CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	2 crisprs	DinG	6	0
NZ_CP044074	Pseudomonas oryzihabitans strain FDAARGOS_657 chromosome, complete genome	4 crisprs	DinG,DEDDh,csa3,cas3,WYL,RT	0	4
NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	3 crisprs	csa3	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044072_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044072_1

47889-47993

Orphan

Consensus_repeat	Method
AACGACTACAGATTCCGGTA	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP044072_1

>merge|NZ_CP044072|1|47889-47993|PILER-CR
CGACTACAAATTCCGGTAGTCATCGCAGCAATACTTCTCGGTCAACGACTACAGATTACGGCTTGGCCGTCCTCTAACCTGCTGAAACGACTACAGATTCCGGTA

>NZ_CP044072|1|1|47889-47993|PILER-CR
CGACTACAAATTCCGGTAGT	CATCGCAGCAATACTTCTCGGTCAA
CGACTACAGATTACGGCTTG	GCCGTCCTCTAACCTGCTGAAA
CGACTACAGATTCCGGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044072.1\|WP_150338129.1\|51674_52433_+\|DeoR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP044072.1\|WP_074585149.1\|50009_51440_+\|amidase	unknown	unknown	gnl\|CDD\|180437
NZ_CP044072.1\|WP_150338070.1\|58530_60318_+\|allophanate-hydrolase	unknown	unknown	gnl\|CDD\|236177
NZ_CP044072.1\|WP_150338062.1\|40748_41318_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP044072.1\|WP_150338065.1\|52410_53691_+\|hydantoinase/carbamoylase-family-amidase	unknown	unknown	gnl\|CDD\|236456
NZ_CP044072.1\|WP_074585147.1\|45372_46053_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP044072.1\|WP_017638721.1\|56053_57592_+\|sodium:solute-symporter	unknown	unknown	gnl\|CDD\|271357
NZ_CP044072.1\|WP_150338058.1\|33999_35184_-\|outer-membrane-porin,-OprD-family	unknown	unknown	gnl\|CDD\|335381
NZ_CP044072.1\|WP_150338063.1\|41622_42180_+\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|227226
NZ_CP044072.1\|WP_150338128.1\|39901_40558_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198291
NZ_CP044072.1\|WP_150338060.1\|37589_38159_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234994
NZ_CP044072.1\|WP_150338066.1\|53702_54644_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|366736
NZ_CP044072.1\|WP_150338069.1\|57658_58318_+\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP044072.1\|WP_150338057.1\|32827_33616_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP044072.1\|WP_108576311.1\|48648_49512_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP044072.1\|WP_150338061.1\|38428_39592_+\|DUF1173-family-protein	unknown	unknown	gnl\|CDD\|369028
NZ_CP044072.1\|WP_150338068.1\|55811_56057_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044072.1\|WP_150338064.1\|42201_44445_+\|type-III-restriction-endonuclease-subunit-R	unknown	unknown	gnl\|CDD\|227226
NZ_CP044072.1\|WP_150338059.1\|36820_37006_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|367773
NZ_CP044072.1\|WP_150338067.1\|54649_55585_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|270700

Protein	Function_ID	Function_description	E-value
NZ_CP044072.1\|WP_150338129.1\|51674_52433_+\|DeoR-family-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.7991e-84
NZ_CP044072.1\|WP_074585149.1\|50009_51440_+\|amidase	gnl\|CDD\|180437	PRK06169, PRK06169, putative amidase; Provisional.	1.66757e-146
NZ_CP044072.1\|WP_150338070.1\|58530_60318_+\|allophanate-hydrolase	gnl\|CDD\|236177	PRK08186, PRK08186, allophanate hydrolase; Provisional.	0
NZ_CP044072.1\|WP_150338062.1\|40748_41318_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.1604e-12
NZ_CP044072.1\|WP_150338065.1\|52410_53691_+\|hydantoinase/carbamoylase-family-amidase	gnl\|CDD\|236456	PRK09290, PRK09290, allantoate amidohydrolase; Reviewed.	2.20813e-159
NZ_CP044072.1\|WP_074585147.1\|45372_46053_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	3.89003e-36
NZ_CP044072.1\|WP_017638721.1\|56053_57592_+\|sodium:solute-symporter	gnl\|CDD\|271357	cd10322, SLC5sbd, Solute carrier 5 family, sodium/glucose transporters and related proteins; solute-binding domain. This family represents the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporter family or solute sodium symporter family) that co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. Family members include: the human glucose (SGLT1, 2, 4, 5), chiro-inositol (SGLT5), myo-inositol (SMIT), choline (CHT), iodide (NIS), multivitamin (SMVT), and monocarboxylate (SMCT) cotransporters, as well as Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. Vibrio parahaemolyticus Na(+)/galactose cotransporter (vSGLT) has 13 transmembrane helices (TMs): TM-1, an inverted topology repeat: TMs1-5 and TMs6-10, and TMs 11-12 (TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). One member of this family, human SGLT3, has been characterized as a glucose sensor and not a transporter. Members of this family are important in human physiology and disease.	3.75839e-45
NZ_CP044072.1\|WP_150338058.1\|33999_35184_-\|outer-membrane-porin,-OprD-family	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	5.66612e-180
NZ_CP044072.1\|WP_150338063.1\|41622_42180_+\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|227226	COG4889, COG4889, Predicted helicase [General function prediction only].	4.34004e-22
NZ_CP044072.1\|WP_150338128.1\|39901_40558_-\|glutathione-S-transferase	gnl\|CDD\|198291	cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the Saccharomyces cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.	1.75118e-48
NZ_CP044072.1\|WP_150338060.1\|37589_38159_+\|hypothetical-protein	gnl\|CDD\|234994	PRK01973, PRK01973, septum site-determining protein MinC.	0.00526185
NZ_CP044072.1\|WP_150338066.1\|53702_54644_+\|phosphotransferase	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	6.17003e-12
NZ_CP044072.1\|WP_150338069.1\|57658_58318_+\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.92188e-59
NZ_CP044072.1\|WP_150338057.1\|32827_33616_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	2.62819e-51
NZ_CP044072.1\|WP_108576311.1\|48648_49512_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.90201e-60
NZ_CP044072.1\|WP_150338061.1\|38428_39592_+\|DUF1173-family-protein	gnl\|CDD\|369028	pfam06666, DUF1173, Protein of unknown function (DUF1173). This family contains a group of hypothetical bacterial proteins that contain three conserved cysteine residues towards the N-terminal. The function of these proteins is unknown.	4.88916e-71
NZ_CP044072.1\|WP_150338064.1\|42201_44445_+\|type-III-restriction-endonuclease-subunit-R	gnl\|CDD\|227226	COG4889, COG4889, Predicted helicase [General function prediction only].	1.41462e-41
NZ_CP044072.1\|WP_150338059.1\|36820_37006_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|367773	pfam04014, MazE_antitoxin, Antidote-toxin recognition MazE, bacterial antitoxin. AbrB-like is a family of small proteins that operate in conjunction with a cognate toxin molecule. The commonly attributed role of toxin-antitoxin systems is to maintain low-copy number plasmids from one generation to the next. Such gene-pairs are also found on chromosomes and to be associated with a number of biological functions such as: reduction of protein synthesis, gene regulation and retardation of cell growth under nutritional stress. This family includes proteins from a number of different pairings, eg MazE, AbrB, VapB, PhoU, PemI-like and SpoVT. MazE is the antidote to the toxin MazF of E. coli. MazE-MazF in E. coli is a regulated prokaryotic chromosomal addiction module. MazE antidote is degraded by the ClpPA protease of the bacterial proteasome. MazE-MazF is thought to play a role in programmed cell death when cells suffer nutrient deprivation, and MazE-MazF modules have also been implicated in the bacteriostatic effects of other addiction modules.	0.000316299
NZ_CP044072.1\|WP_150338067.1\|54649_55585_+\|phosphotransferase	gnl\|CDD\|270700	cd05151, ChoK-like, Choline Kinase and similar proteins. This subfamily is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate and displays negligible activity towards N-methylated derivatives of Etn. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.49292e-46

>NZ_CP044072.1|WP_074585147.1|45372_46053_+|ParA-family-protein
MSKHAPKRASAYLRRSLVKTVVIASRKGGVGKTTTTEVLGVELARRGNRVMLIDTDPQGSLTEWWQEREIEEPQMSNVPYESLGAALSVLEGEGYNYVLIDTPPESNDVITATVKFADLVIIPVKAGPHDLRAVRQTLTLVKDENKPFVFLLNEVTLNTNITKDVMVALSQHGKLCPPMPRRTIMVEAGIDGRVPQELRPSCSAARDIRKLCDYVLEELEFQQARA
>NZ_CP044072.1|WP_150338064.1|42201_44445_+|type-III-restriction-endonuclease-subunit-R
MGLLPGFAFDLGILDEAHKTAGAAGRRNSFALNDHPTLRIDRRLFLTATPLAIAEEEGPAGTGPIYSMTDEAVFGPVAYELSYSAAVAAGIICDFRVIISVEEGDDEQLAEALEDDERRYAVHAQELLRAMTDVGARKAFAFYSRISQSKRFATALREAVGAGDFWARHIDGSFPSWQRTRLLHQYGRASRAALSCARCLAEGVDVPDTDLIAFMHRRESHVDIVQALGRAVRKAPGKRYGYVLIPLRLKRSSGESLIQAVARSDMSTVWRTLAALAEQDDAMLNEVQRAAVDQGETGQPTSPGWFNKLHVIAPAGRPDAGAWAASLKAVLSTELVGRIAGSWPHFYGLLRAFVTDRGHARVARSYRTPGGHTLGAWCSRQRALHRLGRLAPNRAEQLEAIGFEFDPRKHAWERGYEALRSYLADTGSPSPAVDVVTADGLALGHWCSEQRKAYRLGRLAPRKKQLLEALGFIVSPSDDAWEKRYQALVAFKEEHGHLRVAQRQVLVDGTDLADWCRNQRSRQIDLSRRDRLAALGFDFHAGVLDARWEAAYTALEEFGARQGHVNVPLDFVLPDGTALGTWVGNQRARYRDGQMDQQRIELLNQLGFVWEMFGAAFDQGLQHLEQFEAAHGHCDVPIAYVAGDGYKLGRWCSNQRTRLKDKPDDPDHGRLLAAGFSFDPAEAAWQQHYAALQDYLAANAGASVPVKHVTADGLRLGSWVSRQKTLLKAGKLAHAKHAALRGLGVFS
>NZ_CP044072.1|WP_150338063.1|41622_42180_+|DEAD/DEAH-box-helicase-family-protein
MRTWRRSMEGPLPDMLAPVSAGVSLYAGEHLKRQPIRCDNHPPPLLHHRRLIPMQFSSSLLAPHQLEARARILDGFKRRARLQVHMACGTGKTRLAQGVAAALGARSIVIFLPSLALVSQTLQAWVSNAELDLERVLCVCSDESVATLDDEHEVLEDLPVAVTTSPEEIALKVGALGRDLIVLCT
>NZ_CP044072.1|WP_150338062.1|40748_41318_+|TetR-family-transcriptional-regulator
MTQNAREQILLSAKAAAQLHGYGGINFRTIAEEVGIKNASIYYHFPSKADLGAAVAERYWQETAQVLSELRASHKAPEECLRLYPSIFRKSIENQNRLCLSSFMAAEVEDLPDQVTKEVRAFADVNVEWLVDVLADLDWGSDEERKRRAYAIYTAVAGAQLIARTRQDINLFDELVSSYLEAGLIPARA
>NZ_CP044072.1|WP_150338128.1|39901_40558_-|glutathione-S-transferase
MKIYDWFDGPYPARVRIALAEKGLLPKIEFVSVNLWTGEHKEPEFLAINYSGTLPVLELQDGTRIAECTAITQYLDSLEGSLTLTGETALEKGLIHMMTKRAEIEFLDAVSVYFHHATPGLGPKVELYQNAEWGAKMGEKATRGMCYFDNLLRQQPFVAGDKFSMADIAVIGGMIFASLVKLPVPDECDALRSWYAKIQDRPSYKTWSALVDQGAPAK
>NZ_CP044072.1|WP_150338061.1|38428_39592_+|DUF1173-family-protein
MERAYGREHGLCGCPGSGERKLTIKLREGSDGYHLARYPHSGPEHANDCRFYAAAPQRSGLQGYAVGVVEETADGGMKVRLARGVRQQAPGEAGDAAPSPPAAPGVKKPAMTLLGLLHLLWSESRLTTWYPAMAGKRDGELVSHLLHECVGRVSVAPRIKLDQVLLLAAQKEKRREATNREIATNAASRNWRLVVVSPLARYDEERHSGSPERLPVTGPFGMPTLYLPPAVWETASRRFGRELGAWRRGSRVIAIAQIAQRPGKAHQADVLEVALMQVSEQWIPLDSDLEGKVEQKLRDEDRKFDKPLRYDADECAVFPDFWLLDMQQDFALEVFGMATPQYLERRGTKEQWYCSEYGKTGWWRWDATQDPRGEHIPAFPAAYGSSR
>NZ_CP044072.1|WP_150338060.1|37589_38159_+|hypothetical-protein
MAMSAEPDDAPDWLVQKPRRARPVALVVCLAVGGLATLAALELASRALPGPSASVGTDHPALPAETAAHPAPEPADTVRGTVRRATPSPVEENAAAAATSPSNNQPPAAAIGKQTVFNDRNFTPSGADNVVSFSEASRSLAPEEAPPQPTKVTVVHQTLSMKDRVCWPYKAGSLEHRNCRSAVGLQYRD
>NZ_CP044072.1|WP_150338059.1|36820_37006_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MTQSACTTVKCQDPGDGSGDVIVDLPPDILKEMNLAVGDKLSIELVDSVIVLRPVREPNPE
>NZ_CP044072.1|WP_150338058.1|33999_35184_-|outer-membrane-porin,-OprD-family
MAQEHGFIEDAASTLQMRNFYFNRDFRDSGAPKAKAEEWAQGFLLNAQSGYTQGIVGIGADLIGGLGVKLDSGDGRAGTLLLPNDGDGSADEFSSLGAAAKLKISKTELKVGELLPTLPILQYDDARLLPQTFQGAMLTSKEIPGLTLNAGQMRSFTQRNSSDREDMFIDGRAFATSDRYNYLGSEYRFNQDRTMLGLWGAQLEDIYHQRFIQFTHKQPLGAWTLGANIGLLDSDEDGQANAGQIDNRSFYTALSASVSGHTVMAAWQRMYGDDGTIWLSPTTTVLPSDIQVRNFASAEEKAWQLRYDYNFAAMGIPGLNAFVRYVKGDNVAVAGGNGGNGGKEWERDFDVSYVIQSGPLKNVGLRWRNAMVRSNFGPSVNDKRLIINYSLALF
>NZ_CP044072.1|WP_150338057.1|32827_33616_+|GntR-family-transcriptional-regulator
MRNPTRSSPQLYITIVHWIGEEIRSGRLGAGDQLPTERKLCEQFSVSRTVVREALSLLKSEELISTHQGKGAFVAKRTERHGFRIDHAPCDGETSIKHLLELLMTIEVAATRLAAMRRTSEDVKKMRQALDGMEGAIFEESLGDDAEHQFHKTVLVAAGNPHLKALSEYLGHGIRRMIHDARINMADKYSDDIQLVQDERRAIFLAILAGDPSAAACAASRYLSNVSERLGMAHARKVVQRSGERSTESQHRNKEGADFRGS
>NZ_CP044072.1|WP_108576311.1|48648_49512_+|replication-initiation-protein
MSKVSTSVPDQADPRPIRVTKSNTLITASYRLTLNEQRLILAAISQIDPRKGMPKKISVSALLYSEIYGVQLRHAYEQMKETADVLFEREVKTFDGSAVERKRWVDAARYIAGEGRVELSFTIHVMPYLSRLHTKLTSYDLRRVARLDSTHSFRLFEMLMQFKKTGWAYIEIETLRTALGLSDAYQRFNNLRQRVIDPAVEELRTKSRLDVTYELKREARRVVAIKFMFKDLAQQLPLNLGDEELVPLTEIDLPEDPSLLLASAFEDLSEDDPNFTFPIDVDESGGA
>NZ_CP044072.1|WP_074585149.1|50009_51440_+|amidase
MQKLDLEGVVLDVISSAQRIREGQLTSVTLVQACLKSIKATNPTLRAFGDVYVDHALNQAQLLDAEAREGRFRGPLHGVPFGIKDLFHTAGLRTTRGSLTALDYVPTQDAPIIQRLKAAGGIVLGKTATTEFGWTGASTSRVFGDGRTPWNTSLTSGGSSSGSAIATAAFMVPAALGSDGGGSVRIPSSFCGTFALKGSLGRIPTWPWSATETLSHAGPITRTVRDSALLFDVLSGPDALDHQALPAPTESYLARCDQPLSPLRVAYCPTLFETPVHPEVAAGVDAAVDILARQLPLEVERLTLDWRDPLTTFETLWVAGRGIAYGKTLGGRLGELDPGFATLIEKARQYDLADYLAASQQRAMFANQVHALFESYDLLLLPTLPILPFPAHLTGPEEGYEAAGSGTPWARWTPFTYPFNLSGNPAASLPCAWSADELPIGLQVVGPRHADAAVLQFCAAVEALLPWAHRVPPLLR
>NZ_CP044072.1|WP_150338129.1|51674_52433_+|DeoR-family-transcriptional-regulator
MLNQPRLDEILRLINLQQRVKAADLAQAMQVSEETIRRDLKHLEEAGKLRRIHGGAVLPKPNEEQPLQVRSRIQTRAKTRLAACAAELVQDGMALFLDTGTTTLALAQQLTRFKALRVVTNSLDIGLLLTQHSANQVLMTPGDIRRNDNALIGPHTLAFAAGFHYDIAFMGIGAVDSELGLMDYEEPEAHLRRTLTVNCRRSVILADDAKFGHRTFINTLPLSAVDTLVSNRPPSAEFVRCLESADVELVYP
>NZ_CP044072.1|WP_150338065.1|52410_53691_+|hydantoinase/carbamoylase-family-amidase
MSSSFTRDFPVADAADLNAFDALFAQSSAIGATANGGLQRLAASAEDGAMRDVFSTWLRAHGFTVQVDAVGNQFGLMTFDPAAPYVLCGSHLDTQPKAGRFDGVYGVLAGAVAIASVARQVEARGEAPVFNLAVVNWTNEEGARFQPSLIGSSAFIGSLSVDEAWASRDGAGVTLGEALAQIGYRGEAMLDLPVAAYLEMHVEQGVQLESQGLAIGVVRRTWAALKWRVRFDGEQNHTGPAPMAVRRDALLAAAEAIVAVRAEAERHGLDMHTSVGRLELEPNSPNVVPALTRLWVEFRSPSMALLVEAEERFRASLDSIAARTGTTFTLESEQLRQPSHLHEGLADLARLTCAALGVPAGDSATVAGHDAISLGRRYPAALLFVPSQGGLSHNEAEFSATSDLHQGLRILTALLYRTCCQPELYL
>NZ_CP044072.1|WP_150338066.1|53702_54644_+|phosphotransferase
MTSTLEFDRLQHALAAAGLTGLQITPGSPGVASPIRLACEWAGFHVHSDQGAFYAKVLYDDMRPLIDFAQSVEATRCAAAAGVTPAVRLADADEGVMLLERLAPEDWHWARLDRLQPELSLEVLWRLKRAVQEGPAPAFERSPWADLEKLRTLCRQQGVALPADHAWIDDCVDQAWHALRQHPGEARPLHGDGLAGNVMVNAAGEFRLLDFDRGGCFDPWYDVAVTLNELYPFEPQWRAGIARWSATASDGDYARCRLYGLLDDWYWTLWGLWAGVASARPLEFSKVGQWTLLRCRMTIQESRFESWLRQVRG
>NZ_CP044072.1|WP_150338067.1|54649_55585_+|phosphotransferase
MKRLGEASTQAERQLEQAILAHEPWAGCTAHYAPVSGGISNTNWRVQIEGAPTAFFLKVPGQGTELFIDRRTAHDASLKAAATGYGAPVVAFLEAHGVEVFEFMEGWRASSNRDFLDRDVRHRALHALKAFNDQPLLIQTKTAFDMIDEHQRQVHELGGQWPDDHAWLDRQYRRARQALEASGVDLAPCMNDTLAGNFMLNAAAEVRLVDFEYASNNDRHYELALWFGEMFFAPDMELALLEDYFGAVTTQTLARVYVNKALADLKWSTWAMVQHAVSQIDFDFYKYGALKHSRARSVIHDSRWETWLRQV
>NZ_CP044072.1|WP_150338068.1|55811_56057_+|hypothetical-protein
MTSSRPFSLKTCGFGLYFCGLLLMAVFPPFYLSVSGSTQVVLGIPLPIFYWILIAVLLGVGVAALYLVESANGDIPKETQP
>NZ_CP044072.1|WP_017638721.1|56053_57592_+|sodium:solute-symporter
MIPAGSSFDMLISFGVIGLFLAGMIAVLYLTNKQSHDFADYAVGGRSYGPWYIAMCYTNSWWPGATFTAFFSLSVGGALGFYGMVYSTLGVTAMYLMANRAWTWGQRFNLTTQPDLLGMRFDSPAVKRLASIIGIISVFPWVVMGIQALAMLFQFASFGSWGITACLTAGVLVVLIRQYWTVSMGMRGLIMTDMYQGLIAYVLAAALCVFLLGGSENASFANLAELPAKMLLIPGDTGTGYGAWYMFSLIFTGVIGSMCWPMSFQRIYTASGVRSVKKGTVYTILLVGGFYGILMLFAAAVSQDPNVAAHPQQGWFLSLFDIGGPWLLALAIAIVLAASIGHVDGCVQVCGVQFANDLATWTTPRTDRQLTALAKGGMIVFIAAAAVVAYLTFNYSRLQLLAQISYQGIIQLAVPLFFGIFTRWGNKQGAILGMLTGILIAIVLTVLYPDDIAALGSLTSGIVGVIFNALVFVGCALAIKPSEAESRRVADLFELGVAPRPAAKGAVAPAMG
>NZ_CP044072.1|WP_150338069.1|57658_58318_+|HAD-IB-family-hydrolase
MALALFDLDETLIHGDCASLWSAWMARIGWVDAEDFPRRDQALMALYGQGQLAMEDYMAFSLEPLVGRTPAEVAEVVHDYLDTVIAPRFYPGARSTVEAHRQAGDRLLVISASAAFLVQPIAARLGIEEVLAIDVEVVAGRYTGRTSGVLTYREGKVIRLEQWLQEQHESLAGASFYSDSRNDLPLLSAVEHPVAVNPDEVLLAQAQAAGWKVLDWRLA
>NZ_CP044072.1|WP_150338070.1|58530_60318_+|allophanate-hydrolase
MNSYPIRILTQRYVAGDLTPSQTVQTLLEMLELSDRPEVWIHRLPQAALQARARELEQQANELGGALQERFPLFGIPFAVKDNIDVAGLPTTVACPEFAYVARENAYVVQRLLDAGAILVGKTNLDQFATGLVGVRSPYGAVRNAVDERYVSGGSSSGSAVAVALGYVAFALGTDTAGSGRVPAGFNGIVGLKPSLGLLSSRGVVPACRSVDTLSIFAADAASAWQVMQVAAHYDAEDAYARQPLTRPVQRRRCRVALPAQPEFFGDGQAAQAFAQSLARLRQDPSVVIDEIPYAVLAEAAALLYQGPWVAERRAAVGQFYEQRPAALHPVVKGILAGADRFTAVDTFEAQYRLQALTRDAERVLAGFDLLVVPTAPCMPTIAEVMADPVQSNARLGYYTNFVNLMNMAAFALPGVPRADGLPAGITLIGRAGSDHYLAETAARWQSLFGGEDQGDAIALAPLDAGEPQVEVAVVGAHLWGQPLNWQLLESGARRLSSTTTSDHYRLYAMANTQPAKPGLVRVAEEGAAIDLEVWTMPLRLFGAFVAAIPAPLGIGSVELADGRWVKGFICEPAGLDGAQDITRFGGWRAYRASL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044072_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044072_2

48134-48442

Orphan

Consensus_repeat	Method
CGACTACAGATTACGGTA	PILER-CR

4 spacers

The CRISPR arrays of NZ_CP044072_2

>merge|NZ_CP044072|2|48134-48442|PILER-CR
GACTACAGATTGCGGTATAGGCGCAGCTAGACACCTATTCCGCGGTTCGAGCACGGTCACCGCCCACCCGATACGACTACAGATTACGGTACCCAGCCGCTCAGACCGATCACTGCGAGCCTAGAACACGTGTCGGCCATGCAATGCGACTACGGATTACGGTAGTGCAGCGGTCAGACCCGCTATGCCGCACCAAAGGGATTTCTAAGGTGGGTGTTGCGACTACAAATCACGGTACAAACGCCTCTCAGCAGGCCTCTCGGTAGCACGCTACGCTCCCTCTGATCGATCCGACTACAAATTACGGTA

>NZ_CP044072|2|2|48134-48442|PILER-CR
GACTACAGATTGCGGTAT	AGGCGCAGCTAGACACCTATTCCGCGGTTCGAGCACGGTCACCGCCCACCCGATAC
GACTACAGATTACGGTAC	CCAGCCGCTCAGACCGATCACTGCGAGCCTAGAACACGTGTCGGCCATGCAATGC
GACTACGGATTACGGTAG	TGCAGCGGTCAGACCCGCTATGCCGCACCAAAGGGATTTCTAAGGTGGGTGTTGC
GACTACAAATCACGGTAC	AAACGCCTCTCAGCAGGCCTCTCGGTAGCACGCTACGCTCCCTCTGATCGATCC
GACTACAAATTACGGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044072.1\|WP_150338129.1\|51674_52433_+\|DeoR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP044072.1\|WP_074585149.1\|50009_51440_+\|amidase	unknown	unknown	gnl\|CDD\|180437
NZ_CP044072.1\|WP_150338070.1\|58530_60318_+\|allophanate-hydrolase	unknown	unknown	gnl\|CDD\|236177
NZ_CP044072.1\|WP_150338062.1\|40748_41318_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP044072.1\|WP_150338065.1\|52410_53691_+\|hydantoinase/carbamoylase-family-amidase	unknown	unknown	gnl\|CDD\|236456
NZ_CP044072.1\|WP_074585147.1\|45372_46053_+\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP044072.1\|WP_017638721.1\|56053_57592_+\|sodium:solute-symporter	unknown	unknown	gnl\|CDD\|271357
NZ_CP044072.1\|WP_150338058.1\|33999_35184_-\|outer-membrane-porin,-OprD-family	unknown	unknown	gnl\|CDD\|335381
NZ_CP044072.1\|WP_150338063.1\|41622_42180_+\|DEAD/DEAH-box-helicase-family-protein	unknown	unknown	gnl\|CDD\|227226
NZ_CP044072.1\|WP_150338128.1\|39901_40558_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198291
NZ_CP044072.1\|WP_150338060.1\|37589_38159_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234994
NZ_CP044072.1\|WP_150338066.1\|53702_54644_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|366736
NZ_CP044072.1\|WP_150338069.1\|57658_58318_+\|HAD-IB-family-hydrolase	unknown	unknown	gnl\|CDD\|319796
NZ_CP044072.1\|WP_150338057.1\|32827_33616_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP044072.1\|WP_108576311.1\|48648_49512_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP044072.1\|WP_150338061.1\|38428_39592_+\|DUF1173-family-protein	unknown	unknown	gnl\|CDD\|369028
NZ_CP044072.1\|WP_150338068.1\|55811_56057_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044072.1\|WP_150338064.1\|42201_44445_+\|type-III-restriction-endonuclease-subunit-R	unknown	unknown	gnl\|CDD\|227226
NZ_CP044072.1\|WP_150338059.1\|36820_37006_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|367773
NZ_CP044072.1\|WP_150338067.1\|54649_55585_+\|phosphotransferase	unknown	unknown	gnl\|CDD\|270700

