190311_2191298_-	AAA domain-containing protein	L7TKP0	Rhizobium_phage	1.6e-37	33.1
WP_053298768.1\|2191486_2192239_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_012217222.1\|2192253_2193201_-	dimethyl sulfoxide reductase anchor subunit	NA	NA	NA	NA
WP_053298696.1\|2193267_2194011_-	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_053298697.1\|2194027_2196964_-	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	1.5e-06	27.0

DBSCAN-SWA_130

2202034 : 2203687

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298699.1\|2202034_2203687_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	6.5e-55	27.8

DBSCAN-SWA_131

2209436 : 2212741

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298703.1\|2209436_2210471_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.0e-18	37.1
WP_006403878.1\|2210491_2212741_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.8e-23	38.0

DBSCAN-SWA_132

2220008 : 2220899

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298708.1\|2220008_2220899_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	5.8e-26	31.8

DBSCAN-SWA_133

2243875 : 2244721

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006411670.1\|2243875_2244721_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.1e-29	33.9

DBSCAN-SWA_134

2254119 : 2255508

environmental_Halophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298743.1\|2254119_2255508_+	uracil-xanthine permease	H9YQ34	environmental_Halophage	1.8e-26	52.4

DBSCAN-SWA_135

2270488 : 2273464

Tunisvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298756.1\|2270488_2271391_-	DUF72 domain-containing protein	V9SDC4	Tunisvirus	2.6e-05	27.0
WP_081000709.1\|2271634_2273464_+	ATP-dependent DNA helicase RecQ	Q9DSV4	Diadromus_pulchellus_ascovirus	6.3e-59	41.7

DBSCAN-SWA_136

2298423 : 2299644

Burkholderia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069221211.1\|2298423_2299644_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	2.8e-228	93.1

DBSCAN-SWA_137

2313039 : 2313960

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298774.1\|2313039_2313960_+	NAD(P)-dependent oxidoreductase	A0A1V0SKV4	Klosneuvirus	2.3e-09	28.0

DBSCAN-SWA_138

2317485 : 2327485

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006403973.1\|2317485_2320050_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.4e-08	25.2
WP_006403974.1\|2320046_2320889_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_053298777.1\|2321018_2322239_+	porin	NA	NA	NA	NA
WP_053298778.1\|2322466_2324281_+	FAD-binding protein	A0A2P0ZL82	Lactobacillus_phage	3.0e-13	25.6
WP_006399641.1\|2324345_2325176_+	aldo/keto reductase	NA	NA	NA	NA
WP_053298779.1\|2325240_2326617_-	MFS transporter	NA	NA	NA	NA
WP_053298780.1\|2326717_2327485_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.9e-18	32.8

DBSCAN-SWA_139

2338776 : 2340702

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298785.1\|2338776_2340702_-	selenocysteine-specific translation elongation factor	A0A2K9KZ60	Tupanvirus	2.0e-15	30.3

DBSCAN-SWA_140

2352312 : 2354659

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006404000.1\|2352312_2353431_+	acyltransferase	B5WZU0	Pseudomonas_phage	1.0e-11	27.4
WP_006399611.1\|2353771_2354659_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.1e-64	44.2

DBSCAN-SWA_141

2363295 : 2365439

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053298806.1\|2363295_2364360_+	acyltransferase	C6ZR20	Salmonella_phage	1.4e-18	29.1
WP_006399600.1\|2364395_2365439_+	GDP-mannose 4,6-dehydratase	M1HGM9	Acanthocystis_turfacea_Chlorella_virus	2.5e-108	56.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044054

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044055

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection