CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP044087	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed2	0 crisprs	RT	2
NZ_CP044086	Pseudomonas luteola strain FDAARGOS_637 chromosome 1, complete sequence	0 crisprs	DEDDh,DinG,csa3,cas3	5
NZ_CP044084	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed1, complete sequence	0 crisprs	cas3,WYL,PD-DExK,csa3,cas14j	41
NZ_CP044088	Pseudomonas luteola strain FDAARGOS_637 plasmid unnamed3	0 crisprs	NA	0
NZ_CP044085	Pseudomonas luteola strain FDAARGOS_637 chromosome 2, complete sequence	1 crisprs	csa3,PD-DExK	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2824 : 92331

113

uncultured_Caudovirales_phage(45.07%)

plate,holin,terminase,protease,portal,transposase,tail,lysis,head,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150348712.1\|2824_4108_-\|tail	phage tail protein	A0A077K818	Ralstonia_phage	2.8e-82	59.2
WP_150348713.1\|4104_4713_-\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	3.3e-73	65.8
WP_150348714.1\|5625_5967_-\|plate	baseplate assembly protein	A0A2H4JE52	uncultured_Caudovirales_phage	1.3e-29	57.7
WP_150348715.1\|5963_6521_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	6.6e-52	58.8
WP_167517301.1\|6624_7008_+	hypothetical protein	NA	NA	NA	NA
WP_150348717.1\|7783_8311_-\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	2.1e-55	61.5
WP_150348718.1\|8843_9053_-	hypothetical protein	NA	NA	NA	NA
WP_150348798.1\|9857_10178_-\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	1.8e-17	50.0
WP_150348719.1\|10204_10426_-\|tail	phage tail protein	A0A2H4J946	uncultured_Caudovirales_phage	7.2e-18	61.4
WP_150348720.1\|10425_10887_-\|head	head completion/stabilization protein	A0A2H4JCS4	uncultured_Caudovirales_phage	4.2e-36	50.0
WP_004574517.1\|12967_13207_+	hypothetical protein	NA	NA	NA	NA
WP_004574518.1\|13206_13617_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_004574519.1\|13620_16617_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	9.1e-265	48.3
WP_004574520.1\|16754_16967_-	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_004574521.1\|17090_17327_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_004574522.1\|17319_17682_-	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
WP_004574523.1\|17681_18098_-	hypothetical protein	NA	NA	NA	NA
WP_004574524.1\|18118_19801_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-38	28.0
WP_004574525.1\|19813_20245_-	organomercurial transporter MerC	NA	NA	NA	NA
WP_004574526.1\|20257_20536_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_004574527.1\|20549_20900_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_004574528.1\|20971_21391_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_004574529.1\|21543_21762_-	hypothetical protein	NA	NA	NA	NA
WP_150348721.1\|21840_22038_+	hypothetical protein	NA	NA	NA	NA
WP_150348722.1\|22046_22835_-	hypothetical protein	A0A219YA47	Aeromonas_phage	1.2e-09	31.4
WP_150348723.1\|24106_24982_-	hypothetical protein	NA	NA	NA	NA
WP_150348724.1\|25043_25406_-	hypothetical protein	NA	NA	NA	NA
WP_167517302.1\|25402_25684_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_150348799.1\|25813_26260_-	hypothetical protein	A0A2H4JG61	uncultured_Caudovirales_phage	6.7e-47	63.2
WP_010799797.1\|26322_26538_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	7.2e-15	66.1
WP_150348726.1\|26629_26974_+	helix-turn-helix transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	7.2e-25	55.8
WP_010799795.1\|27040_27499_+	DUF2511 domain-containing protein	NA	NA	NA	NA
WP_150348727.1\|27696_28971_-	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	1.6e-165	70.3
WP_150348728.1\|28967_29408_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	6.2e-53	68.5
WP_150348729.1\|29414_32015_-\|tail	phage tail tape measure protein	A0A2H4JE61	uncultured_Caudovirales_phage	1.1e-104	33.7
WP_010799791.1\|32001_32124_-\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	2.2e-08	71.1
WP_150348730.1\|32132_32465_-\|tail	phage tail assembly protein	E5FFG7	Burkholderia_phage	5.2e-20	59.1
WP_150348731.1\|32544_33060_-\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	6.5e-70	73.7
WP_150348732.1\|33109_34276_-\|tail	phage tail sheath protein	F1BUU3	Erwinia_phage	5.6e-154	71.0
WP_010799787.1\|34373_34901_-	hypothetical protein	NA	NA	NA	NA
WP_150348800.1\|35216_35654_-	hypothetical protein	A0A2H4J973	uncultured_Caudovirales_phage	1.6e-40	54.7
WP_150348733.1\|35653_36235_-	hypothetical protein	NA	NA	NA	NA
WP_167517303.1\|36246_37566_-\|tail	phage tail protein	A0A077K818	Ralstonia_phage	3.8e-82	59.2
WP_150348734.1\|37562_38171_-\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	5.7e-73	65.8
WP_150348735.1\|38167_39085_-\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	9.4e-96	61.8
WP_150348736.1\|39086_39428_-\|plate	baseplate assembly protein	A0A2H4JE52	uncultured_Caudovirales_phage	9.7e-30	58.6
WP_150348737.1\|39424_39976_-\|plate	phage baseplate assembly protein V	Q9ZXL0	Pseudomonas_virus	3.6e-50	55.4
WP_150348738.1\|40110_41106_+	hypothetical protein	NA	NA	NA	NA
WP_150348739.1\|41090_41543_-	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	6.1e-40	58.5
WP_150348740.1\|41539_42076_-\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	2.1e-55	62.9
WP_167517304.1\|42068_42212_-	hypothetical protein	A0A2H4JCP0	uncultured_Caudovirales_phage	9.0e-06	51.2
WP_150348741.1\|42171_42615_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	1.7e-05	33.3
WP_150348742.1\|42611_42821_-	hypothetical protein	NA	NA	NA	NA
WP_150348743.1\|42820_43630_-	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	1.2e-83	63.2
WP_150348801.1\|43626_43947_-\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	1.8e-17	50.0
WP_010799811.1\|43973_44195_-\|tail	tail protein X	A