Protein	Function_ID	Function_description	E-value
NZ_CP044072.1\|WP_150338129.1\|51674_52433_+\|DeoR-family-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.7991e-84
NZ_CP044072.1\|WP_074585149.1\|50009_51440_+\|amidase	gnl\|CDD\|180437	PRK06169, PRK06169, putative amidase; Provisional.	1.66757e-146
NZ_CP044072.1\|WP_150338070.1\|58530_60318_+\|allophanate-hydrolase	gnl\|CDD\|236177	PRK08186, PRK08186, allophanate hydrolase; Provisional.	0
NZ_CP044072.1\|WP_150338062.1\|40748_41318_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	3.1604e-12
NZ_CP044072.1\|WP_150338065.1\|52410_53691_+\|hydantoinase/carbamoylase-family-amidase	gnl\|CDD\|236456	PRK09290, PRK09290, allantoate amidohydrolase; Reviewed.	2.20813e-159
NZ_CP044072.1\|WP_074585147.1\|45372_46053_+\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	3.89003e-36
NZ_CP044072.1\|WP_017638721.1\|56053_57592_+\|sodium:solute-symporter	gnl\|CDD\|271357	cd10322, SLC5sbd, Solute carrier 5 family, sodium/glucose transporters and related proteins; solute-binding domain. This family represents the solute-binding domain of SLC5 proteins (also called the sodium/glucose cotransporter family or solute sodium symporter family) that co-transport Na+ with sugars, amino acids, inorganic ions or vitamins. Family members include: the human glucose (SGLT1, 2, 4, 5), chiro-inositol (SGLT5), myo-inositol (SMIT), choline (CHT), iodide (NIS), multivitamin (SMVT), and monocarboxylate (SMCT) cotransporters, as well as Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. Vibrio parahaemolyticus Na(+)/galactose cotransporter (vSGLT) has 13 transmembrane helices (TMs): TM-1, an inverted topology repeat: TMs1-5 and TMs6-10, and TMs 11-12 (TMs numbered to conform to the solute carrier 6 family Aquifex aeolicus LeuT). One member of this family, human SGLT3, has been characterized as a glucose sensor and not a transporter. Members of this family are important in human physiology and disease.	3.75839e-45
NZ_CP044072.1\|WP_150338058.1\|33999_35184_-\|outer-membrane-porin,-OprD-family	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	5.66612e-180
NZ_CP044072.1\|WP_150338063.1\|41622_42180_+\|DEAD/DEAH-box-helicase-family-protein	gnl\|CDD\|227226	COG4889, COG4889, Predicted helicase [General function prediction only].	4.34004e-22
NZ_CP044072.1\|WP_150338128.1\|39901_40558_-\|glutathione-S-transferase	gnl\|CDD\|198291	cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the Saccharomyces cerevisiae GST protein, GTT2. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. GTT2, a homodimer, exhibits GST activity with standard substrates. Strains with deleted GTT2 genes are viable but exhibit increased sensitivity to heat shock.	1.75118e-48
NZ_CP044072.1\|WP_150338060.1\|37589_38159_+\|hypothetical-protein	gnl\|CDD\|234994	PRK01973, PRK01973, septum site-determining protein MinC.	0.00526185
NZ_CP044072.1\|WP_150338066.1\|53702_54644_+\|phosphotransferase	gnl\|CDD\|366736	pfam01636, APH, Phosphotransferase enzyme family. This family consists of bacterial antibiotic resistance proteins, which confer resistance to various aminoglycosides they include: aminoglycoside 3'-phosphotransferase or kanamycin kinase / neomycin-kanamycin phosphotransferase and streptomycin 3''-kinase or streptomycin 3''-phosphotransferase. The aminoglycoside phosphotransferases inactivate aminoglycoside antibiotics via phosphorylation. This family also includes homoserine kinase. This family is related to fructosamine kinase pfam03881.	6.17003e-12
NZ_CP044072.1\|WP_150338069.1\|57658_58318_+\|HAD-IB-family-hydrolase	gnl\|CDD\|319796	cd02612, HAD_PGPPase, phosphatidylglycerol-phosphate phosphatase, similar to Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C. This family includes Escherichia coli K-12 phosphatidylglycerol-phosphate phosphatase C, PgpC (previously named yfhB) which catalyzes the dephosphorylation of phosphatidylglycerol-phosphate (PGP) to phosphatidylglycerol (PG). This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.	4.92188e-59
NZ_CP044072.1\|WP_150338057.1\|32827_33616_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	2.62819e-51
NZ_CP044072.1\|WP_108576311.1\|48648_49512_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.90201e-60
NZ_CP044072.1\|WP_150338061.1\|38428_39592_+\|DUF1173-family-protein	gnl\|CDD\|369028	pfam06666, DUF1173, Protein of unknown function (DUF1173). This family contains a group of hypothetical bacterial proteins that contain three conserved cysteine residues towards the N-terminal. The function of these proteins is unknown.	4.88916e-71
NZ_CP044072.1\|WP_150338064.1\|42201_44445_+\|type-III-restriction-endonuclease-subunit-R	gnl\|CDD\|227226	COG4889, COG4889, Predicted helicase [General function prediction only].	1.41462e-41
NZ_CP044072.1\|WP_150338059.1\|36820_37006_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|367773	pfam04014, MazE_antitoxin, Antidote-toxin recognition MazE, bacterial antitoxin. AbrB-like is a family of small proteins that operate in conjunction with a cognate toxin molecule. The commonly attributed role of toxin-antitoxin systems is to maintain low-copy number plasmids from one generation to the next. Such gene-pairs are also found on chromosomes and to be associated with a number of biological functions such as: reduction of protein synthesis, gene regulation and retardation of cell growth under nutritional stress. This family includes proteins from a number of different pairings, eg MazE, AbrB, VapB, PhoU, PemI-like and SpoVT. MazE is the antidote to the toxin MazF of E. coli. MazE-MazF in E. coli is a regulated prokaryotic chromosomal addiction module. MazE antidote is degraded by the ClpPA protease of the bacterial proteasome. MazE-MazF is thought to play a role in programmed cell death when cells suffer nutrient deprivation, and MazE-MazF modules have also been implicated in the bacteriostatic effects of other addiction modules.	0.000316299
NZ_CP044072.1\|WP_150338067.1\|54649_55585_+\|phosphotransferase	gnl\|CDD\|270700	cd05151, ChoK-like, Choline Kinase and similar proteins. This subfamily is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate and displays negligible activity towards N-methylated derivatives of Etn. ChoK plays an important role in cell signaling pathways and the regulation of cell growth. The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	1.49292e-46

>NZ_CP044072.1|WP_074585147.1|45372_46053_+|ParA-family-protein
MSKHAPKRASAYLRRSLVKTVVIASRKGGVGKTTTTEVLGVELARRGNRVMLIDTDPQGSLTEWWQEREIEEPQMSNVPYESLGAALSVLEGEGYNYVLIDTPPESNDVITATVKFADLVIIPVKAGPHDLRAVRQTLTLVKDENKPFVFLLNEVTLNTNITKDVMVALSQHGKLCPPMPRRTIMVEAGIDGRVPQELRPSCSAARDIRKLCDYVLEELEFQQARA
>NZ_CP044072.1|WP_150338064.1|42201_44445_+|type-III-restriction-endonuclease-subunit-R
MGLLPGFAFDLGILDEAHKTAGAAGRRNSFALNDHPTLRIDRRLFLTATPLAIAEEEGPAGTGPIYSMTDEAVFGPVAYELSYSAAVAAGIICDFRVIISVEEGDDEQLAEALEDDERRYAVHAQELLRAMTDVGARKAFAFYSRISQSKRFATALREAVGAGDFWARHIDGSFPSWQRTRLLHQYGRASRAALSCARCLAEGVDVPDTDLIAFMHRRESHVDIVQALGRAVRKAPGKRYGYVLIPLRLKRSSGESLIQAVARSDMSTVWRTLAALAEQDDAMLNEVQRAAVDQGETGQPTSPGWFNKLHVIAPAGRPDAGAWAASLKAVLSTELVGRIAGSWPHFYGLLRAFVTDRGHARVARSYRTPGGHTLGAWCSRQRALHRLGRLAPNRAEQLEAIGFEFDPRKHAWERGYEALRSYLADTGSPSPAVDVVTADGLALGHWCSEQRKAYRLGRLAPRKKQLLEALGFIVSPSDDAWEKRYQALVAFKEEHGHLRVAQRQVLVDGTDLADWCRNQRSRQIDLSRRDRLAALGFDFHAGVLDARWEAAYTALEEFGARQGHVNVPLDFVLPDGTALGTWVGNQRARYRDGQMDQQRIELLNQLGFVWEMFGAAFDQGLQHLEQFEAAHGHCDVPIAYVAGDGYKLGRWCSNQRTRLKDKPDDPDHGRLLAAGFSFDPAEAAWQQHYAALQDYLAANAGASVPVKHVTADGLRLGSWVSRQKTLLKAGKLAHAKHAALRGLGVFS
>NZ_CP044072.1|WP_150338063.1|41622_42180_+|DEAD/DEAH-box-helicase-family-protein
MRTWRRSMEGPLPDMLAPVSAGVSLYAGEHLKRQPIRCDNHPPPLLHHRRLIPMQFSSSLLAPHQLEARARILDGFKRRARLQVHMACGTGKTRLAQGVAAALGARSIVIFLPSLALVSQTLQAWVSNAELDLERVLCVCSDESVATLDDEHEVLEDLPVAVTTSPEEIALKVGALGRDLIVLCT
>NZ_CP044072.1|WP_150338062.1|40748_41318_+|TetR-family-transcriptional-regulator
MTQNAREQILLSAKAAAQLHGYGGINFRTIAEEVGIKNASIYYHFPSKADLGAAVAERYWQETAQVLSELRASHKAPEECLRLYPSIFRKSIENQNRLCLSSFMAAEVEDLPDQVTKEVRAFADVNVEWLVDVLADLDWGSDEERKRRAYAIYTAVAGAQLIARTRQDINLFDELVSSYLEAGLIPARA
>NZ_CP044072.1|WP_150338128.1|39901_40558_-|glutathione-S-transferase
MKIYDWFDGPYPARVRIALAEKGLLPKIEFVSVNLWTGEHKEPEFLAINYSGTLPVLELQDGTRIAECTAITQYLDSLEGSLTLTGETALEKGLIHMMTKRAEIEFLDAVSVYFHHATPGLGPKVELYQNAEWGAKMGEKATRGMCYFDNLLRQQPFVAGDKFSMADIAVIGGMIFASLVKLPVPDECDALRSWYAKIQDRPSYKTWSALVDQGAPAK
>NZ_CP044072.1|WP_150338061.1|38428_39592_+|DUF1173-family-protein
MERAYGREHGLCGCPGSGERKLTIKLREGSDGYHLARYPHSGPEHANDCRFYAAAPQRSGLQGYAVGVVEETADGGMKVRLARGVRQQAPGEAGDAAPSPPAAPGVKKPAMTLLGLLHLLWSESRLTTWYPAMAGKRDGELVSHLLHECVGRVSVAPRIKLDQVLLLAAQKEKRREATNREIATNAASRNWRLVVVSPLARYDEERHSGSPERLPVTGPFGMPTLYLPPAVWETASRRFGRELGAWRRGSRVIAIAQIAQRPGKAHQADVLEVALMQVSEQWIPLDSDLEGKVEQKLRDEDRKFDKPLRYDADECAVFPDFWLLDMQQDFALEVFGMATPQYLERRGTKEQWYCSEYGKTGWWRWDATQDPRGEHIPAFPAAYGSSR
>NZ_CP044072.1|WP_150338060.1|37589_38159_+|hypothetical-protein
MAMSAEPDDAPDWLVQKPRRARPVALVVCLAVGGLATLAALELASRALPGPSASVGTDHPALPAETAAHPAPEPADTVRGTVRRATPSPVEENAAAAATSPSNNQPPAAAIGKQTVFNDRNFTPSGADNVVSFSEASRSLAPEEAPPQPTKVTVVHQTLSMKDRVCWPYKAGSLEHRNCRSAVGLQYRD
>NZ_CP044072.1|WP_150338059.1|36820_37006_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MTQSACTTVKCQDPGDGSGDVIVDLPPDILKEMNLAVGDKLSIELVDSVIVLRPVREPNPE
>NZ_CP044072.1|WP_150338058.1|33999_35184_-|outer-membrane-porin,-OprD-family
MAQEHGFIEDAASTLQMRNFYFNRDFRDSGAPKAKAEEWAQGFLLNAQSGYTQGIVGIGADLIGGLGVKLDSGDGRAGTLLLPNDGDGSADEFSSLGAAAKLKISKTELKVGELLPTLPILQYDDARLLPQTFQGAMLTSKEIPGLTLNAGQMRSFTQRNSSDREDMFIDGRAFATSDRYNYLGSEYRFNQDRTMLGLWGAQLEDIYHQRFIQFTHKQPLGAWTLGANIGLLDSDEDGQANAGQIDNRSFYTALSASVSGHTVMAAWQRMYGDDGTIWLSPTTTVLPSDIQVRNFASAEEKAWQLRYDYNFAAMGIPGLNAFVRYVKGDNVAVAGGNGGNGGKEWERDFDVSYVIQSGPLKNVGLRWRNAMVRSNFGPSVNDKRLIINYSLALF
>NZ_CP044072.1|WP_150338057.1|32827_33616_+|GntR-family-transcriptional-regulator
MRNPTRSSPQLYITIVHWIGEEIRSGRLGAGDQLPTERKLCEQFSVSRTVVREALSLLKSEELISTHQGKGAFVAKRTERHGFRIDHAPCDGETSIKHLLELLMTIEVAATRLAAMRRTSEDVKKMRQALDGMEGAIFEESLGDDAEHQFHKTVLVAAGNPHLKALSEYLGHGIRRMIHDARINMADKYSDDIQLVQDERRAIFLAILAGDPSAAACAASRYLSNVSERLGMAHARKVVQRSGERSTESQHRNKEGADFRGS
>NZ_CP044072.1|WP_108576311.1|48648_49512_+|replication-initiation-protein
MSKVSTSVPDQADPRPIRVTKSNTLITASYRLTLNEQRLILAAISQIDPRKGMPKKISVSALLYSEIYGVQLRHAYEQMKETADVLFEREVKTFDGSAVERKRWVDAARYIAGEGRVELSFTIHVMPYLSRLHTKLTSYDLRRVARLDSTHSFRLFEMLMQFKKTGWAYIEIETLRTALGLSDAYQRFNNLRQRVIDPAVEELRTKSRLDVTYELKREARRVVAIKFMFKDLAQQLPLNLGDEELVPLTEIDLPEDPSLLLASAFEDLSEDDPNFTFPIDVDESGGA
>NZ_CP044072.1|WP_074585149.1|50009_51440_+|amidase
MQKLDLEGVVLDVISSAQRIREGQLTSVTLVQACLKSIKATNPTLRAFGDVYVDHALNQAQLLDAEAREGRFRGPLHGVPFGIKDLFHTAGLRTTRGSLTALDYVPTQDAPIIQRLKAAGGIVLGKTATTEFGWTGASTSRVFGDGRTPWNTSLTSGGSSSGSAIATAAFMVPAALGSDGGGSVRIPSSFCGTFALKGSLGRIPTWPWSATETLSHAGPITRTVRDSALLFDVLSGPDALDHQALPAPTESYLARCDQPLSPLRVAYCPTLFETPVHPEVAAGVDAAVDILARQLPLEVERLTLDWRDPLTTFETLWVAGRGIAYGKTLGGRLGELDPGFATLIEKARQYDLADYLAASQQRAMFANQVHALFESYDLLLLPTLPILPFPAHLTGPEEGYEAAGSGTPWARWTPFTYPFNLSGNPAASLPCAWSADELPIGLQVVGPRHADAAVLQFCAAVEALLPWAHRVPPLLR
>NZ_CP044072.1|WP_150338129.1|51674_52433_+|DeoR-family-transcriptional-regulator
MLNQPRLDEILRLINLQQRVKAADLAQAMQVSEETIRRDLKHLEEAGKLRRIHGGAVLPKPNEEQPLQVRSRIQTRAKTRLAACAAELVQDGMALFLDTGTTTLALAQQLTRFKALRVVTNSLDIGLLLTQHSANQVLMTPGDIRRNDNALIGPHTLAFAAGFHYDIAFMGIGAVDSELGLMDYEEPEAHLRRTLTVNCRRSVILADDAKFGHRTFINTLPLSAVDTLVSNRPPSAEFVRCLESADVELVYP
>NZ_CP044072.1|WP_150338065.1|52410_53691_+|hydantoinase/carbamoylase-family-amidase
MSSSFTRDFPVADAADLNAFDALFAQSSAIGATANGGLQRLAASAEDGAMRDVFSTWLRAHGFTVQVDAVGNQFGLMTFDPAAPYVLCGSHLDTQPKAGRFDGVYGVLAGAVAIASVARQVEARGEAPVFNLAVVNWTNEEGARFQPSLIGSSAFIGSLSVDEAWASRDGAGVTLGEALAQIGYRGEAMLDLPVAAYLEMHVEQGVQLESQGLAIGVVRRTWAALKWRVRFDGEQNHTGPAPMAVRRDALLAAAEAIVAVRAEAERHGLDMHTSVGRLELEPNSPNVVPALTRLWVEFRSPSMALLVEAEERFRASLDSIAARTGTTFTLESEQLRQPSHLHEGLADLARLTCAALGVPAGDSATVAGHDAISLGRRYPAALLFVPSQGGLSHNEAEFSATSDLHQGLRILTALLYRTCCQPELYL
>NZ_CP044072.1|WP_150338066.1|53702_54644_+|phosphotransferase
MTSTLEFDRLQHALAAAGLTGLQITPGSPGVASPIRLACEWAGFHVHSDQGAFYAKVLYDDMRPLIDFAQSVEATRCAAAAGVTPAVRLADADEGVMLLERLAPEDWHWARLDRLQPELSLEVLWRLKRAVQEGPAPAFERSPWADLEKLRTLCRQQGVALPADHAWIDDCVDQAWHALRQHPGEARPLHGDGLAGNVMVNAAGEFRLLDFDRGGCFDPWYDVAVTLNELYPFEPQWRAGIARWSATASDGDYARCRLYGLLDDWYWTLWGLWAGVASARPLEFSKVGQWTLLRCRMTIQESRFESWLRQVRG
>NZ_CP044072.1|WP_150338067.1|54649_55585_+|phosphotransferase
MKRLGEASTQAERQLEQAILAHEPWAGCTAHYAPVSGGISNTNWRVQIEGAPTAFFLKVPGQGTELFIDRRTAHDASLKAAATGYGAPVVAFLEAHGVEVFEFMEGWRASSNRDFLDRDVRHRALHALKAFNDQPLLIQTKTAFDMIDEHQRQVHELGGQWPDDHAWLDRQYRRARQALEASGVDLAPCMNDTLAGNFMLNAAAEVRLVDFEYASNNDRHYELALWFGEMFFAPDMELALLEDYFGAVTTQTLARVYVNKALADLKWSTWAMVQHAVSQIDFDFYKYGALKHSRARSVIHDSRWETWLRQV
>NZ_CP044072.1|WP_150338068.1|55811_56057_+|hypothetical-protein
MTSSRPFSLKTCGFGLYFCGLLLMAVFPPFYLSVSGSTQVVLGIPLPIFYWILIAVLLGVGVAALYLVESANGDIPKETQP
>NZ_CP044072.1|WP_017638721.1|56053_57592_+|sodium:solute-symporter
MIPAGSSFDMLISFGVIGLFLAGMIAVLYLTNKQSHDFADYAVGGRSYGPWYIAMCYTNSWWPGATFTAFFSLSVGGALGFYGMVYSTLGVTAMYLMANRAWTWGQRFNLTTQPDLLGMRFDSPAVKRLASIIGIISVFPWVVMGIQALAMLFQFASFGSWGITACLTAGVLVVLIRQYWTVSMGMRGLIMTDMYQGLIAYVLAAALCVFLLGGSENASFANLAELPAKMLLIPGDTGTGYGAWYMFSLIFTGVIGSMCWPMSFQRIYTASGVRSVKKGTVYTILLVGGFYGILMLFAAAVSQDPNVAAHPQQGWFLSLFDIGGPWLLALAIAIVLAASIGHVDGCVQVCGVQFANDLATWTTPRTDRQLTALAKGGMIVFIAAAAVVAYLTFNYSRLQLLAQISYQGIIQLAVPLFFGIFTRWGNKQGAILGMLTGILIAIVLTVLYPDDIAALGSLTSGIVGVIFNALVFVGCALAIKPSEAESRRVADLFELGVAPRPAAKGAVAPAMG
>NZ_CP044072.1|WP_150338069.1|57658_58318_+|HAD-IB-family-hydrolase
MALALFDLDETLIHGDCASLWSAWMARIGWVDAEDFPRRDQALMALYGQGQLAMEDYMAFSLEPLVGRTPAEVAEVVHDYLDTVIAPRFYPGARSTVEAHRQAGDRLLVISASAAFLVQPIAARLGIEEVLAIDVEVVAGRYTGRTSGVLTYREGKVIRLEQWLQEQHESLAGASFYSDSRNDLPLLSAVEHPVAVNPDEVLLAQAQAAGWKVLDWRLA
>NZ_CP044072.1|WP_150338070.1|58530_60318_+|allophanate-hydrolase
MNSYPIRILTQRYVAGDLTPSQTVQTLLEMLELSDRPEVWIHRLPQAALQARARELEQQANELGGALQERFPLFGIPFAVKDNIDVAGLPTTVACPEFAYVARENAYVVQRLLDAGAILVGKTNLDQFATGLVGVRSPYGAVRNAVDERYVSGGSSSGSAVAVALGYVAFALGTDTAGSGRVPAGFNGIVGLKPSLGLLSSRGVVPACRSVDTLSIFAADAASAWQVMQVAAHYDAEDAYARQPLTRPVQRRRCRVALPAQPEFFGDGQAAQAFAQSLARLRQDPSVVIDEIPYAVLAEAAALLYQGPWVAERRAAVGQFYEQRPAALHPVVKGILAGADRFTAVDTFEAQYRLQALTRDAERVLAGFDLLVVPTAPCMPTIAEVMADPVQSNARLGYYTNFVNLMNMAAFALPGVPRADGLPAGITLIGRAGSDHYLAETAARWQSLFGGEDQGDAIALAPLDAGEPQVEVAVVGAHLWGQPLNWQLLESGARRLSSTTTSDHYRLYAMANTQPAKPGLVRVAEEGAAIDLEVWTMPLRLFGAFVAAIPAPLGIGSVELADGRWVKGFICEPAGLDGAQDITRFGGWRAYRASL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP044072_1	1.1\|47909\|25\|NZ_CP044072\|PILER-CR	47909-47933	25	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	47907-47931	1.0
NZ_CP044072_1	1.2\|47954\|22\|NZ_CP044072\|PILER-CR	47954-47975	22	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	47952-47973	1.0
NZ_CP044072_2	2.1\|48152\|56\|NZ_CP044072\|PILER-CR	48152-48207	56	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	48151-48206	1.0
NZ_CP044072_2	2.2\|48226\|55\|NZ_CP044072\|PILER-CR	48226-48280	55	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	48225-48279	1.0
NZ_CP044072_2	2.3\|48299\|55\|NZ_CP044072\|PILER-CR	48299-48353	55	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	48298-48352	1.0
NZ_CP044072_2	2.4\|48372\|54\|NZ_CP044072\|PILER-CR	48372-48425	54	NZ_CP044072	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence	48371-48424	1.0

1. spacer 1.1|47909|25|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtcatcgcagcaatacttctcggtc	CRISPR spacer
gtcatcgcagcaatacttctcggtc	Protospacer
*************************

2. spacer 1.2|47954|22|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

tggccgtcctctaacctgctga	CRISPR spacer
tggccgtcctctaacctgctga	Protospacer
**********************

3. spacer 2.1|48152|56|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

taggcgcagctagacacctattccgcggttcgagcacggtcaccgcccacccgata	CRISPR spacer
taggcgcagctagacacctattccgcggttcgagcacggtcaccgcccacccgata	Protospacer
********************************************************

4. spacer 2.2|48226|55|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

cccagccgctcagaccgatcactgcgagcctagaacacgtgtcggccatgcaatg	CRISPR spacer
cccagccgctcagaccgatcactgcgagcctagaacacgtgtcggccatgcaatg	Protospacer
*******************************************************

5. spacer 2.3|48299|55|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

gtgcagcggtcagacccgctatgccgcaccaaagggatttctaaggtgggtgttg	CRISPR spacer
gtgcagcggtcagacccgctatgccgcaccaaagggatttctaaggtgggtgttg	Protospacer
*******************************************************

6. spacer 2.4|48372|54|NZ_CP044072|PILER-CR matches to NZ_CP044072 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

caaacgcctctcagcaggcctctcggtagcacgctacgctccctctgatcgatc	CRISPR spacer
caaacgcctctcagcaggcctctcggtagcacgctacgctccctctgatcgatc	Protospacer
******************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044074_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044074_1

272299-272396

Orphan

Consensus_repeat	Method
TGGGAGAGGGTTGGGGTGAGGGC	CRISPRCasFinder

1 spacers

DinG

The CRISPR arrays of NZ_CP044074_1

>merge|NZ_CP044074|1|272299-272396|CRISPRCasFinder
TGGGAGAGGGTTGGGGTGAGGGCCCGCAGGAAGGCAAGGCGTCATCGAGCTGCGCGCTTTTACCCCCTCTCCCTCTGGGAGAGGGCTGGGGTGAGGGC

>NZ_CP044074|1|1|272299-272396|CRISPRCasFinder
TGGGAGAGGGTTGGGGTGAGGGC	CCGCAGGAAGGCAAGGCGTCATCGAGCTGCGCGCTTTTACCCCCTCTCCCTC
TGGGAGAGGGCTGGGGTGAGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044074.1\|WP_150338250.1\|284527_285754_-\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|341373
NZ_CP044074.1\|WP_027597154.1\|274832_276110_-\|glucarate-dehydratase	unknown	unknown	gnl\|CDD\|239439
NZ_CP044074.1\|WP_074583828.1\|283958_284522_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044074.1\|WP_150338242.1\|260201_261059_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|367029
NZ_CP044074.1\|WP_027602507.1\|261179_263153_+\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|236635
NZ_CP044074.1\|WP_150338243.1\|265546_266296_-\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143587
NZ_CP044074.1\|WP_150338247.1\|276292_277954_+\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|370112
NZ_CP044074.1\|WP_027602512.1\|271014_271953_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176126
NZ_CP044074.1\|WP_150338246.1\|272405_274685_-\|beta-glucosidase-BglX	unknown	unknown	gnl\|CDD\|185053
NZ_CP044074.1\|WP_007159605.1\|283550_283940_-\|DUF1987-domain-containing-protein	unknown	unknown	gnl\|CDD\|378154
NZ_CP044074.1\|WP_042136225.1\|267808_269152_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340877
NZ_CP044074.1\|WP_027597149.1\|282819_283554_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP044074.1\|WP_150338245.1\|269231_271001_+\|D-lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|236872
NZ_CP044074.1\|WP_044341430.1\|259584_260184_+\|LysE-family-transporter	unknown	unknown	gnl\|CDD\|224199
NZ_CP044074.1\|WP_144960040.1\|280482_280866_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319937
NZ_CP044074.1\|WP_144960023.1\|263347_265348_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP044074.1\|WP_150338248.1\|277950_280224_+\|ATP-dependent-DNA-helicase	DinG	COG1199_DinG_CAS-IV-A	gnl\|CDD\|224120
NZ_CP044074.1\|WP_150338249.1\|281097_282732_+\|glucan-biosynthesis-protein-D	unknown	unknown	gnl\|CDD\|237327
NZ_CP044074.1\|WP_150338244.1\|266511_267648_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341483
NZ_CP044074.1\|WP_150338241.1\|257981_259427_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|236901

Protein	Function_ID	Function_description	E-value
NZ_CP044074.1\|WP_150338250.1\|284527_285754_-\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|341373	cd04598, CBS_pair_GGDEF_EAL, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain. The GGDEF domain has been suggested to be homologous to the adenylyl cyclase catalytic domain and is thought to be involved in regulating cell surface adhesiveness in bacteria. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	2.54285e-52
NZ_CP044074.1\|WP_027597154.1\|274832_276110_-\|glucarate-dehydratase	gnl\|CDD\|239439	cd03323, D-glucarate_dehydratase, D-Glucarate dehydratase (GlucD) catalyzes the dehydration of both D-glucarate and L-idarate to form 5-keto-4-deoxy-D-glucarate (5-KDG) , the initial reaction of the catabolic pathway for (D)-glucarate. GlucD belongs to the enolase superfamily of enzymes, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and that is stabilized by coordination to the essential Mg2+ ion.	0
NZ_CP044074.1\|WP_150338242.1\|260201_261059_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|367029	pfam02311, AraC_binding, AraC-like ligand binding domain. This family represents the arabinose-binding and dimerization domain of the bacterial gene regulatory protein AraC. The domain is found in conjunction with the helix-turn-helix (HTH) DNA-binding motif pfam00165. This domain is distantly related to the Cupin domain pfam00190.	8.62619e-23
NZ_CP044074.1\|WP_027602507.1\|261179_263153_+\|BCCT-family-transporter	gnl\|CDD\|236635	PRK09928, PRK09928, choline transport protein BetT; Provisional.	0
NZ_CP044074.1\|WP_150338243.1\|265546_266296_-\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143587	cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes. This superfamily (also known as the C-N hydrolase superfamily) contains hydrolases that break carbon-nitrogen bonds; it includes nitrilases, cyanide dihydratases, aliphatic amidases, N-terminal amidases, beta-ureidopropionases, biotinidases, pantotheinase, N-carbamyl-D-amino acid amidohydrolases, the glutaminase domain of glutamine-dependent NAD+ synthetase, apolipoprotein N-acyltransferases, and N-carbamoylputrescine amidohydrolases, among others. These enzymes depend on a Glu-Lys-Cys catalytic triad, and work through a thiol acylenzyme intermediate. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. These oligomers include dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers, as well as variable length helical arrangements and homo-oligomeric spirals. These proteins have roles in vitamin and co-enzyme metabolism, in detoxifying small molecules, in the synthesis of signaling molecules, and in the post-translational modification of proteins. They are used industrially, as biocatalysts in the fine chemical and pharmaceutical industry, in cyanide remediation, and in the treatment of toxic effluent. This superfamily has been classified previously in the literature, based on global and structure-based sequence analysis, into thirteen different enzyme classes (referred to as 1-13). This hierarchy includes those thirteen classes and a few additional subfamilies. A putative distant relative, the plasmid-borne TraB family, has not been included in the hierarchy.	1.07386e-34
NZ_CP044074.1\|WP_150338247.1\|276292_277954_+\|VRR-NUC-domain-containing-protein	gnl\|CDD\|370112	pfam08774, VRR_NUC, VRR-NUC domain.	1.35122e-36
NZ_CP044074.1\|WP_027602512.1\|271014_271953_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176126	cd08435, PBP2_GbpR, The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE. The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.77544e-42
NZ_CP044074.1\|WP_150338246.1\|272405_274685_-\|beta-glucosidase-BglX	gnl\|CDD\|185053	PRK15098, PRK15098, beta-glucosidase BglX.	0
NZ_CP044074.1\|WP_007159605.1\|283550_283940_-\|DUF1987-domain-containing-protein	gnl\|CDD\|378154	pfam09345, DUF1987, Domain of unknown function (DUF1987). This family of proteins are functionally uncharacterized.	3.17078e-51
NZ_CP044074.1\|WP_042136225.1\|267808_269152_+\|MFS-transporter	gnl\|CDD\|340877	cd17319, MFS_ExuT_GudP_like, Hexuronate transporter, Glucarate transporter, and similar transporters of the Major Facilitator Superfamily. This family is composed of predominantly bacterial transporters for hexuronate (ExuT), glucarate (GudP), galactarate (GarP), and galactonate (DgoT). They mediate the uptake of these compounds into the cell. They belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.59421e-79
NZ_CP044074.1\|WP_027597149.1\|282819_283554_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.75157e-48
NZ_CP044074.1\|WP_150338245.1\|269231_271001_+\|D-lactate-dehydrogenase	gnl\|CDD\|236872	PRK11183, PRK11183, D-lactate dehydrogenase; Provisional.	0
NZ_CP044074.1\|WP_044341430.1\|259584_260184_+\|LysE-family-transporter	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	7.16551e-14
NZ_CP044074.1\|WP_144960040.1\|280482_280866_-\|VOC-family-protein	gnl\|CDD\|319937	cd08349, BLMA_like, Bleomycin binding protein (BLMA) and similar proteins. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the larger superfamily, this family contains members with or without domain swapping.	4.62152e-24
NZ_CP044074.1\|WP_144960023.1\|263347_265348_-\|HAMP-domain-containing-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	1.06809e-70
NZ_CP044074.1\|WP_150338248.1\|277950_280224_+\|ATP-dependent-DNA-helicase	gnl\|CDD\|224120	COG1199, DinG, Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair].	2.46902e-61
NZ_CP044074.1\|WP_150338249.1\|281097_282732_+\|glucan-biosynthesis-protein-D	gnl\|CDD\|237327	PRK13273, mdoD, glucan biosynthesis protein D; Provisional.	0
NZ_CP044074.1\|WP_150338244.1\|266511_267648_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341483	cd14861, Fe-ADH-like, Iron-containing alcohol dehydrogenases-like. This family contains proteins similar to iron-containing alcohol dehydrogenase (Fe-ADH), most of which have not been characterized. Their specific function is unknown. The protein structure represents a dehydroquinate synthase-like fold and belongs to the alcohol dehydrogenase-like superfamily. It is distinct from other alcohol dehydrogenases which contain different protein domains. Alcohol dehydrogenase catalyzes the reduction of acetaldehyde to alcohol with NADP as cofactor. Its activity requires iron ions.	0
NZ_CP044074.1\|WP_150338241.1\|257981_259427_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	8.45259e-43

>NZ_CP044074.1|WP_027602512.1|271014_271953_-|LysR-family-transcriptional-regulator
MKQLASLNAIMSRLHAKQLRLLIALAEKGSLLNAAEGLGLTQPGASKALKELESALGVELFLRTNRGLLPTPAGTCAIRFARLIQADLDNLRLELHAIASGSGGKLAIGTIMGAVPLLTHAISRLLDLQPRLSIEVVEDTSTTLLGLIDQGRLDAAICRLSVSERPESYDALVIKDESLAVIAHAAHPAAQRERVELRDLSDSRWVVYRANMPMRRTLEHEFFEAQLPFPLHLIETTSALTTLSLLSRNPRLVALVSVEVADYVCQHGLVSRLPLELRSHSEPYELVSRRSAQQNPAFALLVESLYAIQRED
>NZ_CP044074.1|WP_150338245.1|269231_271001_+|D-lactate-dehydrogenase
MDLVSELHTIVGRRHVLQGDAATRRFRLGIRYGGGAVLAVVRPGSLLEMWRVLQRCHSAGTIIICQAANTGLTGGSTPVAEGYDRPVVLINTLRLTRLALLRQGEQVLSQPGVTLSQLETTLKPLGREPHSVIGSTCIGASVTGGVCNNSGGSLIRRGPAFTQLSLFARIDEAGQLQLVNHLGLALGDTPEEILSRLDEGRFDDSVVQDPAGAMASDREYARHVRDVASATPARYNADPRRLYEASGSAGKIAVFALRLDTFAADRNTRVFYIGSNRAADLEAIRRHILVNFVQLPIAGEYMHRTAYELSRTYGKDLFLFIQRCGAQRVPQAFAWKTRFDALSERLGLGAQLGDRLLQRLAAPLPEHLPARLNAFAARFEHHLLLKMGEDGIDEARAYLQSWLPSADADFIECDLEEGNAAFLNRFAVGNAMNRYRAVHRDTVEDILALDIALPRNTQDWFETLPPELAEQIEVTMYCGHFFCHVLHQEYLVKKGRDCAALKRRLLALLEARGARYPAEHNVGHLYAAAPELERHYRQLNPTNAFNPGIGQLTRRHRWQEDCCATHAGDAIAAVAKAARAETAETSRTS
>NZ_CP044074.1|WP_042136225.1|267808_269152_+|MFS-transporter
MAHPSTAASPVQFDPLYRKVAWRVLPLLLLGYIIAYLDRVNVGFAKLAMLSDLGMSDAAYGLGAGIFFIGYFLFEVPSNLMLHRVGAKLWIARIMITWGLVSSLMAFTGPIAQLLGISHELTFYGLRFLLGVCEAGFFPGVILYLTYWFPAALHSRMMAIVILGNPVSFIFGGPLSGAIMYYMGSNGLLAGWQWMFVIEAVPAVVVGVVVLWLLDNGIQDARWLNQQEKAELTRRLALEAAEKPRIALKRLYALPIIWLLTVIYVLLMLGNYGINFWVPTIIKNAGVASVLDIGLITAIPYVFGAATMVWVTRQAQRTGNQRAYGALMSVLAGIGLILCAAFPQHLLLMILGVAFAVGGSLSAIALFWGLPGAFLQGAAAAAGIAIINSFGNLGGFAGPYLLGLLTTLFGSAQVGLMLLGGCLLGCAALMLWVTRRPAPSTTGLLAE
>NZ_CP044074.1|WP_150338244.1|266511_267648_+|iron-containing-alcohol-dehydrogenase
MAIINYVTEIRFGAGCAAELANVNARLGFQRPLIVTDRGVVAAGLIEQLVEQNPLAAYQVFDATPANPTEAATREGVACFRDADCDGIIAVGGGSPIDLAKAIAVSARHPGPLKQFALIEGGLTRITAATVPIVAIPTTAGTGSEVGRGAIIILDDGRKVGILSPHVIPRVAICDPLLTLSLPPHLTAATGMDAVAHCIETFLAPGFNPPAEGIALDGLRRAWRHLELAFNEPTNLEARTQMLSASLQGALAFQKGLGCVHSLSHSLGGIDPRLHHGTLNAVLLPAVVAFNRSAESVVRDEKLERLAQAMELPPQLSVEQALAHKAEALRLPTGLAQMGVDRGLIPRIVTGALADHSHRTNPREASAEDYAQLIQASF
>NZ_CP044074.1|WP_150338243.1|265546_266296_-|carbon-nitrogen-hydrolase-family-protein
MPTPTLAAAQSVSLAGDLAANLRTHLDFITAAADAGVELLLFPELSLTGYEPTLAAALTLEGTDARLRPLREACRVAGLTAVVGAPIQGPTGLQIGALILGADGSCRVHTKEYLHPGEVPPFVPGHGGDLLEVRGLKAALAICADSNHEAHADGAHARGADLYLASAVIGPTGYPADSARLAGHARRLGMPVLLANHGAPTGGYACVGRSAFWQADGGCLVAAPGDGPCLVIVRQVAGAWQGEIRTVRP
>NZ_CP044074.1|WP_144960023.1|263347_265348_-|HAMP-domain-containing-protein
MALNTIRTRYTLIFLGFIGATLAATVIGIRLWVTPDLVAAGESAVLTRVNEVGTRIYRELNQIQAQQRSITQTVPLLDSAAIDRVLPGLVDQYGDAKVFGGGIWPLPNQREQGRDKFSTFYHRDAGGKLIVNTHWNSPESLNYWEQPWFQAGLKAPAGQCVWAAAYKDAASAEPRTNCAMAIQRDGKAFGVSTIDLTLGFFNPLVDSLRKELDDTDMMIVEADGKILSNLSELGDSQILNNVSAYAARSPFVAAIQQNLGKLKGEAVVRDTYVDEHGTPHTFFLRPLAGTPWLLATALPTSLIAATNTGILKTLAAIQLPLVLLLVGIMVLALGKLMGRLGLLQRNIESLSAGDADLTRRIPVHGQDEVDAVAGAVNGFIGYLQRLIGEVGDATDRIDTGLKQLHGQAQQNGAILARHASETDQAVTAITEMSATSDSVARSASDTATLTQAANGQAERSRAVVQQASASVLALVDQVEDATLKVQAMQSDAQRINDVLGVIGGIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAGRTQQSTAEINEMLNRLQQGVSSAVAAMEMTKASCQSTAERTREVTEGLDEMSGSVVRISDLSTQIAAAAEEQSVVAGEINQNMVAVRHIVDDLVTSGQRTAESTAAVQSSNEQLIAVVRRFRVR
>NZ_CP044074.1|WP_027602507.1|261179_263153_+|BCCT-family-transporter
MTGQGESAARPTFSPPVFWTSTLLLLVLVLYASLFQANAQWLFAAIQGWIITNLSWFYILAVAIILGTVVFLGMSRYGDIKLGPDHSEPDYANTTWFAMLFSAGMGIGLMFFGVAEPVMHFLNPPYADGQTVDAARQAMRITFFHWGLHAWSIYAIVALILAYFSYRHGLPLTLRSALYPLIGERIHGPIGHAVDIFAIIGTVLGVATSLGFGVSQINTGLNVLFGVPVSTPVQIGLIVVTTALATLSVVSGLDKGVRRLSELNLGLAVLLMLTVVILGPTVLILQTFVENTGGYLSEIVSRTLNLNAYRPTDWIGGWTLFYWGWWLAWSPFVGLFIARISRGRTIREFVSGVLLVPAGFTLLWMTVFGNTAIHMILTEGITDLAAAVSQDSSLALFAFLEHFPFASVISLIAIVMVVVFFVTSADSGAMVVDMLASGGQDQTPVWQRVFWGASMGLVAIALLLADGLKALQTATIASALPFTLALLFSMHGLLKALKLDATKRGLRHQSLSLTPPTSRTPGGWQRRLRGLAMFPRRSHVVRFIGEVAKPACLAVAEEWRKQGYVCGVEDREDGGVRLYVGPAEQPEFVYQVRPHAYAMPSFVMGSEPGEERKYFRAQVYLREGGQDHDVMGWSREDVIGDILDQYERHMHFLHLVG
>NZ_CP044074.1|WP_150338242.1|260201_261059_+|helix-turn-helix-domain-containing-protein
MSSQIELPGATDWVRHAPAHAELESIEAFFSGHAFDPHRHATYAIGRTLAGVQSFSYRGARTNSLPGETMILHPDEVHDGRAGAADGFRYRMVYLPPTLVQDILGGRPLPFHREGVSLDPRLAQATEAVFAALDAQSDVLARDDALYGLVATLAEVCQAWPSRGRVDFAAALRAREYLEDHLDQAVTLDDLARCAGRDRWSLTRDFRAYFGTSPHRYLTLRRLDQVRLQVRLGRGLAEAAVAAGFYDQSHMTKHFRQTFGVAPARWFRGLAGAPGATVLAGVSDP
>NZ_CP044074.1|WP_044341430.1|259584_260184_+|LysE-family-transporter
MEIVLYAFSVIYSPGPVNALGLNAGLRGQARRALGFYAGVGCAMLVLFLALGYAGAVVVSGALLPWLALLGGGYCLYLGYRIARAAPPTAEGEGAATRLTFASGLLIQGLNPKAWLAVLPIATVMFPAAQVTGGKIALWSLPLALSACGAPASYALLGALLGRYLVRGRGFRAVNRLLGLSLVGCALLLFHDAWRGLLG
>NZ_CP044074.1|WP_150338241.1|257981_259427_-|HAMP-domain-containing-histidine-kinase
MFGSLRSRLIALLLMLGGMAVGVGWLMILLLRQSESAQLGQATVEAEQACQAIASSYRFYSNGWSGPTAGLADPTLQRSLGGVASVALLRYRGMAGGLWQEQAGLLADASPFPLTAAERQHLADLSAATLAEARSLSDSFSADGATVLVAACPLSGPIADLAAWTLTRLTFAEGSGQRQLKLGLGLLLLAMLAATLLLGRLTWQWSRHVARVERDLGANASHDLPTLALTGERELDRVLAALNQAGQRLTQARDEAQRLTTQVHASERLAALGRVAAGVAHEIRNPLAAMRLKAENALAGDSGRQRKALDAILTQVTRLDRLLRRLLDLTQPLHLQPTVIALPAFCREVLAGHEDQAAQRGIRLTARVAVEEGYFDRDALARALDNLLLNALQAAPADSEIRLDASRRGDWLVLAVEDEGQGPPAELRAQLFEPFVTGRPEGTGLGLALVRETARAHGGEARLIDPSLPTRFEILLPCQPC
>NZ_CP044074.1|WP_150338246.1|272405_274685_-|beta-glucosidase-BglX
MLNAPRLTALMLGLGLAVSATLAPAQDRDPARAYVDALLAKMTLEEKIGQLNLVSVGPDYPKEAIMADIRAGKVGAMFNTVTRPDIRQMQDQIAHSRLKIPLFYAYDVIHGMRTIFPINLGLASTWNLDAIATSGRISALEAAADGLNLTFSPTVDVTREPRWGRASETFGEDTWLTSRIGATLVHAYQGKDLRAPDSLMASIKHFGGYGAVEAGRDYSNVDMSPQRLMQDYLPPYRAAAEAGAGAVMVALNSINGVPATANRWLLQDLLRKDWNYQGLLISDHGAINELVLHGVAKDTRDAAEQALKAGVELNMHDDVYGKQLPALLAAGKVTQAEIDQAVRDMLLTKYRMGLFDDPYRRLQGQDPADTNAESRLHRAEARQVARESLVLLKNEKAVLPLRKGATLAVVGPLADSPRDVMGNWSAAGVAAQAVSIRRGLENAVAGQGKVLYAKGANLLDDRDVLAYLNSYEPAVAVDPRSASELIAEAVATARQAEVVVAVVGESQGMAHEASSRARISVPDTQRELIKALKATGKPLVLVLMNGRPLALEWEQEQANALLEAWFPGTEGGNAVADVLFGDHNPSGKLTMTFPREVGQVPLYYNHLSSGRPFDAAKPNKYTSRYFDIVNGPLYPFGYGLSYTSFEVSAPQLSSATLKKGDTLTARVTVKNTGSRAGATVVQLYLHDVTASLARPVKELKGFQKVMLQPGESRELDFPITEADLRFYNSDLKLVSEPGEFRVMVGLDSERVREGSFTLL
>NZ_CP044074.1|WP_027597154.1|274832_276110_-|glucarate-dehydratase
MKIKRITVTPIAFRDAPLLNASGIHEPYALRSIIEVEGDNGHIGLGESYGDAPVLAVLKAMESSLVGLSAWDLNGLRARVVETVAGLAGGVVAGAELAPGSHPSKQVANAYSAFEVAFLDLQARSLGIPLVELLGGAVRREVPFSAYLFLKYAEHIDAPYPPDRWGEAISPEQVVAQAARMIEENGFQSIKLKAGTLLGPDHEAACIKALRQAFPQAPLRIDPNGNWSLETSLRIAEVLKDDLQYYEDPTPGLDGMAELHRRTGIPLATNMVVTDFDEFRRSVAQNSVQIVLADHHYWGGLRDTQILARLCDTFGLGVSMHSNSHLGISLMAMTHVAAAVPNLAYACDTHYPWQEEDEEVIRGGKLPIRNGCVAITDAPGLGVELDQDQLAKLHEQFLAIDIRSRDDVRQMRKYQPDWETRKPRF
>NZ_CP044074.1|WP_150338247.1|276292_277954_+|VRR-NUC-domain-containing-protein
MKAPLEDPLYYLHNFQRVLDWVALRYPDLLDDREQAFITAFAELPQPSRALLVRLVMRKGEVFRASKLVYGEIGCPRAAASPLVELGWLLADPELHLIELFALLRKEELLGCFGNRLPKAGRKEDWLARLEAEQATPLTFSGWTATVPELVAEGVWRLTLMDLCDRLRLLFFGNLHQDWTDFVLADLGIFQYETVAFSAESRAFGQRHEVDAYLHIQRCRQALRDGLPAAELLPLLPAERFANTWLELRRGKLLHELAQHHERLGELAQAQALYAASAHPESRIRALRMLERLEDWPAAQALAEAIVAAPAHDAERQQVARILPRLVRKQGGPPNRRRPASPVERLDFELVNDGLRRVEWLVREHLGRDEAPVHYVENTLLTSLFGLLCWDAIFLAIPGAFFHPYQREPADLRLPGFRERRAEAFAACLARLDDGSYPAVIRERFASKRGLASPFVAWGILGSELLDQALACLPAQHLRLCFERLLEDPENNRTGLPDLIQFWPAEGRYRMIEVKGPGDRLQDNQRRWLDFFAAHDIPVSVCHVQWQVAATSA
>NZ_CP044074.1|WP_150338248.1|277950_280224_+|ATP-dependent-DNA-helicase
MSYRIAVRALCEFTAKAGDLDLRFTPSPTALEGIEGHQRVAARRGPGYEREVSLQGDFEDLQVRGRADGFDAAAQRLEEIKTHRGSLERQPGNHRHLHWAQAKVYGHLLCQSRELPELTLALVYFDIGTGAETVFTEQWTAADLAAHFELQCSRFLAWARQELAHRATRDAALATLAFPHPDFRHGQRPLAEAVYKAASVGCCLLAQAPTGIGKTVGTLFPLLKAMPRRNLDRLFFLAAKTPGRALALHGLESLAAPVRVLELVARDKACEHPELACHGESCPLARGFYDRLPAARAAALAEPTQLTRARVRETALAHEVCPYYLAQELARWSDVVVGDYNYYFDGSAMLHALAQTQEWRVGVLVDEAHNLLDRARGMYSASLDQRRLAAGKAVAPPAIAKGLQALNREWNRLHKEQQVDYQVQPELPAAFLTALQRVVGLLTEHFGESGQPPAPELQTLFFDLLQFMRLGETFGDHSLFDVTLLKGRGKAQSQLNLRNLVPAPFVGPRLAAAHSCTLFSATLIPQHFHRDLLGVPAGSAWVDVASPFAAEQLEVRLVRLSTRYADRAASRAPIAALIASRYRQRPGNYLAFFSSFDYLDQVAEALAELAPDVPQWRQSRGMDEAARQAFLERFQADGRGIGFAVLGGSFGEGIDLPGDRLIGAFVATLGLPQLNPVNEQLRQRLQRRFGDGYRYAYLYPGLQKVIQAAGRVIRTVQDRGCLYLIDDRFTQPEVRALLPTWWQVEEGAVPTGEPAPA
>NZ_CP044074.1|WP_144960040.1|280482_280866_-|VOC-family-protein
MAAAAIAFGPPSPILRIFDDEKAREFYCHFLGFRLVWEHRFEPGLPLYAEVERAGLRLHLSGHHGDACPGSTVFVRLTGIRAFQAELLAQDYGFARPGIEELPWGLVMEIADPFGNRLRFCEETPEA
>NZ_CP044074.1|WP_150338249.1|281097_282732_+|glucan-biosynthesis-protein-D
MQRRHLLKASLALAAYTGIPSTGLFALEAFANPANGDGQAFDFDWLKQHAKELAGQAYQPTAQKLPDTLANMTPQQFNAIGYDAKHSLWHDLKGQLDVQFFHVGMGFKTPVRMFSVDPKTNEAKEVHFRPELFNYNDSGVDKSQLKGDLGFAGFKLFKAPHLAQYDIVSFLGASYFRAVDKTRQYGLSARGLAIDTYADRPEEFPDFTKFWFVTPNKNSTRFVVYALLDSPSATGAYRFDIDCLNDRVVMDVDANVNARRDIKQLGIAPMTSMFGCGTHERQTCNTYHPQIHDSDRLAMWKGNGEWICRPLNNPPKLQFNAFKDDSPKGFGLVQTDHEFESYQDVMVRYDRRPSLWVEPTSAWGEGAIQLLEIPTTGETLDNIVAFWAPAETITAGKSLHYGYKLHWSALPPVSTPLARVYATRSGIGGFPEGWAPGEHWPKVWARRFAIDFNGGGLSFLPEGTGIEPVVTVTDGKVQDFHVLKIDEIGGYRVIFDWYPTSDKADPVQMRAFIRTQDRALSETWLYQYFPPAADQRRYPDWKQS
>NZ_CP044074.1|WP_027597149.1|282819_283554_-|GGDEF-domain-containing-protein
MTASVRRCSPAEAGPDLFEQEAGVLQAARALYGADDADAERYRAALGDLTLHFERLMRETRRLIARSDRAEREMNALNQQLQTLSQQLEYRATHDALTGMLNRGAVIDQAGQALRQRGGAMIVLDIDHFKRINDEFGHPAGDRVIQAIARCLQELVQAPAIVGRVGGEEFTVLLPTLARDEALAMTERLRLRIAREATGTAPVTASFGLSLNLPGTDFELAYGLADAALYRAKRAGRNQVVLAD
>NZ_CP044074.1|WP_007159605.1|283550_283940_-|DUF1987-domain-containing-protein
MDTMFIAPTATSPEVDFRFAEDELWLKGESFPENAAAFYLPVIESLRAYLDQRRDARIRVHVALAYFNSSSTKMLFTLFDALDQAAQAGNRVELHWYYDAEDETIQEFGEELRLDFQALTFIEHPELPA
>NZ_CP044074.1|WP_074583828.1|283958_284522_-|hypothetical-protein
MTASFPANGAFLDIAQQQHVIFYHRGYFSHGIVAAMAEVVKLQLEFEGISGATRRKLFSSFIELSQNVLHYSADALPPDALADTKLGQGSVCITRQDGNYQMLCANPIASDKVDALRERLEPLCSMSLDQIKQAYRESLRAETPADSKGAGLGFLTMARDASAPLEFAFHPSTQTPGTTLFCLKAII
>NZ_CP044074.1|WP_150338250.1|284527_285754_-|SpoIIE-family-protein-phosphatase
MSSAPLPSARAASRPSQRCALDLCTQWPAVEAEHTNAMVMDLFNERREITSLAVVEHDRPIGLINRDIFLSQMSKPYHREVYDRKSCIAFMDKEPLVVDAGLSIEELTRRTVEVGEKALADGFIVTREGRFAGLGLGVQLMRIVSDLQAEKNRQIMHSIEYASVIQRAMLRSSREALAVMEQDATLVWQPRDVVGGDFYHFAQHADGWFGAIADCTGHGVPGAFMTLIASASLTQALQQLGPRDPSALLSAINASVKAMLGQSGGISESNDGLDLACFWVDRGSHSLTYAGARMPLHLLAPDAADVLTLAPLRLGIGYADSPLDQCWPATTLPLPPGSLLFATTDGLIDQIGGPRRTSFGKRRALTRLSESRALPTAAFCEQLSADLAHWQGDEMRRDDLTFLCIRVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044074_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044074_2

2148921-2149048

Orphan

Consensus_repeat	Method
TCCGGGTGAGGAGTTGAACGCACATGGACAAGGCTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044074_2

>merge|NZ_CP044074|2|2148921-2149048|CRISPRCasFinder
TCCGGGTGAGGAGTTGAACGCACATGGACAAGGCTGTGCCGTTGTCTACCCTACGACGCCCACCTCGTAGCCTGGAAAACCGCGTAGCGTTCTCCGGGTGAGGAGTTGAACGCACGTGGACAAGGCTG

>NZ_CP044074|2|2|2148921-2149048|CRISPRCasFinder
TCCGGGTGAGGAGTTGAACGCACATGGACAAGGCTG	TGCCGTTGTCTACCCTACGACGCCCACCTCGTAGCCTGGAAAACCGCGTAGCGTTC
TCCGGGTGAGGAGTTGAACGCACGTGGACAAGGCTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044074.1\|WP_150338962.1\|2136498_2137359_-\|acyl-CoA-thioesterase-II	unknown	unknown	gnl\|CDD\|224857
NZ_CP044074.1\|WP_150338976.1\|2155305_2156043_-\|proteasome-type-protease	unknown	unknown	gnl\|CDD\|239734
NZ_CP044074.1\|WP_007158996.1\|2152391_2152886_+\|peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|182734
NZ_CP044074.1\|WP_150338970.1\|2145491_2147384_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|277335
NZ_CP044074.1\|WP_007158986.1\|2139143_2139776_+\|exopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|368723
NZ_CP044074.1\|WP_042133367.1\|2141642_2142884_+\|glutathione-dependent-formaldehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|176243
NZ_CP044074.1\|WP_007159008.1\|2156938_2157892_-\|alpha-E-domain-containing-protein	unknown	unknown	gnl\|CDD\|377234
NZ_CP044074.1\|WP_150338964.1\|2137530_2139147_+\|PAS-domain-containing-protein	unknown	unknown	gnl\|CDD\|237425
NZ_CP044074.1\|WP_108581107.1\|2156141_2156942_-\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|224224
NZ_CP044074.1\|WP_150338972.1\|2147522_2148839_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|236722
NZ_CP044074.1\|WP_150338966.1\|2140711_2141488_+\|NYN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350237
NZ_CP044074.1\|WP_150338974.1\|2149171_2150557_-\|cysteine--tRNA-ligase	unknown	unknown	gnl\|CDD\|234705
NZ_CP044074.1\|WP_150338968.1\|2142930_2144184_+\|TIGR03862-family-flavoprotein	unknown	unknown	gnl\|CDD\|274820
NZ_CP044074.1\|WP_007159009.1\|2157954_2159364_-\|circularly-permuted-type-2-ATP-grasp-protein	unknown	unknown	gnl\|CDD\|225190
NZ_CP044074.1\|WP_074584242.1\|2153795_2154608_+\|HDOD-domain-containing-protein	unknown	unknown	gnl\|CDD\|370050
NZ_CP044074.1\|WP_027601870.1\|2150556_2152245_-\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	unknown	unknown	gnl\|CDD\|235424
NZ_CP044074.1\|WP_007159010.1\|2159621_2159963_-\|ribonuclease-E-inhibitor-RraB	unknown	unknown	gnl\|CDD\|377727
NZ_CP044074.1\|WP_042133369.1\|2139772_2140699_+\|histone-deacetylase	unknown	unknown	gnl\|CDD\|212519
NZ_CP044074.1\|WP_058791591.1\|2152882_2153611_+\|UDP-2,3-diacylglucosamine-diphosphatase	unknown	unknown	gnl\|CDD\|235420
NZ_CP044074.1\|WP_081398852.1\|2144393_2145473_+\|FUSC-family-protein	unknown	unknown	gnl\|CDD\|379231

Protein	Function_ID	Function_description	E-value
NZ_CP044074.1\|WP_150338962.1\|2136498_2137359_-\|acyl-CoA-thioesterase-II	gnl\|CDD\|224857	COG1946, TesB, Acyl-CoA thioesterase [Lipid metabolism].	3.7655e-141
NZ_CP044074.1\|WP_150338976.1\|2155305_2156043_-\|proteasome-type-protease	gnl\|CDD\|239734	cd03765, proteasome_beta_bacterial, Bacterial proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.	1.0751e-140
NZ_CP044074.1\|WP_007158996.1\|2152391_2152886_+\|peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|182734	PRK10791, PRK10791, peptidylprolyl isomerase B.	1.60476e-83
NZ_CP044074.1\|WP_150338970.1\|2145491_2147384_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|277335	cd07389, MPP_PhoD, Bacillus subtilis PhoD and related proteins, metallophosphatase domain. PhoD (also known as alkaline phosphatase D/APaseD in Bacillus subtilis) is a secreted phosphodiesterase encoded by phoD of the Pho regulon in Bacillus subtilis. PhoD homologs are found in prokaryotes, eukaryotes, and archaea. PhoD contains a twin arginine (RR) motif and is transported by the Tat (Twin-arginine translocation) translocation pathway machinery (TatAyCy). This family also includes the Fusarium oxysporum Fso1 protein. PhoD belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	5.16042e-24
NZ_CP044074.1\|WP_007158986.1\|2139143_2139776_+\|exopolysaccharide-biosynthesis-protein	gnl\|CDD\|368723	pfam06055, ExoD, Exopolysaccharide synthesis, ExoD. Among the bacterial genes required for nodule invasion are the exo genes. These genes are involved in the production of an extracellular polysaccharide. Mutations in the exoD result in altered exopolysaccharide production and defects in nodule invasion.	6.83003e-40
NZ_CP044074.1\|WP_042133367.1\|2141642_2142884_+\|glutathione-dependent-formaldehyde-dehydrogenase	gnl\|CDD\|176243	cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc-dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	0
NZ_CP044074.1\|WP_007159008.1\|2156938_2157892_-\|alpha-E-domain-containing-protein	gnl\|CDD\|377234	pfam04168, Alpha-E, A predicted alpha-helical domain with a conserved ER motif. An uncharacterized alpha helical domain containing a highly conserved ER motif and typically found as a tandem duplication. Contextual analysis suggests that it functions in a distinct peptide synthesis/modification system comprising of a transglutaminase, a peptidase of the NTN-hydrolase superfamily, an active and inactive circularly permuted ATP-grasp domains and a transglutaminase fused N-terminal to a circularly permuted COOH-NH2 ligase domain.	5.35208e-105
NZ_CP044074.1\|WP_150338964.1\|2137530_2139147_+\|PAS-domain-containing-protein	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	0
NZ_CP044074.1\|WP_108581107.1\|2156141_2156942_-\|transglutaminase-family-protein	gnl\|CDD\|224224	COG1305, COG1305, Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism].	9.02073e-46
NZ_CP044074.1\|WP_150338972.1\|2147522_2148839_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|236722	PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional.	4.12049e-155
NZ_CP044074.1\|WP_150338966.1\|2140711_2141488_+\|NYN-domain-containing-protein	gnl\|CDD\|350237	cd11297, PIN_LabA-like_N_1, uncharacterized subfamily of N-terminal LabA-like PIN domains. This N-terminal LabA-like PIN domain is found in a well conserved group of mainly bacterial proteins with no defined function, which contain a C-terminal LabA_like_C domain. LabA from Synechococcus elongatus PCC 7942, (which does not contain this C-terminal domain), has been shown to play a role in cyanobacterial circadian timing. The LabA-like C-terminal domains characteristic of this subfamily may be related to the LOTUS domain family (which also co-occurs with LabA-like N-terminal domains). The function of the N-terminal domain is unknown. The LabA-like PIN domain family also includes the N-terminal domain of limkain b1, a human autoantigen localized to a subset of ABCD3 and PXF marked peroxisomes. Other members are the LabA-like PIN domains of human ZNF451, uncharacterized Bacillus subtilis YqxD and Escherichia coli YaiI. Curiously, a gene labeled NicB from Pseudomonas putida S16, which is described as a putative NADH-dependent hydroxylase involved in the microbial degradation of nicotine also falls into the LabA-like PIN family. The PIN (PilT N terminus) domain belongs to a large nuclease superfamily. The structural properties of the PIN domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions; in some members, additional metal coordinating residues can be found while some others lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	2.0666e-67
NZ_CP044074.1\|WP_150338974.1\|2149171_2150557_-\|cysteine--tRNA-ligase	gnl\|CDD\|234705	PRK00260, cysS, cysteinyl-tRNA synthetase; Validated.	0
NZ_CP044074.1\|WP_150338968.1\|2142930_2144184_+\|TIGR03862-family-flavoprotein	gnl\|CDD\|274820	TIGR03862, flavo_PP4765, uncharacterized flavoprotein, PP_4765 family. This model describes a sharply distinctive clade of proteins within the larger family of flavoproteins described by pfam03486 and TIGRFAMs model TIGR00275. The function is unknown.	1.36089e-164
NZ_CP044074.1\|WP_007159009.1\|2157954_2159364_-\|circularly-permuted-type-2-ATP-grasp-protein	gnl\|CDD\|225190	COG2308, COG2308, Uncharacterized conserved protein [Function unknown].	0
NZ_CP044074.1\|WP_074584242.1\|2153795_2154608_+\|HDOD-domain-containing-protein	gnl\|CDD\|370050	pfam08668, HDOD, HDOD domain.	1.17991e-52
NZ_CP044074.1\|WP_027601870.1\|2150556_2152245_-\|glutamine--tRNA-ligase/YqeY-domain-fusion-protein	gnl\|CDD\|235424	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional.	0
NZ_CP044074.1\|WP_007159010.1\|2159621_2159963_-\|ribonuclease-E-inhibitor-RraB	gnl\|CDD\|377727	pfam06877, RraB, Regulator of ribonuclease activity B. This family of proteins regulate mRNA abundance by binding to RNaseE and inhibiting its endonucleolytic activity. A subset of these proteins are predicted to function as immunity proteins.	8.06886e-22
NZ_CP044074.1\|WP_042133369.1\|2139772_2140699_+\|histone-deacetylase	gnl\|CDD\|212519	cd09993, HDAC_classIV, Histone deacetylase class IV also known as histone deacetylase 11. Class IV histone deacetylases (HDAC11; EC 3.5.1.98) are predicted Zn-dependent enzymes. This class includes animal HDAC11, plant HDA2 and related bacterial deacetylases. Enzymes in this subfamily participate in regulation of a number of different processes through protein modification (deacetylation). They catalyze hydrolysis of N(6)-acetyl-lysine of histones (or other proteins) to yield a deacetylated proteins. Histone deacetylases often act as members of large multi-protein complexes such as mSin3A or SMRT/N-CoR. Human HDAC11 does not associate with them but can interact with HDAC6 in vivo. It has been suggested that HDAC11 and HDAC6 may use non-histone proteins as their substrates and play a role other than to directly modulate chromatin structure. In normal tissues, expression of HDAC11 is limited to kidney, heart, brain, skeletal muscle and testis, suggesting that its function might be tissue-specific. In mammals, HDAC11 proteins are known to be involved in progression of various tumors. HDAC11 plays an essential role in regulating OX40 ligand (OX40L) expression in Hodgkin lymphoma (HL); selective inhibition of HDAC11 expression significantly up-regulates OX40L and induces apoptosis in HL cell lines. Thus, inhibition of HDAC11 could be a therapeutic drug option for antitumor immune response in HL patients.	1.80967e-131
NZ_CP044074.1\|WP_058791591.1\|2152882_2153611_+\|UDP-2,3-diacylglucosamine-diphosphatase	gnl\|CDD\|235420	PRK05340, PRK05340, UDP-2,3-diacylglucosamine hydrolase; Provisional.	4.17206e-131
NZ_CP044074.1\|WP_081398852.1\|2144393_2145473_+\|FUSC-family-protein	gnl\|CDD\|379231	pfam13515, FUSC_2, Fusaric acid resistance protein-like.	5.17261e-12

>NZ_CP044074.1|WP_150338972.1|2147522_2148839_+|DEAD/DEAH-box-helicase
MTFADLGLIDPLLQALTALEHSSPTPIQRQAIPAVLAGRDLLAAAQTGTGKTGAFGLPLLQRLVQEGPAVTPNHIRALILTPTRELAEQVHASLRDYAQHLPLRTAVAYGGVSINPQMMKLRKGVDVLVATPGRLLDLFNQNAVRFDQVQLLVLDEADRMLDLGFSRQLGELFVMLPRKRQTLLFSATFSDAVRQLAAPVLRDPQTIDVSPRNTAAVTVKQWVVPVDKKRKTELFLHLYRSGRHGQVLVFAKTRKGVEQLVEALQAEGLAAESIHGDKPQPARLRSLARFKAGEADILVATDVAARGLDIQDLPLVVNLDLPIVAEDYVHRIGRTGRAGNQGQAVSLVCADEVEQLAAIETLIGQILMRRDEPDFIPDHRVPQTGPGGLVMKKPKKPKKPKVGGPASDKPLGRWVEDGKPKVKSVRKAPGFGKARKKP
>NZ_CP044074.1|WP_150338970.1|2145491_2147384_-|alkaline-phosphatase-family-protein
MSATPTLPPVLAGPLLRRTEASRLLLWLVTRSAETPVPRLWQGATELGVQGETQCLRLGEQAYLQLIEVRPDTELPTDTFLRYDLQLSAGGIRDWAPHLLSAEGELPRFVLRARFDHLLHGSCRKPHHASADGLIAVDRLLQGCTTPEESPAALLLTGDQVYADDVAGPMLLAVQALTRRLGLYGEDLEGAVVADSEALMAHAANLYHREDLLPAFKSNRALREKFFGGVEKPIFTSTNAHNHLVTLSEVLALYLLCWSPTPWTLIEVVPPALDAKDGERYAAESRCIEGFVATLPQAARALAGVPTLMIFDDHDVTDDWNLSARWEETAYGHPFSRRILGNALLAYLLCQAWGNAPEAVAEPLAATARLLDTAGDDGKLECPAQNACIDDLLRFQGWHYVLKTSPPLIVLDTRTRRWRSERRLEHPSGLMDWEALCELQQDLLDHPSAVIVSAAPMFGVKLIEAVQRIFTWFGQPLMVDAENWMAHPGAAKTMLNIFRHRRTPGNYVVLSGDVHYSFVYDIRIRDRRGEPRLWQITSSGIKNEFPPRLLATLDRLNRWLYAPWSPLNGFTKRRRWELQPRLPDRREAGERLWNGAGIGQVLLDGEGRPAVIRQHNADGSPATEFVERPA
>NZ_CP044074.1|WP_081398852.1|2144393_2145473_+|FUSC-family-protein
MLRDLAGDLRQFGRDRRRLVDELETLTSVLLAILLGHLAGVQHVGWAAFSGYIVMRSDVRDSFSRGCLRVLGTCIGAAGALLVLRHLQLNPYEQAVLLGTVGSITLYLTLVGRYGYAWLLGGLTYAMVVLASLQAPDQLEQYALSRLLEVALGTSACVLVSALSTYGVRARLWPKVPTTVASTPRTLGVWQPLALRHALQGGLALALLSLGATAEIGVDVSQAAITILAVMVVPFDGLSSAGKAVSRRLLHRMLGCLLGGGLAALLLLVSQESLWLTLAGVALGVLIGRHLENGPLGIGYLGMQFALAFLVVMVPDHYDHIDPVAGLARLGGILLGFLVLEPVYWLSTWLIRRLSPGRP
>NZ_CP044074.1|WP_150338968.1|2142930_2144184_+|TIGR03862-family-flavoprotein
MSLLSATPAVAVIGGGPAGLMAAETLAAAGVHVDLFDAMPSVGRKFLLAGVGGMNITHAEEQSAFRQRYRERESGVSPWLDSFDSNALRAWIHELGIETFVGTSGRVFPADMKAAPLLRAWLHRLRDQGVCIHIRSRWLGWDAEGRLRLATPEGERLLQPQATVLALGGGSWPRLGSDGAWQALLAARGVELRPLEPANCGFEVAGWSDFLKTRHAGAPIKPAALALPGQPPRQGEFVLTDTGIEGSLVYALSAEIRTAIERDGQATLTLDLAPQRDLAELGRALAKPRGSQSLANHLRRHAGIDGARAALLRELAPPETFQDMGRLAQACKAVPLTVVRARPLAEAISSAGGVPLEALDDGLMLRQLPGVFCAGEMLDWEAPTGGYLLTACFASGRAAGQGVLRWLADGGSSDRRT
>NZ_CP044074.1|WP_042133367.1|2141642_2142884_+|glutathione-dependent-formaldehyde-dehydrogenase
MRALTYHGAHDVRVDTVPDPTIQDADDIVLRVTATAICGSDLHLYRGKIPTVEHGDIFGHEFMGIVEETGPAVTAVQKGDRVVIPFVIACGSCFFCNQDLYAACETTNTGRGAILNKKQIPPGAALFGFSHLYGGVPGGQAEYVRVPKANTGPFKVPGTLADEKVLFLSDILPTAWQAVLNTGIGQGSSIAIYGAGPVGLLSAACARMLGAERIFMVDHHPYRLAYAQQTYGVIPINFDEDDDPAATIIEQTPGKRGVDGVVDAVGFEAKGSTTETILANLKLEGSSGKALRQCIAAVRRGGTVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVQRYLPELLEHIERGDLAPEAIITHRMSLEQAVEGYKIFDKKQEDCRKVILTPGRSEPLIPERLEEPLAAPLGQAGVV
>NZ_CP044074.1|WP_150338966.1|2140711_2141488_+|NYN-domain-containing-protein
MSKTAKTPESSQARLAVLIDADNAPAAIVDGLMAEIARFGVASVKRIYGDWTQPQLNSWKKVLLDHSIQPVQQFGYTKGKNATDSALIIDAMDLLYTRRFDGFCLVSSDSDFTRLAARLREEGLTVYGFGEEKTPDPFVSACDRFIYTEILRSKPREEPREAAGASDKPATTNRGKPKLSTILKLIEQAVEDASDEGGWANLGMVGANLGKVRPDFDARLYGHRKFSGLVKAHGDRFDVQERDPADGSAGKAVYIRNR
>NZ_CP044074.1|WP_042133369.1|2139772_2140699_+|histone-deacetylase
MSTRLPLVYHEDYSPPFPAGHRFPMEKFRLLHEHLSASGILGADNWQRPELCPDELLALAHAPDYIQAFKAGELPPPLQRQLGLPWSEALVRRTIRAVGGSLLTLELALRHGLACHLAGGTHHAHHDYPAGFCIFNDLAILALSLLESGRAGRVLILDCDVHQGDGTARILAEVPDAVTVSLHCATNYPARKAQSDWDIPLPRGLDDAGYLRVLDDALGYLLPLHQPDVVLYDAGVDVHRDDALGYLELTDAGLAARDGFVLRRCLAADIPVVGVIGGGYSADRLALARRHGILHHTATQVWHELGLH
>NZ_CP044074.1|WP_007158986.1|2139143_2139776_+|exopolysaccharide-biosynthesis-protein
MKEEALEREPASCDTGQDGPVDLQSFLACLERVGNSPSQVSVQHLIDAIGSRSFGPMILLPGVLAISPLTGIPGIATAIAVFVMLVSGQLLLGRDHFWLPRWVLQRSVSRGKLRKSLRLLQKPARWVDKVVKSRLRVLTSRPAHFVTALLCILIAATMPVLDLVPFANTTAGLALTSFALSLIARDGLLFLLALGFCTGILWFILELLVF
>NZ_CP044074.1|WP_150338964.1|2137530_2139147_+|PAS-domain-containing-protein
MTETANASSSHPAAAQIAELGKGLGHDDIFFAAVKKTRMPMIVTDPHQPDNPIIFANESFLRTTGYALDEVLGRNCRFLQGPDTRQEHIAEIRNAIREQRDCDIELLNYRKDGSTFWNALFISPVLNPAGQLRYFFASQLDVSRRRDAEDALRQAQKMEALGQLTGGIAHDFNNLLQVMVGYLDILRINLDRPELDRDKAKRHVDNTRDAVNRAATLTQQLLAFARKQRLTGRAVDLNKLINARQSRLAQALGGPFRFIFRPAPALWNCRLDPIQLETALLNIVDNARLAMQERGTGTLTLETLNVEVNGQDLAHGGLAQGHYVCIALTDTGCGMSTDVLGRALDPFFTTRDEGQGSGLGLSMVYGFLKQSGGLVRLYSEVGIGTSVRLYFPVSEEEAREHPAPLPTPHEDSGGSETILVVDDRPDVAALAQAILEETGYQVLVAHNGQQALDILAREPAIDLLFSDLIMPGGMNGVMLAKEAQRRQPELRILLTTGYANNALELEEGNGERFPILNKPYGRQDLTRWIRRMLDSAQP
>NZ_CP044074.1|WP_150338962.1|2136498_2137359_-|acyl-CoA-thioesterase-II
MSKVLDNLVDLLTLESLAPDLYRGGSQDLGFPQLFGGQVLGQALSAASQTVPMERRVHSLHGYFLRAGSAVEAVTYQVDRIRDGGSFSTRRVTAFQGEQPIFFCSASFHIEEPGFEHQTTMPEVPAPETLQSEIAHAQRYAELIPAPLRDKLLGPRPIEMRPVVFTDPFQPQPTEPVRHVWFRATGDLPDQPALHRYLLAYASDFNLLPSSLLPHGTSFWDRSLQIASLDHAVWFHRDFRLDDWLLYAIDSPWAGGARGLCRGSIYNRAGQLVASVAQEGLIRKRG
>NZ_CP044074.1|WP_150338974.1|2149171_2150557_-|cysteine--tRNA-ligase
MALHLYNTLTKTKEAFTPLVPGQVRMYVCGMTVYDYCHLGHGRSMVAFDVITRWLRHSGYDLTYVRNITDIDDKIINRANANGEPFTDLVARMIEAMHEDEARLNIRKPDQEPRATDHIDGMHAMIQTLIDKGYAYAAGNGDVYYRVNRFAGYGKLSRRRVEDLRIGARIEPGEAKEDPLDFVLWKAAKPGEPSWASPWGEGRPGWHIECSVMSTCCLGETFDIHGGGNDLEFPHHENEIAQSEAATGKTYANAWLHCGMITINGEKMSKSLGNFFTLREVLEKYHPEVVRYLLIASHYRSPINYSEDNLREAKGALERFYHSLKGLPQAPAQGGESYAERFAQCMDDDFNTAGACGVLFELAREINRLRESDPAAAAGLAGRLRELGEVLGVLQLEPEAFLRADSAGRVDAAEVEALIQARLAARAEKNWAESDRIRDQLTALGVVLEDGKGGTTWRLAE
>NZ_CP044074.1|WP_027601870.1|2150556_2152245_-|glutamine--tRNA-ligase/YqeY-domain-fusion-protein
MSKPTSDSSTAAKAAPAHFLRQIVQADLDAGKQAKIVTRFPPEPNGYLHIGHAKSICVNFGLAKEFGGDCHLRFDDTNPAKEDQEYIDAIKSDVHWLGFDWAGEVRYASSYFDQLYAWAVNLIEQGLAYVCDLTPEQAREYRGSLTEPGRNSPFRDRSVAENLDLFARMKAGEFKDGEKVLRAKIDMASPNMNLRDPILYRIRHAHHHQTGDAWCIYPSYDFTHGQSDALEGVTHSICTLEFEDHRPLYEWFLAKLPVPAQPRQYEFARLNLNYTVTSKRKLKQLVDEGHVQGWDDPRMSTLSGYRRRGYTPAAIRNFCEMIGVTRSNGVVDVAMLEFAIREDLDQNAPRAMCVLKPLKVVITNYPEGQVENLELARHPKQDLGVRQLPFTRELYIDQGDYEENPPKGYKRLEPGGEVRLRGSYVIRADEAIKDADGKVIELRCSYDPDTLGKNPEGRKVKGVIHWVPAEGSVECEVRLYDRLFRSAQPEKSEEGGSFLDNINPESLVVLKGCRAEPSLAQAQPEDRFQFEREGYFCVDLKDSAPGKPVFNRTVTLRDSWGQ
>NZ_CP044074.1|WP_007158996.1|2152391_2152886_+|peptidyl-prolyl-cis-trans-isomerase
MIKLHTNHGVITLELFEDKAPETAANFKEYVKSGHYDGTIFHRVISNFMVQGGGFEPGMKQKPTRAPIKNEANNGVSNAIGTVAMARTMDPHSASAQFFINVSDNTFLNHTAPTSQGWGYAVFGKVVEGMDVVNAIKGVATTSKAGHQDVPSEDVIIEKAEIVE
>NZ_CP044074.1|WP_058791591.1|2152882_2153611_+|UDP-2,3-diacylglucosamine-diphosphatase
MILLVSDLHLEPQRPDLVRAFLHLLETRARGAEALYILGDLFEAWIGDDAMGAFEQEIATALRQLADSGTALYLMHGNRDFLIGKAFCRQAGCRLLPDRHIADFHGRRVLLMHGDTLCTRDEGYQKLRRILRNPLTLFVLRHLPLASRQKLARKLRSESRQQTRAKAMDITDVTEAEVEREMRTARVTTLIHGHTHRPARHELLLDGQPAERIVLGDWDRRGWVLEASAAGLSQVDFALDER
>NZ_CP044074.1|WP_074584242.1|2153795_2154608_+|HDOD-domain-containing-protein
MQLDTLFAQLHNLPNVPEVAQVLIRQFDDPNTSIETLSRTVARDPVIAAKVLRLANSARFRGARESTSIEDAALRLGFNTLRTLVLASAFASGFKAAPGFDLQAFWYNSFLVASLCKPLAKQAGLDQETAFTCGMLHDIGELLIQSGAPELAPSLAGRATASSHRAADETLQLGFGYPEVGAELARRWQLPQVLRDAIGYQARPLQAPEGNGYALIVAQAVAVAEVLHENAGDSKVQDLSGPLFASIDLEQLTAVLPNARDTAATFAQAA
>NZ_CP044074.1|WP_150338976.1|2155305_2156043_-|proteasome-type-protease
MTYCVAMKLQDGLVFVADSRTNAGVDNIATFRKLHLFRIPGERLIIIQSAGNLATSQAVISLLRQRLDSEQDNLHGVPTLYDAARLLGQTLREVLQRDAEDAPSGHGLDLSCSFLLGGQIRGAEPELFNLYPHGNFISATEDTPYFQIGESKYGKPILDRALSFATPLEEALRCALLSYDATIRSNLSVGLPLDLVVYPRDRLAQVSSHRIDEQDPYFQALRKGWGEGLRDLLAALPAAPADYWR
>NZ_CP044074.1|WP_108581107.1|2156141_2156942_-|transglutaminase-family-protein
MRLAIHHETLYRYADQVRASIQYLRLTPQDDARQRILGWELALPRPARAQRDPFGNILHVLTLDTPHDAITITASGQVEIDETFEAEPCQASAFPFLRQTRLTEADEALTAFAREVCDGRRDRDTLIQLMERLHERMTYVPGSTEVDGNAAQAFAKGAGVCQDHAHAFLACARSLGIPARYVSGYLCTDDSAHLSSHAWAEAWHDGAWYSYDVTNRLARPERHLRLAIGLDYLDACPVRGMRRGGGVEHMEARVMVEPLQQAQQQQ
>NZ_CP044074.1|WP_007159008.1|2156938_2157892_-|alpha-E-domain-containing-protein
MLSRTAADLYWMSRNLERAENLARMLDVSYSLSMMPQSGQGGGLDELAMPLLITGTLDDYREKHGALHPERLLHFFALDERNPGSIYCCLQAARSNAHAVRGRITADMWENVNSTWLEMREIAVTGLIRFGISRFCEWVKERSHLFRGATVGTIMRNDAYRFIRLGTFVERADNTLRMLDARYQVLGEEEAEAISDASARGFYQWSALLRALSAFEAYTELYRDALNVRNGAELLLLQEDLPRSLLACVIELHRVLASLPGENGREAKRLAAGLEARLRYTSIDEVLEEGLHAWIGDFIVHVRQLGSAINTAYLETV
>NZ_CP044074.1|WP_007159009.1|2157954_2159364_-|circularly-permuted-type-2-ATP-grasp-protein
MSRQLYNEMYDVQAQCRPHYGRYAQWLSETPPELLAQRRREADLLFHRAGITFTLYGDEQGTERLIPFDALPRAIPASEWQIIERGCIQRVQALNLFLHDLYHDQRIIKAGVIPAEQVLANDQYQLAMQGLDLPNGIYAHIAGVDLVRDGDGAYYVLEDNLRTPSGVSYMLENRKMMMRLFPELFTLERIAPIDHYPNLLLDTLRSSTPVNNPTVAVLTPGRFNSAYFEHAFLAREMGVELVEGADLLVRDEQVFMRTTSGFQKVDVIYRRLDDAFLDPLAFNPDSLLGVPGLLAAYRAGNVILANAIGTGVADDKSIYPYVPEMIRFYLSEEPILYNVPTWQCRKPDELSHVLANLPELVVKEVHGSGGYGMLVGPTASSMEIEAFRARLKANPSAYIAQPTLSLSTCPTFVENGIAPRHIDLRPFVLSGRKTRLVPGGLTRVALREGSLVVNSSQGGGTKDTWVVQD
>NZ_CP044074.1|WP_007159010.1|2159621_2159963_-|ribonuclease-E-inhibitor-RraB
MSLSFADDVSLNLLQRMKEGGFDFARFHPIDFFAIFADEGKARIAADQFHGESLNAQVMPHEEGGWHLQVSKVMFATHATIDDFESDLEAVVVPLGGQLDGWGVTQEVSRSSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044074_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044074_3

2432334-2432420

Orphan

Consensus_repeat	Method
GGGAGAGGGCCAGGGTGAGGGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044074_3

>merge|NZ_CP044074|3|2432334-2432420|CRISPRCasFinder
GGGAGAGGGCCAGGGTGAGGGCCTAACCCCCACCCGCGCACCGCTCTAGATCCCCTCTCCCTCCGGGAGAGGGCTAGGGTGAGGGCC

>NZ_CP044074|3|3|2432334-2432420|CRISPRCasFinder
GGGAGAGGGCCAGGGTGAGGGCC	TAACCCCCACCCGCGCACCGCTCTAGATCCCCTCTCCCTCC
GGGAGAGGGCTAGGGTGAGGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044074.1\|WP_150339137.1\|2433766_2434765_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044074.1\|WP_027598061.1\|2420481_2420937_-\|phosphohistidine-phosphatase-SixA	unknown	unknown	gnl\|CDD\|224973
NZ_CP044074.1\|WP_027601621.1\|2424662_2425877_+\|sugar-MFS-transporter	unknown	unknown	gnl\|CDD\|340952
NZ_CP044074.1\|WP_150339141.1\|2438265_2439141_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176166
NZ_CP044074.1\|WP_150339143.1\|2439317_2440076_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187602
NZ_CP044074.1\|WP_150339145.1\|2440082_2440826_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP044074.1\|WP_077172375.1\|2432462_2433713_+\|ribonucleotide-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|235968
NZ_CP044074.1\|WP_027598064.1\|2426290_2427640_-\|dicarboxylate/amino-acid:cation-symporter	unknown	unknown	gnl\|CDD\|234968
NZ_CP044074.1\|WP_027598973.1\|2442456_2443476_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP044074.1\|WP_007160483.1\|2421264_2422287_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|234629
NZ_CP044074.1\|WP_150339139.1\|2437678_2438209_+\|transposase	unknown	unknown	gnl\|CDD\|224854
NZ_CP044074.1\|WP_007160484.1\|2422664_2423180_+\|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA	unknown	unknown	gnl\|CDD\|179953
NZ_CP044074.1\|WP_007160503.1\|2440923_2441391_+\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349971
NZ_CP044074.1\|WP_042132871.1\|2428017_2428758_+\|4'-phosphopantetheinyl-transferase-superfamily-protein	unknown	unknown	gnl\|CDD\|225524
NZ_CP044074.1\|WP_027598066.1\|2429366_2432282_+\|ribonucleoside-diphosphate-reductase-subunit-alpha	unknown	unknown	gnl\|CDD\|235966
NZ_CP044074.1\|WP_027598974.1\|2443472_2444339_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224097
NZ_CP044074.1\|WP_042138046.1\|2441387_2442218_-\|IclR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332
NZ_CP044074.1\|WP_150339135.1\|2420933_2421233_-\|DUF4389-domain-containing-protein	unknown	unknown	gnl\|CDD\|379561
NZ_CP044074.1\|WP_027598063.1\|2423191_2424409_+\|beta-ketoacyl-ACP-synthase-I	unknown	unknown	gnl\|CDD\|181184
NZ_CP044074.1\|WP_017641977.1\|2420017_2420461_-\|hotdog-fold-thioesterase	unknown	unknown	gnl\|CDD\|182360

Protein	Function_ID	Function_description	E-value
NZ_CP044074.1\|WP_027598061.1\|2420481_2420937_-\|phosphohistidine-phosphatase-SixA	gnl\|CDD\|224973	COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms].	3.15421e-27
NZ_CP044074.1\|WP_027601621.1\|2424662_2425877_+\|sugar-MFS-transporter	gnl\|CDD\|340952	cd17394, MFS_FucP_like, Fucose permease and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of L-fucose permease (also called L-fucose-proton symporter) and similar proteins such as glucose/galactose transporter and N-acetyl glucosamine transporter NagP. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. Glucose/galactose transporter functions in the uptake of of glucose and galactose. The FucP-like subfamily belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.7112e-147
NZ_CP044074.1\|WP_150339141.1\|2438265_2439141_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176166	cd08477, PBP2_CrgA_like_8, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 8. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.88374e-74
NZ_CP044074.1\|WP_150339143.1\|2439317_2440076_+\|SDR-family-oxidoreductase	gnl\|CDD\|187602	cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR. This subgroup resembles the SDR family, but does not have a perfect match to the NAD-binding motif or the catalytic tetrad characteristic of the SDRs. It includes the SDRs, Q9HYA2 from Pseudomonas aeruginosa PAO1 and APE0912 from Aeropyrum pernix K1. BKR catalyzes the NADPH-dependent reduction of ACP in the first reductive step of de novo fatty acid synthesis (FAS). FAS consists of four elongation steps, which are repeated to extend the fatty acid chain through the addition of two-carbo units from malonyl acyl-carrier protein (ACP): condensation, reduction, dehydration, and a final reduction. Type II FAS, typical of plants and many bacteria, maintains these activities on discrete polypeptides, while type I FAS utilizes one or two multifunctional polypeptides. BKR resembles enoyl reductase, which catalyzes the second reduction step in FAS. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	4.80729e-75
NZ_CP044074.1\|WP_150339145.1\|2440082_2440826_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.41449e-13
NZ_CP044074.1\|WP_077172375.1\|2432462_2433713_+\|ribonucleotide-diphosphate-reductase-subunit-beta	gnl\|CDD\|235968	PRK07209, PRK07209, ribonucleotide-diphosphate reductase subunit beta; Validated.	0
NZ_CP044074.1\|WP_027598064.1\|2426290_2427640_-\|dicarboxylate/amino-acid:cation-symporter	gnl\|CDD\|234968	PRK01663, PRK01663, C4-dicarboxylate transporter DctA; Reviewed.	0
NZ_CP044074.1\|WP_027598973.1\|2442456_2443476_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.53428e-153
NZ_CP044074.1\|WP_007160483.1\|2421264_2422287_-\|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase	gnl\|CDD\|234629	PRK00094, gpsA, NAD(P)H-dependent glycerol-3-phosphate dehydrogenase.	9.36403e-165
NZ_CP044074.1\|WP_150339139.1\|2437678_2438209_+\|transposase	gnl\|CDD\|224854	COG1943, COG1943, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.63767e-30
NZ_CP044074.1\|WP_007160484.1\|2422664_2423180_+\|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA	gnl\|CDD\|179953	PRK05174, PRK05174, bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase.	4.91688e-132
NZ_CP044074.1\|WP_007160503.1\|2440923_2441391_+\|RNA-methyltransferase	gnl\|CDD\|349971	cd18098, SpoU-like, SAM-dependent rRNA or tRNA methylase related to SpoU. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	5.75743e-66
NZ_CP044074.1\|WP_042132871.1\|2428017_2428758_+\|4'-phosphopantetheinyl-transferase-superfamily-protein	gnl\|CDD\|225524	COG2977, EntD, Phosphopantetheinyl transferase component of siderophore synthetase [Secondary metabolites biosynthesis, transport, and catabolism].	6.94355e-56
NZ_CP044074.1\|WP_027598066.1\|2429366_2432282_+\|ribonucleoside-diphosphate-reductase-subunit-alpha	gnl\|CDD\|235966	PRK07207, PRK07207, ribonucleoside-diphosphate reductase subunit alpha.	0
NZ_CP044074.1\|WP_027598974.1\|2443472_2444339_+\|ABC-transporter-permease	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	1.91327e-69
NZ_CP044074.1\|WP_042138046.1\|2441387_2442218_-\|IclR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	4.16702e-51
NZ_CP044074.1\|WP_150339135.1\|2420933_2421233_-\|DUF4389-domain-containing-protein	gnl\|CDD\|379561	pfam14333, DUF4389, Domain of unknown function (DUF4389). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and archaea. Proteins in this family are typically between 104 and 223 amino acids in length. There is a single completely conserved residue R that may be functionally important.	1.89408e-22
NZ_CP044074.1\|WP_027598063.1\|2423191_2424409_+\|beta-ketoacyl-ACP-synthase-I	gnl\|CDD\|181184	PRK07967, PRK07967, beta-ketoacyl-ACP synthase I.	0
NZ_CP044074.1\|WP_017641977.1\|2420017_2420461_-\|hotdog-fold-thioesterase	gnl\|CDD\|182360	PRK10293, PRK10293, 1,4-dihydroxy-2-naphthoyl-CoA hydrolase.	3.33294e-39

>NZ_CP044074.1|WP_027598066.1|2429366_2432282_+|ribonucleoside-diphosphate-reductase-subunit-alpha
MHTDLTREQAQQGRPAQDASQDLGATAPGQLRVIKRNGTVVPYTDDKITVAISKAFLAVEGGTAAASSRIHTTVKQLTDQVSSTFKRRMPSGGTIHIEEIQDQVELALMRAGEQKVARSYVIYREARSQERKQGAASDIAEPHPSIRVTKADGTTQPLDMGRLNTIISEACEGLEEVNGELIQKETLKNLYDGVAEKDVNTALVMTARTLVEREPNYSYVTARLLLDSLRAEGLSFLGVAESATHHEMADLYAKALPAYVAKGVELELLDPKLATFDLAKLGAAIDHERDQQFTYLGLQTLYDRYFLHSHGTRFELPQLFFMRVAMGLAHMEQDKEARAIEFYNLLASFDYMASTPTLFNAGTLRPQLSSCYLTTVPDDLSGIYGAIHDNAMLSKFAGGLGNDWTPVRALGSYIKGTNGKSQGVVPFLKVVNDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWIPDLFMKRVFEDGNWTLFSPADVPDLHDLYGKAFEERYEYYEALTEYGKLKLHKTIKAKDLWRKMLSMLFETGHPWLTFKDPCNLRSPQQHVGVVHSSNLCTEITLNTNKDEIAVCNLGSVNLVNHIVDGKLDTAKVARTVKTAVRMLDNVIDINYYSVPQAENSNLKHRPVGMGIMGFQDALYLQHIAYGSDAAVQFADTSMEVISYYAIQASCDLAEERGSYSSFQGSLWSQGILPIDSEKRLIEERGAKYIEVDLSETLDWAPLRERAKKGIRNSNIMAIAPTATIANITGVSQSIEPTYQNLYVKSNLSGEFTVINPYLVRDLKARGLWDSVMVNDLKYYDGSVQQIERIPQDLKDLYATAFEVETKWIVEAASRRQKWIDQAQSLNLYIAGASGKKLDVTYRMAWFRGLKTTYYLRALAATSTEKSTINTGKLNAVSADPITGVQASAAPAPAQKVEAAPAAAPAPVPKACSLDDPECEACQ
>NZ_CP044074.1|WP_042132871.1|2428017_2428758_+|4'-phosphopantetheinyl-transferase-superfamily-protein
MPALPPTDLPGCCTAPAPLPPLAEEFDALALLHCRFDPAQVSFERDALRLGALPPDNIRRAVAKRQAEYLAGRLCAREALRQLSGAPAVPGHRREDRGPAWPAGWVGAITHSHGWAAAAVGSAQDYLGLGLDVETLLEPAKALRLADQILTPAERESVQALDEAQQAFAITLAFSAKESLFKALHPQVGQMFFFQDAEILGTDPGGTFDIRLLIELSPRWSAGTSLRGHYRLDEERRLLTLIAPRR
>NZ_CP044074.1|WP_027598064.1|2426290_2427640_-|dicarboxylate/amino-acid:cation-symporter
MTATVDTTTTTTAPAPKRPVKQPLYKSLYFQVIVAIVLGVLLGHFYPQTGAAMKPLGDGFIKLIKMVIAPIIFCTVVTGIAGMQNMKAVGKTGGMALLYFEIFSTIALLIGLIVVNVVQPGAGMNVDVSTLDTKGIAAYAAAGEKQSTIDFLMNIIPSTVVNAFATGEILQVLFFAVLFGYALHRLGETGQLVFNFIDRISHVFFNIINVIMKLAPIGAFGAMAFTIGKYGVGTLVQLGYLMACFYITCLLFVLVVLGAVARMHGFSILKFIKYIREELLIVLGTSSSESALPRMLTKMQKLGAEKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNTQMDITHQITLLLVLLISSKGAAGVTGSGFIVLAATLSAVGHVPVAGLALILGIDRFMSEARALTNLVGNGVASIVVAKWCGQLDEQTLKTELARGPNAVEVEEARQPA
>NZ_CP044074.1|WP_027601621.1|2424662_2425877_+|sugar-MFS-transporter
MHNQNQSYRGPLIVLTMLFFMWGLITSLNDILIPHLKAVFTLSYLQASLIQFCFFTAYFIVSFPAGRLVESLGYKKGIIVGLLTAGVGCVLFYPAAGAHSYGFFLTALFVLAAGITVLQVAANPYVTILGKPETAASRLNLTQAFNSLGTTVGPLVGAVTILALVGEDSAAHSVQLPYLILAGMLVALAVIIGLFRLPQIKDTEQDNATDENALTANSVWAYRHLLLGVVGIFMYVGAEVSIGSYLVSLMESPDVAGLNAATAAKYLSLYWGGAMVGRFIGGVIMTKVRPNLVLTFNAIAIGVLLAVAVLQGGKVAMWALLAIGFFNSIMFPTIFSLALKGLGKFTSKGSGLLCMGIVGGALVPAIQGYFADTIGLLPSFLIPLVCYLYILFYGVMGYRPTLRR
>NZ_CP044074.1|WP_027598063.1|2423191_2424409_+|beta-ketoacyl-ACP-synthase-I
MRRVVITGLGIVSCLGNDKDTVSANLRAGRAGIRHNPEYAEMGLRSQVSGSIDLNLEELIDRKVKRFVGDAAAYAYLAMEQAIKDSGLSEEQVSNPRTGLIAGSGGASTFNQMEALDILREKGVKRVGPYRVTRTMSSTVSACLATPFKIKGLNYSVASACATSAHCIGLAMEQIQLGKQDVVFAGGGEEEHWTQSMLFDAMGALSSDYNETPEKASRAYDSKRDGFVIAGGGGMVVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALSTVDGEIDYLNTHGTSTPVGDVAEIKGVRAVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCMLMMEGNFIAGSANIDELDPEVADLPILRETKENAKLDLIMSNSFGFGGTNATLVLKRWQG
>NZ_CP044074.1|WP_007160484.1|2422664_2423180_+|3-hydroxyacyl-[acyl-carrier-protein]-dehydratase-FabA
MTKQHAFTYEDLLRCSRGELFGPGNAQLPAPNMLMIDRITHISEVGGKYGKGELVAELDIRPDLWFFGCHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPTAKKVTYNIHIKRTINRSLILAIADGTVSVDGREIYSAEGLRVGLFTSTDSF
>NZ_CP044074.1|WP_007160483.1|2421264_2422287_-|NAD(P)H-dependent-glycerol-3-phosphate-dehydrogenase
MTVQSPIAVLGGGSFGTALANLVAENGLPVRLWMRDPQQAETIRRERENPRYLKGIKVHAAVEATSDLQGAIQGCELILVALPSSALRQALAPIAQQLEGRFLVSTTKGIEAHSFMLMSEILAEIVPRARIGIISGPNLAREIAEHQLTATVVASEDEEVCRRVQAALHGRTFRVYASADRLGVELAGALKNVYAIIAGMAAALAMGENTRSMLITRALAEMTRFAVQRGANPITYLGLAGVGDLIVTCSSEKSRNYRVGHALGRGLTLDEAVAQIGETAEGVNTLRVLKEKADELGVYMPLVNGLYAILFEGRSLGQVIEALMGGEPKTDVDVADAPFN
>NZ_CP044074.1|WP_150339135.1|2420933_2421233_-|DUF4389-domain-containing-protein
MSQPEHSRELLGLRLIWMLLFLFVWLGAQYVLAVVVLVQLVVRLIKGEANPGLTAFGAALGSYLAQIVRFGTFASEVKPWPFADWSATEQPDDRSATAP
>NZ_CP044074.1|WP_027598061.1|2420481_2420937_-|phosphohistidine-phosphatase-SixA
MKLWLLRHGEAEARAPSDELRELTATGRAEVLRSALQLKDAQLQLILASPYVRAQQTAALVQQQLGWPGELRSVSWATPDGEPERALAELARLEVEELLLVTHNPFVGELAGWLLHGHRQAPVPMGTASLLCLEAPLPLAGGFDLVSRFHG
>NZ_CP044074.1|WP_017641977.1|2420017_2420461_-|hotdog-fold-thioesterase
MSIWQTLPDPEDLGRALENTLAEHLDMRIEAWDDSSLTASMVVDRRTHQPMGLLHGGASVALAETVGSIASMLCVDRSRFYCVGQEINANHLRGVRSGRVTAVARPLHLGRSSHVWDIRLSDEEGRLTCVSRLTVAVVPLQRDASPA
>NZ_CP044074.1|WP_077172375.1|2432462_2433713_+|ribonucleotide-diphosphate-reductase-subunit-beta
MLNWEEFDKDDDATPAKPAQAAGQQAPAQTERLDSEGDALVHDARALSADDSDAVARAKAALNELDIQEGLDDLEGSSARVHVGDKQMINARADLNQLVPFKYDWAWQKYLDGCANHWMPQEVNMNADIATWKSADGLTEDERRIVKRNLGFFSTADSLVANNLVLAVYRLITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKASWGLKYTRSISDPEFKTGTPETDRQFLKNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGTAEQFQYILRDESMHLNFGIDMINQIKIENPQLWDAQMKDEATQMILQGTQLEIEYARDTMPRGVLGMNAAMMEDYLKFIANRRLTQIGLKEEYPGATNPFPWMSEIMDLKKEKNFFETRVIEYQTGGALSWD
>NZ_CP044074.1|WP_150339137.1|2433766_2434765_-|hypothetical-protein
MKSYAISVVIYVSFFLLFVCFLLAGFADLDFSEFITALYLITFSIFFFFAIFSVAGNYILNRRYDWLRGIIRRERKGSFVSPKKKRMTYWGKKVNDMYLADIAYLQSSNIVSSAANLIIRSVKGPYNYIRIKGLDFFSIACTASAKIFLVAAFSSMILFFCMYMFVSSWEVFLVARRAEGIRDYQPYSAAIIFLMYGMLPGVIFSRSNYRGFERFKQVIIVSSAAFFVVCIFTYGIFGSLVSYSVMMMGVRDSKPSFYNISEKYYKNEMAFSSWGAIRNGGRYQVSGMVLYRLSSVVYLCPADFYKKNMKYWRENYDRCIVGNGIDVESGVK
>NZ_CP044074.1|WP_150339139.1|2437678_2438209_+|transposase
MSRFRRARVPGASYFFTVVLTDRRSDLLTRHIDLLRETVRATQLRHPFHIDAWVTLPDHLHCIWSLPEGDANFALRWKVIKFGFSKRLPVGEGRTATQRARGERGIWQRRYWEHLIRDEQDYQRHVEYIHFHPVKHGHVGAVEDWPYSSFHRAVRMGLYPQDWGGDFMAETGRWGE
>NZ_CP044074.1|WP_150339141.1|2438265_2439141_-|LysR-family-transcriptional-regulator
MDLLDSMQVFVAVVERGSLAAAAQAQGISPTMAGNHLRGLEQRLGLQLLVRTTRRQRLTAFGEGYYARCREILALVADTDRQAETQRLAPAGILRVSAPVSFGTYGLTPRLGDYLARHPQVTLDLVLSDRVQDLVEEGIDIAIRIGELADSSLVARPLAPYVMWCCAAPGYLAQRGTPERLADLEAHDCLGMDPRALSQWRAQTGTPFGPLPPGRLHLSNGPALRLAALQGLGVILQPAFLLQDDVAAGNLVRLFQGQELTRPLTALYPQTRWRSVTVRSFVEFLLTEFAP
>NZ_CP044074.1|WP_150339143.1|2439317_2440076_+|SDR-family-oxidoreductase
MDLQLHDRTALVTGASMGIGTGIARVLAAEGVRLAITARRRDALEALAEEIVAAGHARPLVIAADITDAEDVQRLAREAEDGLGRVDILINNAGGTRPLSITADDAAWDEAWNLNFTATRRLTQALLGGMRERRWGRIVNFSGSMEPRDVNGAGAAKAAIQFWSKGLASQLAAEGITVNTIAPGRINSEQILQRLHPTPEARQAFIARNIPIGYFGEPEDVGQVVAFLASPLARYLTGDVIAVDGGMHAHAH
>NZ_CP044074.1|WP_150339145.1|2440082_2440826_-|methyltransferase-domain-containing-protein
MSATALYTDLSAYYDLLCADIDYQAQSQAVLRLQRLFGNGGGRHLDLACGTGPHVRHFLDAGFQSSGLDLNPPMLTQAALRCPEAQFSCQDMCAFELEQPVDLITCFLYSLHYSGSLARLQACLARVQAALTPGGLFCFNAVDKRRIDNGSSVGHSVARADGHFSFASAWHYPGEGEHQQLRLRIERRHAGQQQTWQDEHPMVAVDFPELLALLEPHFEVQVLEHDYQRIEPWAGEAGNALFVCVKR
>NZ_CP044074.1|WP_007160503.1|2440923_2441391_+|RNA-methyltransferase
MSNKRYACIGLSNPKSPSNVGSIMRAAGCYGVASVFYTGTRYDRAKDFVTDTKKVHQDIPLINIDDLRRILPLGCVPVAVELVDGARPLPEYTHPDRALYLFGAEDGSLSQELRDWCEDVVYIPTQGCMNLAATVNVVLYDRLAKGNNTRSGPLF
>NZ_CP044074.1|WP_042138046.1|2441387_2442218_-|IclR-family-transcriptional-regulator
MEDSIERKAVGGEVGVGAISRVFAVVRALGEGDPEGEKVTRLAERVGLSQPTTHRLLRGLVEEGMVEQCARSKRYRLSLDFFALAARAGQVGNLRDLARPSLLRLSASLGDSLFLLARSGFDAMCLDRSEGPYPIRTFTGDIGGRVPLGGGQGALAILAFLPEEEREEVIRYNLPRLRDAHHYDEVLLRAEIDNVRQQGYAARNTGVLAGMAGLAVPILDRNGRAVAALSVGTLSERLNAQRLPTVIELLRREAGVIAARINPFDPVLRRPTQGFG
>NZ_CP044074.1|WP_027598973.1|2442456_2443476_+|ABC-transporter-ATP-binding-protein
MAFLTLDNLSKRYGDSYAVAGSTLAIERGEFVSLLGPSGCGKTTTLQMIAGFVEVSSGRILLDGQDITHAKPASRGLGVVFQSYALFPHMTVRDNVAFGLRMRKVAGAELARRVDEALGLVHLGQHAERYPRELSGGQRQRVALARALVIAPPVLLLDEPLSNLDAHLREEMQFEIRRIQREVGITTLMVTHDQSEALSISDRVVVMEAGRITQVDAPYRLYEHPRNRFISDFVGKANLLPGSLDAQGRPQIAAGGALAISLRPEKIELRPAGEGRLQGRVLTRFFLGSQWLYRLETALGEVSVLRSNDGLPPLDEGQRVGLHWDDGLLRRLEAAEAAA
>NZ_CP044074.1|WP_027598974.1|2443472_2444339_+|ABC-transporter-permease
MSTLLRGTGRAYLLSAPALVLFAGLLLAPLALTLALSFNVFDYETGIKEGSYTLAHYLSLLGDPYFYEIFLRTFWISALVTLLCVLIGVPEAIVLSRMGAPWRSIFLILVLTPLLISVVVRAFGWSLLLGADGLVNQAIVALGGRPLKLLYTPFAVVVGLVHVMLPFMIIPVWTSLQKLDPAAEQAALSLGASHLTVLRRIVLPQVMPGVLSGTLIVFGLAASSFAIPGLLGGRRLKMVATLIYDQYLAELNWPMGATLAVALLLLNLLVMLGWNRLVERRYKRALGV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044074_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044074_4

3338520-3338627

Orphan

Consensus_repeat	Method
CCCCCTCACCCCGACCCTCTCCCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044074_4

>merge|NZ_CP044074|4|3338520-3338627|CRISPRCasFinder
CCCCCTCACCCCGACCCTCTCCCCGAGGGGAGAGGGGGTGGTTTGGTGTGACCCTTTAATCCGCGGCGGCAAGCAGCGCCTTGCCCCCTCACCCCAACCCTCTCCCCG

>NZ_CP044074|4|4|3338520-3338627|CRISPRCasFinder
CCCCCTCACCCCGACCCTCTCCCCG	AGGGGAGAGGGGGTGGTTTGGTGTGACCCTTTAATCCGCGGCGGCAAGCAGCGCCTTG
CCCCCTCACCCCAACCCTCTCCCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044074.1\|WP_150339838.1\|3340409_3341087_-\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP044074.1\|WP_027598808.1\|3339554_3340286_+\|precorrin-4-C(11)-methyltransferase	unknown	unknown	gnl\|CDD\|225430
NZ_CP044074.1\|WP_150339835.1\|3338835_3339558_+\|cobalt-precorrin-6A-reductase	unknown	unknown	gnl\|CDD\|236144
NZ_CP044074.1\|WP_150339832.1\|3337303_3338506_+\|precorrin-6y-C5,15-methyltransferase-(decarboxylating)-subunit-CbiE	unknown	unknown	gnl\|CDD\|225151
NZ_CP044074.1\|WP_150339841.1\|3341938_3343024_-\|DUF4432-family-protein	unknown	unknown	gnl\|CDD\|185703
NZ_CP044074.1\|WP_027601062.1\|3344415_3345342_-\|ribokinase	unknown	unknown	gnl\|CDD\|238579
NZ_CP044074.1\|WP_027598814.1\|3345585_3346911_-\|DUF3100-domain-containing-protein	unknown	unknown	gnl\|CDD\|378631
NZ_CP044074.1\|WP_017642949.1\|3330669_3331704_-\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP044074.1\|WP_150339830.1\|3335918_3337205_-\|precorrin-3B-synthase	unknown	unknown	gnl\|CDD\|274131
NZ_CP044074.1\|WP_027601060.1\|3341181_3341946_+\|DNA-binding-transcriptional-repressor-DeoR	unknown	unknown	gnl\|CDD\|182644
NZ_CP044074.1\|WP_150339827.1\|3335299_3335926_-\|precorrin-8X-methylmutase	unknown	unknown	gnl\|CDD\|181352
NZ_CP044074.1\|WP_150339844.1\|3348170_3349325_-\|amidohydrolase	unknown	unknown	gnl\|CDD\|349916
NZ_CP044074.1\|WP_042137407.1\|3334559_3335300_-\|precorrin-2-C(20)-methyltransferase	unknown	unknown	gnl\|CDD\|180341
NZ_CP044074.1\|WP_150340727.1\|3332901_3334563_-\|precorrin-3B-C(17)-methyltransferase	unknown	unknown	gnl\|CDD\|381173
NZ_CP044074.1\|WP_027598812.1\|3343036_3344368_-\|L-fucose:H+-symporter-permease	unknown	unknown	gnl\|CDD\|340952
NZ_CP044074.1\|WP_042137384.1\|3347240_3348143_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176117
NZ_CP044074.1\|WP_017642952.1\|3328407_3329262_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|131484
NZ_CP044074.1\|WP_144961476.1\|3331700_3332717_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NZ_CP044074.1\|WP_027598801.1\|3329908_3330673_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP044074.1\|WP_150339825.1\|3329405_3329924_+\|DUF962-domain-containing-protein	unknown	unknown	gnl\|CDD\|226914

Protein	Function_ID	Function_description	E-value
NZ_CP044074.1\|WP_150339838.1\|3340409_3341087_-\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	2.72221e-120
NZ_CP044074.1\|WP_027598808.1\|3339554_3340286_+\|precorrin-4-C(11)-methyltransferase	gnl\|CDD\|225430	COG2875, CobM, Precorrin-4 methylase [Coenzyme metabolism].	5.46973e-132
NZ_CP044074.1\|WP_150339835.1\|3338835_3339558_+\|cobalt-precorrin-6A-reductase	gnl\|CDD\|236144	PRK08057, PRK08057, cobalt-precorrin-6x reductase; Reviewed.	1.87545e-108
NZ_CP044074.1\|WP_150339832.1\|3337303_3338506_+\|precorrin-6y-C5,15-methyltransferase-(decarboxylating)-subunit-CbiE	gnl\|CDD\|225151	COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism].	8.49716e-77
NZ_CP044074.1\|WP_150339841.1\|3341938_3343024_-\|DUF4432-family-protein	gnl\|CDD\|185703	cd09269, deoxyribose_mutarotase, deoxyribose mutarotase_like. Salmonella enterica serovar Typhi DeoM (earlier named as DeoX) is a mutarotase with high specificity for deoxyribose. It is encoded by one of four genes beonging to the deoK operon. This operon has also been found in Escherichia coli where it is more common in pathogenic than in commensal strains and is associated with pathogenicity. It has been found on a pathogenicity island from a human blood isolate AL863 and confers the ability to use deoxyribose as a carbon source; deoxyribose is not fermented by non-pathogenic E.coli K-12. Proteins in this family are members of the aldose-1-epimerase superfamily. Aldose 1-epimerases, or mutarotases, are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Site directed mutagenesis of this latter histidine residue renders Salmonella enterica DeoM inactive.	4.62068e-168
NZ_CP044074.1\|WP_027601062.1\|3344415_3345342_-\|ribokinase	gnl\|CDD\|238579	cd01174, ribokinase, Ribokinase catalyses the phosphorylation of ribose to ribose-5-phosphate using ATP. This reaction is the first step in the ribose metabolism. It traps ribose within the cell after uptake and also prepares the sugar for use in the synthesis of nucleotides and histidine, and for entry into the pentose phosphate pathway. Ribokinase is dimeric in solution.	1.59773e-121
NZ_CP044074.1\|WP_027598814.1\|3345585_3346911_-\|DUF3100-domain-containing-protein	gnl\|CDD\|378631	pfam11299, DUF3100, Protein of unknown function (DUF3100). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known.	1.52246e-104
NZ_CP044074.1\|WP_017642949.1\|3330669_3331704_-\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	5.33759e-72
NZ_CP044074.1\|WP_150339830.1\|3335918_3337205_-\|precorrin-3B-synthase	gnl\|CDD\|274131	TIGR02435, Precorrin-3B_synthase, precorrin-3B synthase. An iron-sulfur protein. An oxygen atom from dioxygen is incorporated into the macrocycle at C-20. In the aerobic cobalamin biosythesis pathway, four enzymes are involved in the conversion of precorrin-3A to precorrin-6A. The first of the four steps is carried out by EC 1.14.13.83, precorrin-3B synthase (CobG), yielding precorrin-3B as the product. This is followed by three methylation reactions, which introduce a methyl group at C-17 (CobJ; EC 2.1.1.131), C-11 (CobM; EC 2.1.1.133) and C-1 (CobF; EC 2.1.1.152) of the macrocycle, giving rise to precorrin-4, precorrin-5 and precorrin-6A, respectively. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin].	4.40172e-92
NZ_CP044074.1\|WP_027601060.1\|3341181_3341946_+\|DNA-binding-transcriptional-repressor-DeoR	gnl\|CDD\|182644	PRK10681, PRK10681, DNA-binding transcriptional repressor DeoR; Provisional.	5.44063e-86
NZ_CP044074.1\|WP_150339827.1\|3335299_3335926_-\|precorrin-8X-methylmutase	gnl\|CDD\|181352	PRK08285, cobH, precorrin-8X methylmutase; Reviewed.	2.1754e-130
NZ_CP044074.1\|WP_150339844.1\|3348170_3349325_-\|amidohydrolase	gnl\|CDD\|349916	cd05666, M20_Acy1-like, M20 Peptidase aminoacylase 1 subfamily. Peptidase M20 family, uncharacterized subfamily of bacterial proteins predicted as putative amidohydrolases or hippurate hydrolases. These are a class of zinc binding homodimeric enzymes involved in hydrolysis of N-acetylated proteins. N-terminal acetylation of proteins is a widespread and highly conserved process that is involved in protection and stability of proteins. Several types of aminoacylases can be distinguished on the basis of substrate specificity. Aminoacylase 1 (ACY1) breaks down cytosolic aliphatic N-acyl-alpha-amino acids (except L-aspartate), especially N-acetyl-methionine and acetyl-glutamate into L-amino acids and an acyl group. However, ACY1 can also catalyze the reverse reaction, the synthesis of acetylated amino acids. ACY1 may also play a role in xenobiotic bioactivation as well as the inter-organ processing of amino acid-conjugated xenobiotic derivatives (S-substituted-N-acetyl-L-cysteine).	0
NZ_CP044074.1\|WP_042137407.1\|3334559_3335300_-\|precorrin-2-C(20)-methyltransferase	gnl\|CDD\|180341	PRK05990, PRK05990, precorrin-2 C(20)-methyltransferase; Reviewed.	5.11079e-155
NZ_CP044074.1\|WP_150340727.1\|3332901_3334563_-\|precorrin-3B-C(17)-methyltransferase	gnl\|CDD\|381173	cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-methyltransferase (also named CobJ or CbiH). Precorrin-3B C(17)-methyltransferase participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. This model includes CobJ of the aerobic pathway and CbiH of the anaerobic pathway, both as stand-alone enzymes and when CobJ or CbiH form part of bifunctional enzymes, such as in Mycobacterium tuberculosis CobIJ where CobJ fuses with a precorrin-2 C(20)-methyltransferase domain, or Bacillus megaterium CbiH60, where CbiH is fused to a nitrite and sulfite reductase-like domain. In the aerobic pathway, once CobG has generated precorrin-3b, CobJ catalyzes the methylation of precorrin-3b at C-17 to form precorrin-4 (the extruded methylated C-20 fragment is left attached as an acyl group at C-1). In the corresponding anaerobic pathway, CbiH carries out this ring contraction, using cobalt-precorrin-3b as a substrate to generate a tetramethylated delta-lactone.	5.93472e-114
NZ_CP044074.1\|WP_027598812.1\|3343036_3344368_-\|L-fucose:H+-symporter-permease	gnl\|CDD\|340952	cd17394, MFS_FucP_like, Fucose permease and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of L-fucose permease (also called L-fucose-proton symporter) and similar proteins such as glucose/galactose transporter and N-acetyl glucosamine transporter NagP. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. Glucose/galactose transporter functions in the uptake of of glucose and galactose. The FucP-like subfamily belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	6.98743e-134
NZ_CP044074.1\|WP_042137384.1\|3347240_3348143_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176117	cd08426, PBP2_LTTR_like_5, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.3689e-44
NZ_CP044074.1\|WP_017642952.1\|3328407_3329262_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|131484	TIGR02431, p-hydroxybenzoate_hydroxylase_transcriptional, beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family. Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions].	5.49693e-117
NZ_CP044074.1\|WP_144961476.1\|3331700_3332717_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	6.75837e-72
NZ_CP044074.1\|WP_027598801.1\|3329908_3330673_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	6.59372e-106
NZ_CP044074.1\|WP_150339825.1\|3329405_3329924_+\|DUF962-domain-containing-protein	gnl\|CDD\|226914	COG4539, COG4539, Predicted membrane protein [Function unknown].	2.58511e-57

>NZ_CP044074.1|WP_150339832.1|3337303_3338506_+|precorrin-6y-C5,15-methyltransferase-(decarboxylating)-subunit-CbiE
MIPWLTVVGIGEDGYPGLGKQARRALLEAGVVIGGPRQLALLPPCIRATREPWPQPFALAPVLDRRGTPVCVLASGDPMLFGVGASLARQLSADELQVLPAPSSYSLAAARLGWPLQDITLLSVVARPLAAVVRHLHPGARLLVLSNDGHSPAALAALLVDQGFGASQLQVLEHLGGPLERQIAGRARDWSLAEAAALNLVAIEVLSETGETGLPLTPGLPDSAYRHDGQLTKRDVRAVTLARLAPRPGELLWDVGAGCGSIGIEWARSHPGCRVLAIEADAGRQAHILHNRDQLGAPALHLVAGQAPDALAGLATPDAIFIGGGLTAPGVLDACWDALRPGGRLVANAVTLQTEAALVAFRERHGGDLTRLQVAQAQPLGAFDTWRAALPITLLDVVKP
>NZ_CP044074.1|WP_150339830.1|3335918_3337205_-|precorrin-3B-synthase
MNPPSPSALVPRPSACPGLLRIVPARDGGLCRVKLPGGRLTAAQARAIAAASARWASGVLELTNRANLQLRGVRQDGAAALVAELQAADLGPSDPAADDVRNLLLSPSAGRDPQQLRDVRPLAAELLALLEGDRRLHGLSAKFALQLDGGEALARLDHPHDVWLSARAEGYVLGLAGTPADAPLGLIPAGREVATVATLLHRFLDLADPEQSRMRQLLAQRPVEELLAGLGLLPTQSHPRAPAEIAGRLGSHPQRQSGLCWVGAQPALGRLPATTLEAVADLAEYHGNGDLHLTPWQGLLLPDVPVDQAPELLAALAALELTTDPAAPLGRLVACTGSQGCAKGQADTKGDALRLAEQLPADVEVHLSGCPRSCALAGQAPHTLLAVAPGRYDLFVRDATQPGPGRRRATHLSLDEAAAWLARSPSDA
>NZ_CP044074.1|WP_150339827.1|3335299_3335926_-|precorrin-8X-methylmutase
MLEYERDGQAIYRQSFATIRAEADLLAIPADLEKLAVRVIHACGMVDVVQDLAFSPGAGAAGRAALAAGAPILCDARMVAEGVTRTRLPANNQVICTLHDEGIRELALAQGNTRSAVALERWRPHLAGSVVVIGNAPTALFYLLEMLDAGAPRPALILGMPVGFVGAMESKDALAADSRGVPYVIVRGRRGGSAMAAAAVNALATEVE
>NZ_CP044074.1|WP_042137407.1|3334559_3335300_-|precorrin-2-C(20)-methyltransferase
MAGRLLGLGVGPGDPELITLKALRLLQGAPVVAYFVAKAKANAGQGGNAYGVIEGYLLDGQQRLPLVYPVTTEKLAPPLSYETVIADFYDTAAAQVADHLDAGRDVAVICEGDPFFYGSYMYLHDRLAERYEAQVVPGVCSMLGGVAMLGLPLVYRNQTLTVLSGVLSAEELKARLASADAAVVMKLGRNFEKVRQVLRELGLDDRARYIERATMDNQRIVALDAVDPMASPYFSLVVVPGVKWKG
>NZ_CP044074.1|WP_150340727.1|3332901_3334563_-|precorrin-3B-C(17)-methyltransferase
MSPAIVILGPGALATARRLQAGLPGSLVHGLAGRVEGDVSYTNFGDHLRELYRQQRPLLVLCAAGIVIRSLASLLDDKTAEPPVLAVAEDGSAVVPLLGGLAGANRLARQLGTLLNVAPAITTSGELRFGTCLLDPPAGYALADVDVAKHRVADLLAGAPVRIEGEAPWLDEVPLARDPAARQRILVSPLASADDHTLLIHPRAVLVAARADATATAVTALLASAGYAPGAVALLLARAEDMAAPGLAELSQTLAVPLRFVDARTPDFARASVARAQAQGLALHLHDRPLDAEDLGQRRGRLSVVGLGPGAAELMAPVVRRALDQAQDVLGYATYVQMAGPLRPDQLAHASDNREELQRARHAFELAASGRQVVMVSSGDPGVFAMAAAVLEVLEGADDPRWAAVELEILPGITAAMASAALAGAPLGHDFCLISLSDNLKPWAVIEQRLRQAAAADLAMAFYNPISKARPHQLERALDVLRSCRPANTPVILGRDVGRPGGGLEYTSLGALRSDMVDSRTLVILGSSHTRRFPRADGGEWVYTPRWYDPELL
>NZ_CP044074.1|WP_144961476.1|3331700_3332717_-|ABC-transporter-substrate-binding-protein
MFRRLLPLIAAGLLSAASLTTQAATAYPLTVHNCGRELVFERAPQRLVSLGQASTELLLRLGVGARLVGTGVWFGGLPADLQAAGKGIPRLADNAPSFEAVVGTRPDLVAAQYTYHVGPGGEVADFPRFAKLGIAAYVAPSDCEGKAVTADSNSDGSRSAPFDMQLVTREARELAAILDVQPAGERLVADLDRRIAVAGEQAKAAGVQGRSVLFWFSSPRLEGDPWVAGNLGAPAWIARALGLRNVVDSAEEWPAVSWERIASLDPDYIVVARMDRRLYPADDVDKKLAFLRSDPLTRELRAVRENHLLVVDAPTLNPSLRVVDSVEALAADLAKPQP
>NZ_CP044074.1|WP_017642949.1|3330669_3331704_-|iron-ABC-transporter-permease
MSLPLAAEGARPWRWLLGLAAVLALAASVVLAASFGEMPIAPLTSLQAIANGLGLGPYPVERIVQGIVWEYRLSRALVAACCGAGLAVSGAILQALLRNALAEPYVLGLSAGASTGAVLVMLLGVGGGVLGVSLGAFLGAVLAFAVVLPFLGSGGSTRIILAGVAASQLFNALTAYIVATAANAEQARSVMFWLLGSLAGVRWPDVWLAAGVVLAGLLVCLACARALDAFAFGEDAAASLGVAVGPLRLLLLAVTGLITACLVSLVGAVGFVGLVIPHVARFLVGPGHGRLLPTCALIGALFMVLADIVARTLVAKQTLPIGVVTALVGAPAFAFILYRAREVR
>NZ_CP044074.1|WP_027598801.1|3329908_3330673_-|ABC-transporter-ATP-binding-protein
MSLAARDVAWSAGGQPILAGVTLAVPPGGVLGLLGPNGSGKSSLLRLLAGLRRPEEGRVSLDGTPLAELRRRDLARRVALVEQQAGTEADLSVAEVVRLGRTPHRGLLDAWSARDAEVCQRALAQVGLVDKAARRWHSLSGGERQRAQIARALAQEPSELLLDEPTNHLDIQHQLEILDLVRRLPATCVLAIHDLNLAALFCDRLAVLRDGRLVAEGAPGEVLTAALIQQVWGVRAQVTLDGPDGRPSIRYRLG
>NZ_CP044074.1|WP_150339825.1|3329405_3329924_+|DUF962-domain-containing-protein
MKTLEDHLSQYASYHRDPRNIASHFPGILLIVLAVAILLSRPVFSLAGWPLSPAVPVAGAVALFYLRLDRPLGLLMSVLLALALWLGAALAAQTRGVWLAWGLGLFLIGWAIQFVGHHYEGRKPAFLDDLAGLAIGPLFIATEAVFWLGGRQQLRQAIEERAGPVRRRQPSR
>NZ_CP044074.1|WP_017642952.1|3328407_3329262_-|helix-turn-helix-domain-containing-protein
MDDNRTAHATGLPPLAAPPIIASPAKRIEAFTGDPNFMTSLARGLAVIHAFQERKRQLTIAQISHRTEIPRAAVRRCLHTLMKLGYVTTDGRTYSLLPKVLTLGHAYLSSTPLAVTAQPVLDRLSEQLHEACSMATLEGDEILYIARSATPQRLISVDLSVGSRLPAYCTSMGRILLAALDDAALHDYLEHADLQAKTSRTLYQPPALIECLGQVRQQGYVIVDQELEVGLRSLAVPLRDAAGQVLASLNVGTHASRVSRQELETRFLPVLLAASQELSTRLFH
>NZ_CP044074.1|WP_150339835.1|3338835_3339558_+|cobalt-precorrin-6A-reductase
MKILLLGGTTEALAIARTLPAEAFYSLAGLGRVPQDLPCQVRVGGYGGAAGLSAFLHSEGIELLLDATHPYAARISHNAGLAAAQAGIPCWALRRPGWQAGPDDDWREVADWTELQTTLAPFTRPFFTLGREPLEHLAEIPPHQFWTLRLLDAHPGHARARIIADRGPFALEAERLLFAQGDFDVLISKNSGSAATQPKLQVARERGLPVLILRRPALPSVDREFASVADLLAALAEETP
>NZ_CP044074.1|WP_027598808.1|3339554_3340286_+|precorrin-4-C(11)-methyltransferase
MTVHFIGAGPGDPDLITVKGQRLIRQCPVILYAGSLVPPAVLEGHQAETVIDTAHLDLDAIVGHLAAAHARGQDVARVHSGDPSLYGAIGEQIRRLQALGIPYEIVPGVTATAACAALLGCELTLPGVSQTVILTRYASRTAMPEGEALADLARHRATLAIHLGVGQLERIVADLLPHYGPGCPVAIVHRASWPDQDSVRGTLADIVERARDKDFRRTALILVGEVLAPGDFSDSKLYRQGPG
>NZ_CP044074.1|WP_150339838.1|3340409_3341087_-|deoxyribose-phosphate-aldolase
MQLEPGELAKTIDHTLLAADARRAQIDRLCQEARTHGFYSVCVNSAQVPHAAAQLAGSAVKVCAVVGFPLGAGLSAAKAFEAEQAIAAGAGEIDMVVNLGWLKDGLLEEVSADIAAVQAACGAVPLKVILETGLLDDEQKRQACRICRDLGVAFVKTSTGFGHGGATLEDVRLMREEVGPEMGVKASGGVRDRATAQAMLDAGATRLGTSSGVAIVSGGEGGVGY
>NZ_CP044074.1|WP_027601060.1|3341181_3341946_+|DNA-binding-transcriptional-repressor-DeoR
MDSKKAARLKLMHQALQDQHAIHLREMAQLLGVSEMTLRRDLRLPPDGLRLLGGHVTRDVGGSEAPGYQVVEQDLRQVEEKRRIGRLAAAQIRAGDTVFLDCGTTTPFVVDFIPDDLEFTAVCHSLNVLLKLQQKVNCTLVVCGGTFQRKNQIFESRLETGVLDGVRLTHAFVSAAGVSADFGVTCFNFNEVEVKQKVLRQAQQRLLLVDHTKFDVVRAAHFAALGDFDLVVSDGRIPRSYRERIEANGAQLLT
>NZ_CP044074.1|WP_150339841.1|3341938_3343024_-|DUF4432-family-protein
MSVRLPLQPEQFTADERTLLASDAFQVRAWTYPSGVRALALENRRGRLVVLPYQGQMIWDASFDGCRLTMPGLFDQPRPTRRIIETYGCFMFHAGVLRNGCPAPEDSHELHGELPCAPLDEAWLELGQDAEGDFLRLGGRHDYAMGFGDRYRAQPRVTLRADSAVFELGLEVENQAGQPMDLMYMAHMNYAYVPGGRFHEPLGVARTRVRTSVPAHVRPTADWQAFIAALAEDPERLRVLDAPARYQPEIVSFIDAPGTDAAGEAHFLLEHPGGAAFYTAYRPQDLPHATRWVLHNPDQQVAAFVLPATCEPEGYLAETTKGQVQQLQPGERRAFSVRTGYLAAAEREALLARLADPARIR
>NZ_CP044074.1|WP_027598812.1|3343036_3344368_-|L-fucose:H+-symporter-permease
MSQSPLRPSADGYYLNRTPWFAFILLCCIFALWAAAASMNDVLIAHFKKAFLLSDFQTAFVQSAFYLGYFFLALPAALMVRRFSYKTTILFGLFLYMVGCLLFFPAASMAKYGMFLLALFVIAAGLSFLETACNTYSTLLGPRETGTRRLNISQTFHPFGAMTGVYVGSFVMFKEGDASQAQLLQMNPAEAAAQQLQMIQATLTPYQWMIGVLVLIFVLIACTRYPACKGNERVRSEGDGVAASLGRLRRNPRFVFGVLAQFLYVGAQVGVWSFTIRLAMQLGGMNERSASWFLLTTFAAYFVGKLIANLLMRRWHPAKVLGVYGVLCIALLAYTILVPNITAVYAAVGVSIFLGPCWPTIYGLTVDGIGRDTEFGGSLLVMSIVGGGVIPIFQGLLSDYTGGNMQLAYSVPLLCFTVIVAYALYCLRHPASERLPVGAAQTA
>NZ_CP044074.1|WP_027601062.1|3344415_3345342_-|ribokinase
MGKIAVIGSNMVDLITYIERLPVQGETLEAPDFALGCGGKGANQAVAAAKLGSEVLMVTKVGDDLFADNTLANFRRFGIDTRHVTRAPGRSSGVAPIFVQPDSHNSILIVKGANAALGPADIQAAEADLRDCALIVLQLEIALETVYAAIDCGQRLGIPVLLNPAPAVADLSAAHLARLDYFVPNETELALVSGLPVADRDSAFAAARVLAGRGIRHVVVTLGAAGALYVGEEGEFSLPGQRVAALDTTGAGDAFIGCFAHGRVQGLGLREAMQRAVAYSALSVTGRGTQTSYPEAAVFEDYLASLDL
>NZ_CP044074.1|WP_027598814.1|3345585_3346911_-|DUF3100-domain-containing-protein
MSANPTLAVGQDRAVSDTVKLYFWAALVLLIAELIGSVSIPLGPGKVVLLPMIWALLLGAAIGLASTRLPQGLSVSRSAQVRSAAILQYALLIFIAKLGLVVGGSLPTVIAAGWALAFQELGHFVGTILLGLPVALLLGIKREAIGATFSVGREPSLAIIGERYGMDSPEGRGVLAEYLTGTLIGAVFMAIVAGFIASLNIFHPYSLAMGAGIGSGSIMAAAAGAVAAQQTPEVAKEVMALAAAANLITTTLGTYFTLFISLPLAVWGYRVLEPRIGRTTKASFAQSAVDQTVVDEPVELGWSGRLSAWFAAAGLALLGTFVATKTLPAAALIAVALMIGAAVVGELLCQLFRRKVPAVCWVSLVAMFLTSPWCPLAPQITAAANSVGVLAVITPMLAFAGLSIAKDIPAFRRLGWRIVVVSLTAGFGTFIGAVFIAELFH
>NZ_CP044074.1|WP_042137384.1|3347240_3348143_+|LysR-family-transcriptional-regulator
MRGIHEQRLHYFVEAVRLGSVRAAADALDIAPSAVSRQIAQVEAELGVDLIERHRRGITPTEAGRLVLDYFRQRQTQLDGLRDAIADLQGLRTGRVVLAIGEGFIGDLSRSLGDFSARHPEIEVRVNVVGTNEVIRQVMEDEAQLGLVFNPPRDPHLRVHGSRGQPLYAMVAPEHPLAATQGPVTLTELGQHRLALPDISYGIRQMLDAVEQAAGQRLAPTLTCNTFALLKHYAQQGGVTLLPLFAATQELDSGALRALPLADPGFARAHVELVTRLGRKLSRAADELRTSLVQQMTAFR
>NZ_CP044074.1|WP_150339844.1|3348170_3349325_-|amidohydrolase
MTIHQALLDDARSWRRDFHAHPELGFAEHRTAARVAELLEGFGLEVHRGLGGTGVVGVLRHGEGPSLGLRADMDALPMQEVGDVPHRSTAAGRMHACGHDGHTAILLATARHLSENRDFRGTLYFVFQPAEENLGGAQKMIEDGLFERFPMDAIYGLHNWPGLPAGQVVVNPGAMMASLDTFAITLTGKGCHAAMPERGRDPIVAAADLILQLQTIVARRITPLASAVVSVTMMEAGEAINVIPEVARLRGTVRCLDGAVRAEVERLIGEIVAQAPLAQGVRGELEFTRGYPVTQNHPAQAARVREAAVRAFGAERVSDGVPPSMASEDFAFMLAARPGAYLWLGVDGAQPSAPLHNPAYDFNDAIIEPAVRLWAELVRQELPA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1162556 : 1201980

uncultured_Caudovirales_phage(58.82%)

integrase,protease,plate,tRNA,tail

attL 1152457:1152474|attR 1185206:1185223

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1152457:1152474	attL	NA	NA	NA	NA
WP_007162298.1\|1162556_1162913_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	2.3e-10	39.5
WP_007162299.1\|1162961_1165232_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.8e-164	43.0
WP_002553999.1\|1165303_1165522_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_150338531.1\|1165616_1166324_-	arginyltransferase	NA	NA	NA	NA
WP_150338532.1\|1166359_1167049_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_058791300.1\|1167305_1169789_+	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	1.5e-87	51.7
WP_007162303.1\|1169806_1170430_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_027597796.1\|1170439_1171768_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	3.7e-77	40.2
WP_027597797.1\|1171815_1173093_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	4.3e-99	53.8
WP_007162306.1\|1173092_1174487_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_150338533.1\|1174490_1175492_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_150338534.1\|1175557_1176541_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	2.8e-122	65.4
WP_007162309.1\|1176537_1176849_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	8.8e-30	63.6
WP_144946591.1\|1176851_1177151_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_150338535.1\|1177147_1177504_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	5.5e-20	50.0
WP_007162312.1\|1177505_1177901_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	4.0e-43	63.8
WP_007162313.1\|1177950_1178619_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	9.6e-82	73.5
WP_150338536.1\|1178954_1180004_-\|integrase	tyrosine-type recombinase/integrase	A0A2H4JDJ8	uncultured_Caudovirales_phage	1.1e-105	57.9
WP_150338537.1\|1180005_1180248_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_150338538.1\|1180976_1181297_-	hypothetical protein	NA	NA	NA	NA
WP_150338539.1\|1181293_1181734_-	hypothetical protein	NA	NA	NA	NA
WP_150338540.1\|1182400_1182817_+	hypothetical protein	NA	NA	NA	NA
WP_150338541.1\|1182863_1183235_-	hypothetical protein	NA	NA	NA	NA
WP_150338542.1\|1183359_1183980_-	hypothetical protein	A0A2H4JC30	uncultured_Caudovirales_phage	1.8e-106	85.0
WP_150338543.1\|1184001_1184241_-	hypothetical protein	A0A2H4J8F2	uncultured_Caudovirales_phage	1.2e-21	89.8
WP_150338544.1\|1184237_1184441_-	hypothetical protein	A0A2H4J8H0	uncultured_Caudovirales_phage	2.5e-25	85.1
WP_074583551.1\|1185021_1185282_-	hypothetical protein	A0A2H4JFR3	uncultured_Caudovirales_phage	7.1e-25	98.2
1185206:1185223	attR	NA	NA	NA	NA
WP_150340689.1\|1185278_1185617_-	helix-turn-helix transcriptional regulator	A0A2H4JA92	uncultured_Caudovirales_phage	2.2e-42	91.1
WP_108581872.1\|1185664_1185886_-	hypothetical protein	A0A2H4J8H1	uncultured_Caudovirales_phage	6.3e-06	42.6
WP_150338545.1\|1185882_1186107_-	hypothetical protein	A0A2H4JG58	uncultured_Caudovirales_phage	9.1e-29	86.5
WP_108582119.1\|1186758_1187019_-	DUF1654 domain-containing protein	A0A2H4J8G7	uncultured_Caudovirales_phage	1.8e-15	58.5
WP_150338546.1\|1187612_1188110_-	hypothetical protein	NA	NA	NA	NA
WP_150338547.1\|1188212_1189265_-	hypothetical protein	NA	NA	NA	NA
WP_150338548.1\|1189874_1190069_-	hypothetical protein	NA	NA	NA	NA
WP_108582124.1\|1190091_1190844_-	helix-turn-helix domain-containing protein	A0A2H4J8I0	uncultured_Caudovirales_phage	2.0e-72	84.8
WP_108582125.1\|1190888_1191116_+	hypothetical protein	A0A2H4J0V8	uncultured_Caudovirales_phage	2.1e-12	55.1
WP_150338549.1\|1191030_1193877_+\|tail	phage tail tape measure protein	U5P420	Shigella_phage	1.2e-112	47.8
WP_150338550.1\|1193876_1195181_+	hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	3.2e-97	44.7
WP_150338551.1\|1195187_1196300_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	9.9e-108	57.4
WP_150338552.1\|1196296_1196803_+\|plate	phage baseplate assembly protein V	B5TK73	Pseudomonas_phage	2.3e-59	69.0
WP_150338553.1\|1196805_1197207_+	hypothetical protein	B5TK74	Pseudomonas_phage	1.1e-40	63.8
WP_150338554.1\|1197196_1198234_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	4.9e-117	62.8
WP_150338555.1\|1198224_1198821_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	1.9e-81	74.9
WP_150340690.1\|1199073_1199775_+\|tail	phage tail protein	A9YX14	Burkholderia_phage	9.2e-51	52.1
WP_150338556.1\|1199782_1200262_+	DUF4376 domain-containing protein	A0A1S5R1J2	Pseudomonas_phage	3.5e-25	52.5
WP_150338557.1\|1200258_1200618_+	DUF1353 domain-containing protein	A0A2H4JDM4	uncultured_Caudovirales_phage	2.3e-50	78.4
WP_150338558.1\|1200734_1201208_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	2.5e-76	92.4
WP_150338559.1\|1201207_1201618_+	hypothetical protein	A0A2H4JA72	uncultured_Caudovirales_phage	1.0e-38	74.3
WP_150340691.1\|1201722_1201980_+	hypothetical protein	A0A2H4J8E9	uncultured_Caudovirales_phage	1.2e-32	84.7

DBSCAN-SWA_2

2315659 : 2324254

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042132995.1\|2315659_2316574_-	dTDP-4-dehydrorhamnose reductase	I7HXC9	Enterobacteria_phage	2.1e-34	34.4
WP_007160389.1\|2316570_2317107_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	5.9e-58	63.1
WP_007160390.1\|2317106_2317988_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.6e-105	65.2
WP_150339065.1\|2318060_2319125_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	8.9e-98	51.2
WP_037006952.1\|2319346_2321329_-	polysaccharide biosynthesis protein	K7Y9E1	Megavirus	6.5e-17	26.1
WP_150339067.1\|2321339_2322389_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_150339069.1\|2322385_2323360_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_007160395.1\|2323500_2323722_-	hypothetical protein	NA	NA	NA	NA
WP_007160396.1\|2323966_2324254_-	integration host factor subunit beta	G3M9Y0	Bacillus_virus	1.6e-09	39.1

DBSCAN-SWA_3

3572698 : 3580981

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_007161291.1\|3572698_3572923_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	5.0e-19	56.8
WP_027598230.1\|3572933_3573338_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	F8WQ19	Bacillus_phage	2.0e-10	34.1
WP_150340036.1\|3573319_3575461_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	5.8e-205	49.2
WP_027598228.1\|3575483_3576452_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0M4S3B4	Mycobacterium_phage	1.4e-134	73.4
WP_150340039.1\|3576956_3578495_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_145249174.1\|3578491_3579028_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A2P1EI66	Megavirus	2.4e-14	30.5
WP_150340042.1\|3579115_3580981_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.2e-34	27.6

DBSCAN-SWA_4

3834267 : 3945107

uncultured_Caudovirales_phage(15.38%)

plate,transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150340158.1\|3834267_3834975_-\|transposase	transposase	NA	NA	NA	NA
WP_150340160.1\|3835192_3835666_-\|transposase	transposase	NA	NA	NA	NA
WP_150340162.1\|3835754_3835961_-	hypothetical protein	NA	NA	NA	NA
WP_150340164.1\|3835957_3837157_-	hypothetical protein	NA	NA	NA	NA
WP_150340166.1\|3837206_3837914_-\|transposase	transposase	NA	NA	NA	NA
WP_150340168.1\|3838352_3838748_-	hypothetical protein	NA	NA	NA	NA
WP_150340170.1\|3839714_3840044_-	hypothetical protein	NA	NA	NA	NA
WP_150340172.1\|3840043_3851947_-	filamentous hemagglutinin N-terminal domain-containing protein	NA	NA	NA	NA
WP_150340174.1\|3852010_3853717_-	ShlB/FhaC/HecB family hemolysin secretion/activation protein	NA	NA	NA	NA
WP_150340176.1\|3854028_3854532_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_150340178.1\|3854569_3855160_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_144954895.1\|3855236_3855866_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_150340180.1\|3856014_3856773_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_150340182.1\|3856812_3857346_+	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	1.7e-17	32.7
WP_044343147.1\|3857357_3858305_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_144961175.1\|3858402_3859203_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_150340184.1\|3859229_3859994_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_150340186.1\|3860045_3861218_+	MFS transporter	NA	NA	NA	NA
WP_150340188.1\|3861260_3861776_-	peroxidase-related enzyme	NA	NA	NA	NA
WP_044343151.1\|3861899_3862721_+	AraC family transcriptional regulator	NA	NA	NA	NA
WP_027598608.1\|3862717_3863389_-	nucleoside/nucleotide kinase family protein	NA	NA	NA	NA
WP_150340190.1\|3863662_3865123_+	DUF945 family protein	NA	NA	NA	NA
WP_150340192.1\|3865345_3867307_-	DUF4105 domain-containing protein	NA	NA	NA	NA
WP_007160025.1\|3867303_3867624_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_150340194.1\|3867658_3867958_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_007160027.1\|3868058_3868379_-	DUF2388 domain-containing protein	NA	NA	NA	NA
WP_150340196.1\|3868452_3868662_-	DUF1127 domain-containing protein	NA	NA	NA	NA
WP_027600427.1\|3868923_3869877_+	N-acetyl-gamma-glutamyl-phosphate reductase	NA	NA	NA	NA
WP_150340198.1\|3870065_3870704_-	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_027598615.1\|3870905_3871535_+	thiol:disulfide interchange protein DsbA/DsbL	NA	NA	NA	NA
WP_144961162.1\|3871712_3873500_+	diguanylate cyclase	NA	NA	NA	NA
WP_150340200.1\|3873525_3874311_+	N-acetylmuramoyl-L-alanine amidase	A0A076YN96	Rhizobium_phage	1.6e-14	30.9
WP_037006569.1\|3874326_3875424_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_027600430.1\|3875890_3876829_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027598620.1\|3877099_3878038_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027598621.1\|3878154_3878997_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_150340202.1\|3879000_3880233_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-25	35.1
WP_027598623.1\|3880520_3880823_-	HigA family addiction module antidote protein	A0A191ZBZ4	Erwinia_phage	5.0e-06	38.8
WP_144945649.1\|3880916_3881195_-	plasmid maintenance system killer protein	NA	NA	NA	NA
WP_077171181.1\|3881449_3882307_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_007160039.1\|3882405_3883035_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_027598627.1\|3883050_3886071_-	sarcosine oxidase subunit alpha	NA	NA	NA	NA
WP_017639232.1\|3886067_3886367_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_017639231.1\|3886378_3887629_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_074583431.1\|3887708_3888962_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.2e-105	54.3
WP_150340204.1\|3889176_3890535_+	PAS domain-containing protein	NA	NA	NA	NA
WP_007160045.1\|3890616_3891045_+	universal stress protein	NA	NA	NA	NA
WP_007160046.1\|3891103_3891883_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_007160047.1\|3891963_3892605_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_042134854.1\|3892622_3893219_+	hypothetical protein	NA	NA	NA	NA
WP_077171187.1\|3893365_3894031_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_027598633.1\|3894046_3894898_+	urea carboxylase-associated family protein	NA	NA	NA	NA
WP_007160051.1\|3894958_3895861_-	acetylglutamate kinase	NA	NA	NA	NA
WP_037006571.1\|3895935_3898497_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	7.0e-56	30.4
WP_027598635.1\|3898542_3898998_-	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	2.7e-51	62.4
WP_027600436.1\|3898990_3900214_-	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	4.1e-38	31.6
WP_027598637.1\|3900349_3901024_+	JAB domain-containing protein	NA	NA	NA	NA
WP_150340206.1\|3901362_3902901_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_027600438.1\|3902930_3903425_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_150340208.1\|3903439_3904918_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_150340210.1\|3904924_3905329_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_150340212.1\|3905333_3907118_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_144945619.1\|3907081_3908092_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_150340214.1\|3908107_3910636_+	type VI secretion system ATPase TssH	A0A1C3S747	Escherichia_phage	6.8e-88	31.8
WP_150340216.1\|3910632_3912129_+	AAA domain-containing protein	NA	NA	NA	NA
WP_144954823.1\|3912140_3912269_+	type VI secretion protein	NA	NA	NA	NA
WP_150340218.1\|3912283_3913474_+	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_027598647.1\|3913475_3913946_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_150340220.1\|3913949_3915281_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_027598649.1\|3915283_3916171_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_150340222.1\|3916186_3919618_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_150340224.1\|3919617_3920349_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_150340226.1\|3920345_3921311_+	protein kinase	M1PAV8	Moumouvirus	8.6e-15	27.8
WP_150340228.1\|3921338_3923378_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	6.4e-36	28.7
WP_150340230.1\|3923433_3925767_+	hypothetical protein	NA	NA	NA	NA
WP_150340232.1\|3925750_3926125_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_150340234.1\|3926127_3926799_-	uracil-DNA glycosylase	NA	NA	NA	NA
WP_042134870.1\|3926939_3927317_+	glutaredoxin	NA	NA	NA	NA
WP_027598761.1\|3927483_3928581_-	hybrid-cluster NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_027598760.1\|3928908_3930201_+	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_144945580.1\|3930376_3932002_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.8e-57	39.8
WP_027598758.1\|3932144_3933770_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.9e-37	33.2
WP_042135022.1\|3933867_3934500_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_037007709.1\|3934510_3934921_+	DUF2141 domain-containing protein	NA	NA	NA	NA
WP_150340236.1\|3935653_3936460_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_044341226.1\|3936456_3937665_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_027598754.1\|3937757_3938654_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_007160170.1\|3938694_3939018_-	DUF883 domain-containing protein	NA	NA	NA	NA
WP_007160169.1\|3939236_3939452_+	dodecin domain-containing protein	NA	NA	NA	NA
WP_042135014.1\|3939495_3939723_+	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_150340238.1\|3939811_3940981_-	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_150340240.1\|3941112_3942651_+	nitric oxide reductase transcriptional regulator NorR	NA	NA	NA	NA
WP_150340242.1\|3942668_3943586_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_027598750.1\|3943607_3945107_-\|holin	choline-sulfatase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP044073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044073_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044073_1

96006-96098

Orphan

Consensus_repeat	Method
TGACAATCTAAACGGGTTTGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044073_1

>merge|NZ_CP044073|1|96006-96098|CRISPRCasFinder
TGACAATCTAAACGGGTTTGTTGGTGAGGAAAAAAGCAGGCATGGCAATGGTCCATTTCTTAGTACTACTGACAATCTAAACGGGTTTGTTGG

>NZ_CP044073|1|1|96006-96098|CRISPRCasFinder
TGACAATCTAAACGGGTTTGTTG	GTGAGGAAAAAAGCAGGCATGGCAATGGTCCATTTCTTAGTACTAC
TGACAATCTAAACGGGTTTGTTGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	unknown	unknown	gnl\|CDD\|380271
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP044073.1\|WP_150338144.1\|106884_107151_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949335.1\|98303_98768_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949323.1\|103996_104911_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_027602314.1\|93147_93429_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	unknown	unknown	gnl\|CDD\|176458
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223704
NZ_CP044073.1\|WP_144949341.1\|96721_97192_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235553
NZ_CP044073.1\|WP_144949400.1\|87149_87500_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949338.1\|97252_97567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949403.1\|85910_86555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949406.1\|85206_85914_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949320.1\|104989_106150_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP044073.1\|WP_150338143.1\|106292_106757_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949411.1\|83715_84483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949569.1\|91506_91740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949397.1\|87509_87992_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	gnl\|CDD\|380271	NF033429, ImuA_translesion, translesion DNA synthesis-associated protein ImuA. A three-gene cassette encoding ImuA, ImuB, and ImuC (""inducible mutagenesis"") is induced by DNA damage, is capable of DNA synthesis across DNA damage lesions, and consequently is associated with mutagenesis. This family, ImuA (previously misnamed SulA in Pseudomonas putida) shows some homology to SulA itself and to RecA. ImuB resembles Y-family polymerases but may be catalytically inactive. ImuC is a C-family polymerase, and catalytically active.	1.44677e-81
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	8.56597e-11
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.01156e-48
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	6.23318e-06
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	gnl\|CDD\|176458	cd03468, PolY_like, DNA Polymerase Y-family. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions. Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in order to access the lesion. Because of their high error rates, TLS polymerases are potential targets for cancer treatment and prevention.	3.25036e-70

>NZ_CP044073.1|WP_027602314.1|93147_93429_+|hypothetical-protein
MSHQVNKFSLTSYVEAFFPSNFEVMLERSETNPDDRILTVCDVITDRTTSYEGPLLAILDICSMGAIAADLCNELCGHAATRRVEISKLRKWS
>NZ_CP044073.1|WP_144949569.1|91506_91740_+|hypothetical-protein
MKELDRKHGIELLERYSAEQDAINQLLRQIYECHGTADTEALRNMLGLCIVEIQERQETVLKAFRFLLESDARPQET
>NZ_CP044073.1|WP_144949391.1|89361_90588_+|tyrosine-type-recombinase/integrase
MWRVIVGQLLPRQVKELCEPGVYQDGRGLILRVAKTGAKRWIFRFSFQGQRYDVGLGGYPAVSLKQARLEADRRRLKIAKGVPELPGRRSPAAPSPAAGQDLFATLARQYIATHGASWSHDHHRQWASSMERYVFPVLGRRPVAKIDTDLVLQVLSPIWDKINVSAARIRNRIESVLDAAQALGYREGANPARWHGHLDKLLPRHDRNVVHHPAAAAESCPSVLHRLDSLEGSAARAAELLILTSLRNAEVREARWCEFDFPAMRWTIPAERMKCEREHIVPLTERMLEVLDQQKGQHDTWVFPNARGKKPLPGNAIGRALRKIKLEGAVPHGFRSTFRTWAAETTSHPREICEKVLAHRIGSKTEAAYNRGQLLEKRRKLMSDWETFLAMPDLPTSQAVTPGRLQDA
>NZ_CP044073.1|WP_144949394.1|87988_89086_-|hypothetical-protein
MTLATNQPNKQTKQTPLFVWYGWGYDAVFFDPEAAMAERKFTDAEVIAAGEQLLAGGRKVNGWALRTTLGGGRPETLLSVWQRHHTGVPGGAIPTRPLPEEATAIIETAVAKQTKAMQEALAGALDLVAAAARKEVVLELEQARQEIARLEAEQDDASGVLEGLEADQERSQQQMDGLANELQLKDSQLSAMAEENASLAERLAEAEGQAQLARDQLAESQAELSLALAQKASAEAASVECQRSASAAEERLADTQVELREMRNRLAIARSEADSAAGQIQEMERTRAQDLEILTELRVENRALGDKLARADAGREAAERYLERVQKDSSGRIAALERQFAKAASKPAPRGTGKAPRAASPAAGE
>NZ_CP044073.1|WP_144949397.1|87509_87992_-|hypothetical-protein
MTVAKQFEGFHVYGGSAALKFEVVLNQAQESVLSVDGAGRKGSSENFDWSEKLTLQITPREMPAFMCCVLGITPAFEARNHGAAGDKGLTLVNQPERGVLYLRLLQQRLSINVPITADKVFHLGALGIRVLAEQVHLDVPTCLAMLRGTAGRLLIAAAGD
>NZ_CP044073.1|WP_144949400.1|87149_87500_+|hypothetical-protein
MSAKPFQVLFSTTARTGALDQVHHLAKSISHPGGLAKMSCVVDEVAVELRKSALPYLIAGAGAGAEFGITRYREIAKSGYRAGYLVDEPRREAVVLAIFRGGQDIRELLYRHLLTG
>NZ_CP044073.1|WP_144949403.1|85910_86555_-|hypothetical-protein
MKGQDVGLLLRLVCLERHESSRNALTAWPHDWQDWELAAADVQHVPQPGIDLVGDLASAPSYTARALEEQTGISKSQIALSLNHCIEIGLVKMDRQHGVPRANKRALFEFIVYGLRYVFPARYGELTRGIATSFAAPVLSKTLISGGDHVPVWPNARGRTMGMKVEPLFKTAVEAARKDPEMYALLALVDAIRLGQPRERNVAIDVLQERLGLQ
>NZ_CP044073.1|WP_144949406.1|85206_85914_-|hypothetical-protein
MSVFSTLTEMLRRVAHALGPHLCQQMTFVGGCTTGLLLTDDYTREQVRSTDDVDLIVHVMGVIGFTKLREQLREQGFSEYPPSGDEDVPICSMRLGELRVDFMPDDESLGFSNRWYKAAMATSTQYQLDESTAIMLVSPVYFIATKLEAWKGRGNGDALASRDIEDVLNLVDGREELMGEVQAADEAVQDYIAMEIATLFADRNFQDAVSSQSRGDTDREGLIWERLETLAQGRR
>NZ_CP044073.1|WP_144949408.1|84517_85207_-|hypothetical-protein
MRIEWLSRQGKERSSNNDAAAIGYKGNHVLALVVDASDKANGQAFSRHWATTIVKTAMEHSRPLDIGLLEQVMWAEQRQLRSTYLHTSASYCCALIDLGTRTIDVRYVGDCMFGTQAAQTPIQWVLTPHTLYHQAAQMGVQDVSAESRHILTRSLNARRYCEPGRTSMGLPDARLIICSDGYWNEHLTFGIDLDQLSDDASVLSLDPGAPALIDNSDCQNIRVFDMRIP
>NZ_CP044073.1|WP_144949411.1|83715_84483_+|hypothetical-protein
MAKSNDSETLTLVSERLEHVALIFDLRHHYYDLSLIRDVGENGWTHPWRYFDALMYYLLLTCFDLLGQPGDWVPFSTWLESKKKNNERQHALESIPKNADPIAIAKHLSASYQAIYGVKNSFYNFILNVLTQEERDELFSNIDITRAVLGGDPCTSYPALGKITDERKKLDFLFSLRNKFTHSAVTMGSPTAGVFSGAYEPIVIEGKAYKGYVDIHREVKNGERIIYSVQDWPYCLQRIINNVVSRKSLSIDNRL
>NZ_CP044073.1|WP_144949341.1|96721_97192_+|hypothetical-protein
MYDPTNPQPDRQRIHDNFQQAIGAMEGIRQTIKAEALRLRDEYFAAAKQRSGGKIIYRLIDVRDNGKGAISIAWCKVFFYDGAGDKKQQGRLPIAKGQGVTYAPGLVTRGMDHWFIELFQLYEPQLAVLRDQMLYASKIRKLLVQQQRKAQSSMLG
>NZ_CP044073.1|WP_144949338.1|97252_97567_+|hypothetical-protein
MHRPPEMDHPIIVDAVDLDLWADLYKDSQAPVTLSEFLQQPYLYLKQSGLPVSSEATQEAYPVFLPVRKEVARQIQDEWACQQLAQQSRQQARRHLTLITCTPG
>NZ_CP044073.1|WP_144949335.1|98303_98768_+|hypothetical-protein
MDMLGDEQDSFEQQQSLFRPTELTYCRNLVDLLTEELDQVRQCLGQAQRANRVLIAERDNLVADRDAFKAEVQRHRLRYVQFVQEENQRHVPRGDRLIPDDRDDPLSRAQRHILRLESMNSVLHADLFKVRAQLQILLTERGSTPSAPTGVQHG
>NZ_CP044073.1|WP_144949332.1|98760_99393_+|translesion-DNA-synthesis-associated-protein-ImuA
MDNAATNVVALDSLLDSRRVWRGQSSHVDDASTQPTGHAALDAQLPLGGWPDAALTEILSARTGLGELCLVWPTLARLTAAGERVVLIAPPYLLYPHAWLQAGVDLGRLSVIQVQGKDVLWAAEQCLRSGSCGAVLCWPSRADDRALRRLQVAAETGQTLAFAFRHQREAVNASPAALRLVLEGSPQQLRVLKCRGGNPPATALAHRVWH
>NZ_CP044073.1|WP_144949329.1|99405_100821_+|DNA-polymerase-Y-family-protein
MKWACIFFPQFALDGVLRNCPDPDEALVLLHGPIQRRIIKAANPAALALGLRPEMTYTAAQAICPQFATVEYDEAALRRQHELLAAWAYGFSSQVSLHFADALVLEVQSSLPLFGPWPRFEARLRQELTALGFGHRITLAPNPVAARVLANAGDSLNVRDDAGLASAMRTLPVALLGFEPEIVQALSRMGLRQLSQVLALPRAQLARRFPLSLLNHLDQMLGSKVLPLEFFLPPTTFRLRIELNFEVESTQALLFPLRRLTSDLATYLAGRDMGAQRFTLRLKHREAPTTEIVVGLLAPERDPALLFEFARGRLEPTQVVEPVLAIGLVADELPSFVPQHCGLFDERPQQTVSWEQLRERLRTRLGDDAVYAVAAQGDHRPERAWRRDTPSLALQALGPNRRPGWLLPAPEPLDVDQSRVLSGPERIESGWWDGEDARRDYYVLELSDGRTAWAFQSPAEGPGWWVQGWFA
>NZ_CP044073.1|WP_150338142.1|100817_103892_+|DNA-polymerase-III-subunit-alpha
MTPGYAELHCLSNFSFQRGASSVDQLFERAKAIGYEALAITDECTLAGIVRAWQASEKHDVRLIVGSEFQIAQGPKLVLLVQDLQGYQQLCRLITLARRRADKGSYRLLREDLDQVAGLLALWVPDRGAEAESARWLLDVFPGRLWIATGLHFDQDDQVRLQQLKRLGEALKLPLVAAGDVHMHCRGRRALQDTITAIRHHVPVAEAGQLLFPNGERHLRTREALARCYPSELLEETLRIAERCTFSLAELRYQYPSEVVPEGHTATSWLRVLTEEGCAWRWPEGLSDRLRAQIEKELQLIADKAYESYFLTVHDIVRFARQQGILCQGRGSAANSAVCFALGITELDPTRINLLFERFISHERDEPPDIDVDFEHDCREEVIQYIFRRYGRQRAALTAVVSTYHAAGAVRDVAKALGLPPDQITALADCCGRWTDNLPPPERLRESGFDPDSPLLHRILVLTGELIGFPRHLSQHPGGFVIADQTLDTLVPVENAAMEGRTVIQWDKDDLDAMSLLKVDILALGMLSALRRCFDLVKGYRGEELTLATVPQEDKPTYAMISRADTLGVFQIESRAQMAMLPRLKPQTFYDLVIEVAIVRPGPIQGGMVHPYLRRRTGQEEISYPPELERVFGRTLGVPLFQEQVMELAILAADYTPGEADQLRRSMAAWKRHGGLEPHRERLTTRMLANGYTAEYAADIFRQIEGFGSYGFPESHAASFALLTYASCWLKCHEPAAFAAALINSYPMGFYSPDQILQDARRHRLQTLPVDVTYSDWDCSLEAVAGSSQPAIRMGLRMVRGLAEKAGRAVEQARQQRPFRDVTDLCLRAGLDAKARECLADAGALKGLAGHRFQARWAMAAIEPQLPLFAEGAVVEEEIQELVAPTVGEDLYSDYASLGTTLGPHPLTLLRPELSARRLMSSHELKERRHGQPARVAGLVVGRQRPGTASGVTFVTLEDEFGMVNVVVWRTLAERQRRELVASQLLRVDGTVETRDGVLHIVAGRLEDISDLLQGLDTRSRDFH
>NZ_CP044073.1|WP_144949323.1|103996_104911_-|hypothetical-protein
MNSGPEKYDIKCELLYGLMTYGDGSVENPLRGNWNTWHFGSRGILTWIVMEALDIKRYPWHPDITQCIKPQSEDSLEILRYLTAYLNTEEKVQDLIDEMRRIYDFTQDSLLKSGKNYIHLFRSLNDGNYKADEDNKGGYASNIVKLSKAAIQLKRESFKIAANVLTSWDKNGGYANNPVAISMDHPIRNIVWTSDLIATKSNYPYSPAVESGEWVVVNRSLDGKLSVPAINVTCKKTLKNMERLEAQLSRLKNNDELAVEWLDRGEVRLEPFLGYTEPHLGESIIGLCFKDRLRLALDIIFPRK
>NZ_CP044073.1|WP_144949320.1|104989_106150_-|hypothetical-protein
MAARRPLFKRTALAESLVRELAGETFHDHSSGLFLAAPRRTGKSTFLKNDLIPACEARGWLAVYVDLWADKQTDPADLIAGAIGEALAEYESGLSKVAKKAGIEKLNLLRTLSWDFTRPQLPTGTTLAKALDVLRTVSGRMIVLIVDEAQHALNSEAGVAAMFALKAARDQLNSGVEEDGVRMVFTGSSRDKLANLVLKNGQPFYGARVSEFPRLGRDYVEFVTELWNGSLAAHNQFAIEDVAYAFELVGRRPEMLTALLSDTRVILGEAGNLGELLREGALNHQQGVWSDYESACNDLLPLQRAVLKVIAERAMRKQSFAPFSSETLEAINRMLEQAHEMPNATKPNVQKALEVLRERELIWKANRGEYALEDSAMVGWLVDSAD
>NZ_CP044073.1|WP_150338143.1|106292_106757_-|hypothetical-protein
MQTPNTSSTPALPLQLCVHRYYSRAEDPAFQQLLVVWNQVAPILAAAPAGTVAKVDSESLFVAPLNGALAMFLSADLSPTAVDGNIFRPEDFDGIGADEFAELQSALERWMAAPTYDTPCTPSHLADVLAANYQEPGAPREWQWSGETKNTSGQ
>NZ_CP044073.1|WP_150338144.1|106884_107151_-|hypothetical-protein
MLVIHLESGRVINLERSVSTVNGYGIWEYHRSQSSSMWVPDYTPYRHLAVKPPDPAIGQKVTVAICKLGAPEEEWKPFRSEIAGFDGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044073_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044073_2

96329-96420

Orphan

Consensus_repeat	Method
TGACAATCTAAACGGGTTTGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044073_2

>merge|NZ_CP044073|2|96329-96420|CRISPRCasFinder
TGACAATCTAAACGGGTTTGTTGGAGAGAAAAAAGCAAACATGGAAATGATCCATTTCTTAGTACTACTGACAATCTAAACGGGTTTGTTGT

>NZ_CP044073|2|2|96329-96420|CRISPRCasFinder
TGACAATCTAAACGGGTTTGTTG	GAGAGAAAAAAGCAAACATGGAAATGATCCATTTCTTAGTACTAC
TGACAATCTAAACGGGTTTGTTGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	unknown	unknown	gnl\|CDD\|380271
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP044073.1\|WP_150338144.1\|106884_107151_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949335.1\|98303_98768_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949323.1\|103996_104911_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_027602314.1\|93147_93429_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	unknown	unknown	gnl\|CDD\|176458
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223704
NZ_CP044073.1\|WP_144949341.1\|96721_97192_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235553
NZ_CP044073.1\|WP_144949400.1\|87149_87500_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949338.1\|97252_97567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949403.1\|85910_86555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949406.1\|85206_85914_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949320.1\|104989_106150_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP044073.1\|WP_150338143.1\|106292_106757_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949411.1\|83715_84483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949569.1\|91506_91740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949397.1\|87509_87992_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	gnl\|CDD\|380271	NF033429, ImuA_translesion, translesion DNA synthesis-associated protein ImuA. A three-gene cassette encoding ImuA, ImuB, and ImuC (""inducible mutagenesis"") is induced by DNA damage, is capable of DNA synthesis across DNA damage lesions, and consequently is associated with mutagenesis. This family, ImuA (previously misnamed SulA in Pseudomonas putida) shows some homology to SulA itself and to RecA. ImuB resembles Y-family polymerases but may be catalytically inactive. ImuC is a C-family polymerase, and catalytically active.	1.44677e-81
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	8.56597e-11
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.01156e-48
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	6.23318e-06
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	gnl\|CDD\|176458	cd03468, PolY_like, DNA Polymerase Y-family. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions. Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in order to access the lesion. Because of their high error rates, TLS polymerases are potential targets for cancer treatment and prevention.	3.25036e-70

>NZ_CP044073.1|WP_027602314.1|93147_93429_+|hypothetical-protein
MSHQVNKFSLTSYVEAFFPSNFEVMLERSETNPDDRILTVCDVITDRTTSYEGPLLAILDICSMGAIAADLCNELCGHAATRRVEISKLRKWS
>NZ_CP044073.1|WP_144949569.1|91506_91740_+|hypothetical-protein
MKELDRKHGIELLERYSAEQDAINQLLRQIYECHGTADTEALRNMLGLCIVEIQERQETVLKAFRFLLESDARPQET
>NZ_CP044073.1|WP_144949391.1|89361_90588_+|tyrosine-type-recombinase/integrase
MWRVIVGQLLPRQVKELCEPGVYQDGRGLILRVAKTGAKRWIFRFSFQGQRYDVGLGGYPAVSLKQARLEADRRRLKIAKGVPELPGRRSPAAPSPAAGQDLFATLARQYIATHGASWSHDHHRQWASSMERYVFPVLGRRPVAKIDTDLVLQVLSPIWDKINVSAARIRNRIESVLDAAQALGYREGANPARWHGHLDKLLPRHDRNVVHHPAAAAESCPSVLHRLDSLEGSAARAAELLILTSLRNAEVREARWCEFDFPAMRWTIPAERMKCEREHIVPLTERMLEVLDQQKGQHDTWVFPNARGKKPLPGNAIGRALRKIKLEGAVPHGFRSTFRTWAAETTSHPREICEKVLAHRIGSKTEAAYNRGQLLEKRRKLMSDWETFLAMPDLPTSQAVTPGRLQDA
>NZ_CP044073.1|WP_144949394.1|87988_89086_-|hypothetical-protein
MTLATNQPNKQTKQTPLFVWYGWGYDAVFFDPEAAMAERKFTDAEVIAAGEQLLAGGRKVNGWALRTTLGGGRPETLLSVWQRHHTGVPGGAIPTRPLPEEATAIIETAVAKQTKAMQEALAGALDLVAAAARKEVVLELEQARQEIARLEAEQDDASGVLEGLEADQERSQQQMDGLANELQLKDSQLSAMAEENASLAERLAEAEGQAQLARDQLAESQAELSLALAQKASAEAASVECQRSASAAEERLADTQVELREMRNRLAIARSEADSAAGQIQEMERTRAQDLEILTELRVENRALGDKLARADAGREAAERYLERVQKDSSGRIAALERQFAKAASKPAPRGTGKAPRAASPAAGE
>NZ_CP044073.1|WP_144949397.1|87509_87992_-|hypothetical-protein
MTVAKQFEGFHVYGGSAALKFEVVLNQAQESVLSVDGAGRKGSSENFDWSEKLTLQITPREMPAFMCCVLGITPAFEARNHGAAGDKGLTLVNQPERGVLYLRLLQQRLSINVPITADKVFHLGALGIRVLAEQVHLDVPTCLAMLRGTAGRLLIAAAGD
>NZ_CP044073.1|WP_144949400.1|87149_87500_+|hypothetical-protein
MSAKPFQVLFSTTARTGALDQVHHLAKSISHPGGLAKMSCVVDEVAVELRKSALPYLIAGAGAGAEFGITRYREIAKSGYRAGYLVDEPRREAVVLAIFRGGQDIRELLYRHLLTG
>NZ_CP044073.1|WP_144949403.1|85910_86555_-|hypothetical-protein
MKGQDVGLLLRLVCLERHESSRNALTAWPHDWQDWELAAADVQHVPQPGIDLVGDLASAPSYTARALEEQTGISKSQIALSLNHCIEIGLVKMDRQHGVPRANKRALFEFIVYGLRYVFPARYGELTRGIATSFAAPVLSKTLISGGDHVPVWPNARGRTMGMKVEPLFKTAVEAARKDPEMYALLALVDAIRLGQPRERNVAIDVLQERLGLQ
>NZ_CP044073.1|WP_144949406.1|85206_85914_-|hypothetical-protein
MSVFSTLTEMLRRVAHALGPHLCQQMTFVGGCTTGLLLTDDYTREQVRSTDDVDLIVHVMGVIGFTKLREQLREQGFSEYPPSGDEDVPICSMRLGELRVDFMPDDESLGFSNRWYKAAMATSTQYQLDESTAIMLVSPVYFIATKLEAWKGRGNGDALASRDIEDVLNLVDGREELMGEVQAADEAVQDYIAMEIATLFADRNFQDAVSSQSRGDTDREGLIWERLETLAQGRR
>NZ_CP044073.1|WP_144949408.1|84517_85207_-|hypothetical-protein
MRIEWLSRQGKERSSNNDAAAIGYKGNHVLALVVDASDKANGQAFSRHWATTIVKTAMEHSRPLDIGLLEQVMWAEQRQLRSTYLHTSASYCCALIDLGTRTIDVRYVGDCMFGTQAAQTPIQWVLTPHTLYHQAAQMGVQDVSAESRHILTRSLNARRYCEPGRTSMGLPDARLIICSDGYWNEHLTFGIDLDQLSDDASVLSLDPGAPALIDNSDCQNIRVFDMRIP
>NZ_CP044073.1|WP_144949411.1|83715_84483_+|hypothetical-protein
MAKSNDSETLTLVSERLEHVALIFDLRHHYYDLSLIRDVGENGWTHPWRYFDALMYYLLLTCFDLLGQPGDWVPFSTWLESKKKNNERQHALESIPKNADPIAIAKHLSASYQAIYGVKNSFYNFILNVLTQEERDELFSNIDITRAVLGGDPCTSYPALGKITDERKKLDFLFSLRNKFTHSAVTMGSPTAGVFSGAYEPIVIEGKAYKGYVDIHREVKNGERIIYSVQDWPYCLQRIINNVVSRKSLSIDNRL
>NZ_CP044073.1|WP_144949341.1|96721_97192_+|hypothetical-protein
MYDPTNPQPDRQRIHDNFQQAIGAMEGIRQTIKAEALRLRDEYFAAAKQRSGGKIIYRLIDVRDNGKGAISIAWCKVFFYDGAGDKKQQGRLPIAKGQGVTYAPGLVTRGMDHWFIELFQLYEPQLAVLRDQMLYASKIRKLLVQQQRKAQSSMLG
>NZ_CP044073.1|WP_144949338.1|97252_97567_+|hypothetical-protein
MHRPPEMDHPIIVDAVDLDLWADLYKDSQAPVTLSEFLQQPYLYLKQSGLPVSSEATQEAYPVFLPVRKEVARQIQDEWACQQLAQQSRQQARRHLTLITCTPG
>NZ_CP044073.1|WP_144949335.1|98303_98768_+|hypothetical-protein
MDMLGDEQDSFEQQQSLFRPTELTYCRNLVDLLTEELDQVRQCLGQAQRANRVLIAERDNLVADRDAFKAEVQRHRLRYVQFVQEENQRHVPRGDRLIPDDRDDPLSRAQRHILRLESMNSVLHADLFKVRAQLQILLTERGSTPSAPTGVQHG
>NZ_CP044073.1|WP_144949332.1|98760_99393_+|translesion-DNA-synthesis-associated-protein-ImuA
MDNAATNVVALDSLLDSRRVWRGQSSHVDDASTQPTGHAALDAQLPLGGWPDAALTEILSARTGLGELCLVWPTLARLTAAGERVVLIAPPYLLYPHAWLQAGVDLGRLSVIQVQGKDVLWAAEQCLRSGSCGAVLCWPSRADDRALRRLQVAAETGQTLAFAFRHQREAVNASPAALRLVLEGSPQQLRVLKCRGGNPPATALAHRVWH
>NZ_CP044073.1|WP_144949329.1|99405_100821_+|DNA-polymerase-Y-family-protein
MKWACIFFPQFALDGVLRNCPDPDEALVLLHGPIQRRIIKAANPAALALGLRPEMTYTAAQAICPQFATVEYDEAALRRQHELLAAWAYGFSSQVSLHFADALVLEVQSSLPLFGPWPRFEARLRQELTALGFGHRITLAPNPVAARVLANAGDSLNVRDDAGLASAMRTLPVALLGFEPEIVQALSRMGLRQLSQVLALPRAQLARRFPLSLLNHLDQMLGSKVLPLEFFLPPTTFRLRIELNFEVESTQALLFPLRRLTSDLATYLAGRDMGAQRFTLRLKHREAPTTEIVVGLLAPERDPALLFEFARGRLEPTQVVEPVLAIGLVADELPSFVPQHCGLFDERPQQTVSWEQLRERLRTRLGDDAVYAVAAQGDHRPERAWRRDTPSLALQALGPNRRPGWLLPAPEPLDVDQSRVLSGPERIESGWWDGEDARRDYYVLELSDGRTAWAFQSPAEGPGWWVQGWFA
>NZ_CP044073.1|WP_150338142.1|100817_103892_+|DNA-polymerase-III-subunit-alpha
MTPGYAELHCLSNFSFQRGASSVDQLFERAKAIGYEALAITDECTLAGIVRAWQASEKHDVRLIVGSEFQIAQGPKLVLLVQDLQGYQQLCRLITLARRRADKGSYRLLREDLDQVAGLLALWVPDRGAEAESARWLLDVFPGRLWIATGLHFDQDDQVRLQQLKRLGEALKLPLVAAGDVHMHCRGRRALQDTITAIRHHVPVAEAGQLLFPNGERHLRTREALARCYPSELLEETLRIAERCTFSLAELRYQYPSEVVPEGHTATSWLRVLTEEGCAWRWPEGLSDRLRAQIEKELQLIADKAYESYFLTVHDIVRFARQQGILCQGRGSAANSAVCFALGITELDPTRINLLFERFISHERDEPPDIDVDFEHDCREEVIQYIFRRYGRQRAALTAVVSTYHAAGAVRDVAKALGLPPDQITALADCCGRWTDNLPPPERLRESGFDPDSPLLHRILVLTGELIGFPRHLSQHPGGFVIADQTLDTLVPVENAAMEGRTVIQWDKDDLDAMSLLKVDILALGMLSALRRCFDLVKGYRGEELTLATVPQEDKPTYAMISRADTLGVFQIESRAQMAMLPRLKPQTFYDLVIEVAIVRPGPIQGGMVHPYLRRRTGQEEISYPPELERVFGRTLGVPLFQEQVMELAILAADYTPGEADQLRRSMAAWKRHGGLEPHRERLTTRMLANGYTAEYAADIFRQIEGFGSYGFPESHAASFALLTYASCWLKCHEPAAFAAALINSYPMGFYSPDQILQDARRHRLQTLPVDVTYSDWDCSLEAVAGSSQPAIRMGLRMVRGLAEKAGRAVEQARQQRPFRDVTDLCLRAGLDAKARECLADAGALKGLAGHRFQARWAMAAIEPQLPLFAEGAVVEEEIQELVAPTVGEDLYSDYASLGTTLGPHPLTLLRPELSARRLMSSHELKERRHGQPARVAGLVVGRQRPGTASGVTFVTLEDEFGMVNVVVWRTLAERQRRELVASQLLRVDGTVETRDGVLHIVAGRLEDISDLLQGLDTRSRDFH
>NZ_CP044073.1|WP_144949323.1|103996_104911_-|hypothetical-protein
MNSGPEKYDIKCELLYGLMTYGDGSVENPLRGNWNTWHFGSRGILTWIVMEALDIKRYPWHPDITQCIKPQSEDSLEILRYLTAYLNTEEKVQDLIDEMRRIYDFTQDSLLKSGKNYIHLFRSLNDGNYKADEDNKGGYASNIVKLSKAAIQLKRESFKIAANVLTSWDKNGGYANNPVAISMDHPIRNIVWTSDLIATKSNYPYSPAVESGEWVVVNRSLDGKLSVPAINVTCKKTLKNMERLEAQLSRLKNNDELAVEWLDRGEVRLEPFLGYTEPHLGESIIGLCFKDRLRLALDIIFPRK
>NZ_CP044073.1|WP_144949320.1|104989_106150_-|hypothetical-protein
MAARRPLFKRTALAESLVRELAGETFHDHSSGLFLAAPRRTGKSTFLKNDLIPACEARGWLAVYVDLWADKQTDPADLIAGAIGEALAEYESGLSKVAKKAGIEKLNLLRTLSWDFTRPQLPTGTTLAKALDVLRTVSGRMIVLIVDEAQHALNSEAGVAAMFALKAARDQLNSGVEEDGVRMVFTGSSRDKLANLVLKNGQPFYGARVSEFPRLGRDYVEFVTELWNGSLAAHNQFAIEDVAYAFELVGRRPEMLTALLSDTRVILGEAGNLGELLREGALNHQQGVWSDYESACNDLLPLQRAVLKVIAERAMRKQSFAPFSSETLEAINRMLEQAHEMPNATKPNVQKALEVLRERELIWKANRGEYALEDSAMVGWLVDSAD
>NZ_CP044073.1|WP_150338143.1|106292_106757_-|hypothetical-protein
MQTPNTSSTPALPLQLCVHRYYSRAEDPAFQQLLVVWNQVAPILAAAPAGTVAKVDSESLFVAPLNGALAMFLSADLSPTAVDGNIFRPEDFDGIGADEFAELQSALERWMAAPTYDTPCTPSHLADVLAANYQEPGAPREWQWSGETKNTSGQ
>NZ_CP044073.1|WP_150338144.1|106884_107151_-|hypothetical-protein
MLVIHLESGRVINLERSVSTVNGYGIWEYHRSQSSSMWVPDYTPYRHLAVKPPDPAIGQKVTVAICKLGAPEEEWKPFRSEIAGFDGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044073_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044073_3

96602-96701

Orphan

Consensus_repeat	Method
TGACAATCTAAACGGGTTTGTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044073_3

>merge|NZ_CP044073|3|96602-96701|CRISPRCasFinder
TGACAATCTAAATGGGTTTGTGGTCAGCGGCTGAAAATGGCCTGCTAGTCGTCTTAAAAAGGTGACTGCAGGACTAATTACAATCTCAACGGCATTATTG

>NZ_CP044073|3|3|96602-96701|CRISPRCasFinder
TGACAATCTAAATGGGTTTGTGG	TCAGCGGCTGAAAATGGCCTGCTAGTCGTCTTAAAAAGGTGACTGCAGGACTAA
TTACAATCTCAACGGCATTATTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	unknown	unknown	gnl\|CDD\|380271
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP044073.1\|WP_150338144.1\|106884_107151_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949335.1\|98303_98768_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949323.1\|103996_104911_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_027602314.1\|93147_93429_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	unknown	unknown	gnl\|CDD\|176458
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223704
NZ_CP044073.1\|WP_144949341.1\|96721_97192_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	unknown	unknown	gnl\|CDD\|235553
NZ_CP044073.1\|WP_144949400.1\|87149_87500_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949338.1\|97252_97567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949403.1\|85910_86555_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949406.1\|85206_85914_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949320.1\|104989_106150_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP044073.1\|WP_150338143.1\|106292_106757_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949411.1\|83715_84483_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949569.1\|91506_91740_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044073.1\|WP_144949397.1\|87509_87992_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP044073.1\|WP_144949332.1\|98760_99393_+\|translesion-DNA-synthesis-associated-protein-ImuA	gnl\|CDD\|380271	NF033429, ImuA_translesion, translesion DNA synthesis-associated protein ImuA. A three-gene cassette encoding ImuA, ImuB, and ImuC (""inducible mutagenesis"") is induced by DNA damage, is capable of DNA synthesis across DNA damage lesions, and consequently is associated with mutagenesis. This family, ImuA (previously misnamed SulA in Pseudomonas putida) shows some homology to SulA itself and to RecA. ImuB resembles Y-family polymerases but may be catalytically inactive. ImuC is a C-family polymerase, and catalytically active.	1.44677e-81
NZ_CP044073.1\|WP_144949394.1\|87988_89086_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	8.56597e-11
NZ_CP044073.1\|WP_150338142.1\|100817_103892_+\|DNA-polymerase-III-subunit-alpha	gnl\|CDD\|235553	PRK05672, dnaE2, error-prone DNA polymerase; Validated.	0
NZ_CP044073.1\|WP_144949391.1\|89361_90588_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	6.01156e-48
NZ_CP044073.1\|WP_144949408.1\|84517_85207_-\|hypothetical-protein	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	6.23318e-06
NZ_CP044073.1\|WP_144949329.1\|99405_100821_+\|DNA-polymerase-Y-family-protein	gnl\|CDD\|176458	cd03468, PolY_like, DNA Polymerase Y-family. Y-family DNA polymerases are a specialized subset of polymerases that facilitate translesion synthesis (TLS), a process that allows the bypass of a variety of DNA lesions. Unlike replicative polymerases, TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. The active sites of TLS polymerases are large and flexible to allow the accomodation of distorted bases. Expression of Y-family polymerases is often induced by DNA damage and is believed to be highly regulated. TLS is likely induced by the monoubiquitination of the replication clamp PCNA, which provides a scaffold for TLS polymerases to bind in order to access the lesion. Because of their high error rates, TLS polymerases are potential targets for cancer treatment and prevention.	3.25036e-70

>NZ_CP044073.1|WP_027602314.1|93147_93429_+|hypothetical-protein
MSHQVNKFSLTSYVEAFFPSNFEVMLERSETNPDDRILTVCDVITDRTTSYEGPLLAILDICSMGAIAADLCNELCGHAATRRVEISKLRKWS
>NZ_CP044073.1|WP_144949569.1|91506_91740_+|hypothetical-protein
MKELDRKHGIELLERYSAEQDAINQLLRQIYECHGTADTEALRNMLGLCIVEIQERQETVLKAFRFLLESDARPQET
>NZ_CP044073.1|WP_144949391.1|89361_90588_+|tyrosine-type-recombinase/integrase
MWRVIVGQLLPRQVKELCEPGVYQDGRGLILRVAKTGAKRWIFRFSFQGQRYDVGLGGYPAVSLKQARLEADRRRLKIAKGVPELPGRRSPAAPSPAAGQDLFATLARQYIATHGASWSHDHHRQWASSMERYVFPVLGRRPVAKIDTDLVLQVLSPIWDKINVSAARIRNRIESVLDAAQALGYREGANPARWHGHLDKLLPRHDRNVVHHPAAAAESCPSVLHRLDSLEGSAARAAELLILTSLRNAEVREARWCEFDFPAMRWTIPAERMKCEREHIVPLTERMLEVLDQQKGQHDTWVFPNARGKKPLPGNAIGRALRKIKLEGAVPHGFRSTFRTWAAETTSHPREICEKVLAHRIGSKTEAAYNRGQLLEKRRKLMSDWETFLAMPDLPTSQAVTPGRLQDA
>NZ_CP044073.1|WP_144949394.1|87988_89086_-|hypothetical-protein
MTLATNQPNKQTKQTPLFVWYGWGYDAVFFDPEAAMAERKFTDAEVIAAGEQLLAGGRKVNGWALRTTLGGGRPETLLSVWQRHHTGVPGGAIPTRPLPEEATAIIETAVAKQTKAMQEALAGALDLVAAAARKEVVLELEQARQEIARLEAEQDDASGVLEGLEADQERSQQQMDGLANELQLKDSQLSAMAEENASLAERLAEAEGQAQLARDQLAESQAELSLALAQKASAEAASVECQRSASAAEERLADTQVELREMRNRLAIARSEADSAAGQIQEMERTRAQDLEILTELRVENRALGDKLARADAGREAAERYLERVQKDSSGRIAALERQFAKAASKPAPRGTGKAPRAASPAAGE
>NZ_CP044073.1|WP_144949397.1|87509_87992_-|hypothetical-protein
MTVAKQFEGFHVYGGSAALKFEVVLNQAQESVLSVDGAGRKGSSENFDWSEKLTLQITPREMPAFMCCVLGITPAFEARNHGAAGDKGLTLVNQPERGVLYLRLLQQRLSINVPITADKVFHLGALGIRVLAEQVHLDVPTCLAMLRGTAGRLLIAAAGD
>NZ_CP044073.1|WP_144949400.1|87149_87500_+|hypothetical-protein
MSAKPFQVLFSTTARTGALDQVHHLAKSISHPGGLAKMSCVVDEVAVELRKSALPYLIAGAGAGAEFGITRYREIAKSGYRAGYLVDEPRREAVVLAIFRGGQDIRELLYRHLLTG
>NZ_CP044073.1|WP_144949403.1|85910_86555_-|hypothetical-protein
MKGQDVGLLLRLVCLERHESSRNALTAWPHDWQDWELAAADVQHVPQPGIDLVGDLASAPSYTARALEEQTGISKSQIALSLNHCIEIGLVKMDRQHGVPRANKRALFEFIVYGLRYVFPARYGELTRGIATSFAAPVLSKTLISGGDHVPVWPNARGRTMGMKVEPLFKTAVEAARKDPEMYALLALVDAIRLGQPRERNVAIDVLQERLGLQ
>NZ_CP044073.1|WP_144949406.1|85206_85914_-|hypothetical-protein
MSVFSTLTEMLRRVAHALGPHLCQQMTFVGGCTTGLLLTDDYTREQVRSTDDVDLIVHVMGVIGFTKLREQLREQGFSEYPPSGDEDVPICSMRLGELRVDFMPDDESLGFSNRWYKAAMATSTQYQLDESTAIMLVSPVYFIATKLEAWKGRGNGDALASRDIEDVLNLVDGREELMGEVQAADEAVQDYIAMEIATLFADRNFQDAVSSQSRGDTDREGLIWERLETLAQGRR
>NZ_CP044073.1|WP_144949408.1|84517_85207_-|hypothetical-protein
MRIEWLSRQGKERSSNNDAAAIGYKGNHVLALVVDASDKANGQAFSRHWATTIVKTAMEHSRPLDIGLLEQVMWAEQRQLRSTYLHTSASYCCALIDLGTRTIDVRYVGDCMFGTQAAQTPIQWVLTPHTLYHQAAQMGVQDVSAESRHILTRSLNARRYCEPGRTSMGLPDARLIICSDGYWNEHLTFGIDLDQLSDDASVLSLDPGAPALIDNSDCQNIRVFDMRIP
>NZ_CP044073.1|WP_144949411.1|83715_84483_+|hypothetical-protein
MAKSNDSETLTLVSERLEHVALIFDLRHHYYDLSLIRDVGENGWTHPWRYFDALMYYLLLTCFDLLGQPGDWVPFSTWLESKKKNNERQHALESIPKNADPIAIAKHLSASYQAIYGVKNSFYNFILNVLTQEERDELFSNIDITRAVLGGDPCTSYPALGKITDERKKLDFLFSLRNKFTHSAVTMGSPTAGVFSGAYEPIVIEGKAYKGYVDIHREVKNGERIIYSVQDWPYCLQRIINNVVSRKSLSIDNRL
>NZ_CP044073.1|WP_144949341.1|96721_97192_+|hypothetical-protein
MYDPTNPQPDRQRIHDNFQQAIGAMEGIRQTIKAEALRLRDEYFAAAKQRSGGKIIYRLIDVRDNGKGAISIAWCKVFFYDGAGDKKQQGRLPIAKGQGVTYAPGLVTRGMDHWFIELFQLYEPQLAVLRDQMLYASKIRKLLVQQQRKAQSSMLG
>NZ_CP044073.1|WP_144949338.1|97252_97567_+|hypothetical-protein
MHRPPEMDHPIIVDAVDLDLWADLYKDSQAPVTLSEFLQQPYLYLKQSGLPVSSEATQEAYPVFLPVRKEVARQIQDEWACQQLAQQSRQQARRHLTLITCTPG
>NZ_CP044073.1|WP_144949335.1|98303_98768_+|hypothetical-protein
MDMLGDEQDSFEQQQSLFRPTELTYCRNLVDLLTEELDQVRQCLGQAQRANRVLIAERDNLVADRDAFKAEVQRHRLRYVQFVQEENQRHVPRGDRLIPDDRDDPLSRAQRHILRLESMNSVLHADLFKVRAQLQILLTERGSTPSAPTGVQHG
>NZ_CP044073.1|WP_144949332.1|98760_99393_+|translesion-DNA-synthesis-associated-protein-ImuA
MDNAATNVVALDSLLDSRRVWRGQSSHVDDASTQPTGHAALDAQLPLGGWPDAALTEILSARTGLGELCLVWPTLARLTAAGERVVLIAPPYLLYPHAWLQAGVDLGRLSVIQVQGKDVLWAAEQCLRSGSCGAVLCWPSRADDRALRRLQVAAETGQTLAFAFRHQREAVNASPAALRLVLEGSPQQLRVLKCRGGNPPATALAHRVWH
>NZ_CP044073.1|WP_144949329.1|99405_100821_+|DNA-polymerase-Y-family-protein
MKWACIFFPQFALDGVLRNCPDPDEALVLLHGPIQRRIIKAANPAALALGLRPEMTYTAAQAICPQFATVEYDEAALRRQHELLAAWAYGFSSQVSLHFADALVLEVQSSLPLFGPWPRFEARLRQELTALGFGHRITLAPNPVAARVLANAGDSLNVRDDAGLASAMRTLPVALLGFEPEIVQALSRMGLRQLSQVLALPRAQLARRFPLSLLNHLDQMLGSKVLPLEFFLPPTTFRLRIELNFEVESTQALLFPLRRLTSDLATYLAGRDMGAQRFTLRLKHREAPTTEIVVGLLAPERDPALLFEFARGRLEPTQVVEPVLAIGLVADELPSFVPQHCGLFDERPQQTVSWEQLRERLRTRLGDDAVYAVAAQGDHRPERAWRRDTPSLALQALGPNRRPGWLLPAPEPLDVDQSRVLSGPERIESGWWDGEDARRDYYVLELSDGRTAWAFQSPAEGPGWWVQGWFA
>NZ_CP044073.1|WP_150338142.1|100817_103892_+|DNA-polymerase-III-subunit-alpha
MTPGYAELHCLSNFSFQRGASSVDQLFERAKAIGYEALAITDECTLAGIVRAWQASEKHDVRLIVGSEFQIAQGPKLVLLVQDLQGYQQLCRLITLARRRADKGSYRLLREDLDQVAGLLALWVPDRGAEAESARWLLDVFPGRLWIATGLHFDQDDQVRLQQLKRLGEALKLPLVAAGDVHMHCRGRRALQDTITAIRHHVPVAEAGQLLFPNGERHLRTREALARCYPSELLEETLRIAERCTFSLAELRYQYPSEVVPEGHTATSWLRVLTEEGCAWRWPEGLSDRLRAQIEKELQLIADKAYESYFLTVHDIVRFARQQGILCQGRGSAANSAVCFALGITELDPTRINLLFERFISHERDEPPDIDVDFEHDCREEVIQYIFRRYGRQRAALTAVVSTYHAAGAVRDVAKALGLPPDQITALADCCGRWTDNLPPPERLRESGFDPDSPLLHRILVLTGELIGFPRHLSQHPGGFVIADQTLDTLVPVENAAMEGRTVIQWDKDDLDAMSLLKVDILALGMLSALRRCFDLVKGYRGEELTLATVPQEDKPTYAMISRADTLGVFQIESRAQMAMLPRLKPQTFYDLVIEVAIVRPGPIQGGMVHPYLRRRTGQEEISYPPELERVFGRTLGVPLFQEQVMELAILAADYTPGEADQLRRSMAAWKRHGGLEPHRERLTTRMLANGYTAEYAADIFRQIEGFGSYGFPESHAASFALLTYASCWLKCHEPAAFAAALINSYPMGFYSPDQILQDARRHRLQTLPVDVTYSDWDCSLEAVAGSSQPAIRMGLRMVRGLAEKAGRAVEQARQQRPFRDVTDLCLRAGLDAKARECLADAGALKGLAGHRFQARWAMAAIEPQLPLFAEGAVVEEEIQELVAPTVGEDLYSDYASLGTTLGPHPLTLLRPELSARRLMSSHELKERRHGQPARVAGLVVGRQRPGTASGVTFVTLEDEFGMVNVVVWRTLAERQRRELVASQLLRVDGTVETRDGVLHIVAGRLEDISDLLQGLDTRSRDFH
>NZ_CP044073.1|WP_144949323.1|103996_104911_-|hypothetical-protein
MNSGPEKYDIKCELLYGLMTYGDGSVENPLRGNWNTWHFGSRGILTWIVMEALDIKRYPWHPDITQCIKPQSEDSLEILRYLTAYLNTEEKVQDLIDEMRRIYDFTQDSLLKSGKNYIHLFRSLNDGNYKADEDNKGGYASNIVKLSKAAIQLKRESFKIAANVLTSWDKNGGYANNPVAISMDHPIRNIVWTSDLIATKSNYPYSPAVESGEWVVVNRSLDGKLSVPAINVTCKKTLKNMERLEAQLSRLKNNDELAVEWLDRGEVRLEPFLGYTEPHLGESIIGLCFKDRLRLALDIIFPRK
>NZ_CP044073.1|WP_144949320.1|104989_106150_-|hypothetical-protein
MAARRPLFKRTALAESLVRELAGETFHDHSSGLFLAAPRRTGKSTFLKNDLIPACEARGWLAVYVDLWADKQTDPADLIAGAIGEALAEYESGLSKVAKKAGIEKLNLLRTLSWDFTRPQLPTGTTLAKALDVLRTVSGRMIVLIVDEAQHALNSEAGVAAMFALKAARDQLNSGVEEDGVRMVFTGSSRDKLANLVLKNGQPFYGARVSEFPRLGRDYVEFVTELWNGSLAAHNQFAIEDVAYAFELVGRRPEMLTALLSDTRVILGEAGNLGELLREGALNHQQGVWSDYESACNDLLPLQRAVLKVIAERAMRKQSFAPFSSETLEAINRMLEQAHEMPNATKPNVQKALEVLRERELIWKANRGEYALEDSAMVGWLVDSAD
>NZ_CP044073.1|WP_150338143.1|106292_106757_-|hypothetical-protein
MQTPNTSSTPALPLQLCVHRYYSRAEDPAFQQLLVVWNQVAPILAAAPAGTVAKVDSESLFVAPLNGALAMFLSADLSPTAVDGNIFRPEDFDGIGADEFAELQSALERWMAAPTYDTPCTPSHLADVLAANYQEPGAPREWQWSGETKNTSGQ
>NZ_CP044073.1|WP_150338144.1|106884_107151_-|hypothetical-protein
MLVIHLESGRVINLERSVSTVNGYGIWEYHRSQSSSMWVPDYTPYRHLAVKPPDPAIGQKVTVAICKLGAPEEEWKPFRSEIAGFDGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP044073_1	1.1\|96029\|46\|NZ_CP044073\|CRISPRCasFinder	96029-96074	46	NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	96029-96074	1.0
NZ_CP044073_2	2.1\|96352\|45\|NZ_CP044073\|CRISPRCasFinder	96352-96396	45	NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	96352-96396	1.0
NZ_CP044073_3	3.1\|96625\|54\|NZ_CP044073\|CRISPRCasFinder	96625-96678	54	NZ_CP044073	Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence	96625-96678	1.0

1. spacer 1.1|96029|46|NZ_CP044073|CRISPRCasFinder matches to NZ_CP044073 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gtgaggaaaaaagcaggcatggcaatggtccatttcttagtactac	CRISPR spacer
gtgaggaaaaaagcaggcatggcaatggtccatttcttagtactac	Protospacer
**********************************************

2. spacer 2.1|96352|45|NZ_CP044073|CRISPRCasFinder matches to NZ_CP044073 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

gagagaaaaaagcaaacatggaaatgatccatttcttagtactac	CRISPR spacer
gagagaaaaaagcaaacatggaaatgatccatttcttagtactac	Protospacer
*********************************************

3. spacer 3.1|96625|54|NZ_CP044073|CRISPRCasFinder matches to NZ_CP044073 (Pseudomonas oryzihabitans strain FDAARGOS_657 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

tcagcggctgaaaatggcctgctagtcgtcttaaaaaggtgactgcaggactaa	CRISPR spacer
tcagcggctgaaaatggcctgctagtcgtcttaaaaaggtgactgcaggactaa	Protospacer
******************************************************

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044072

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044074

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP044073

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection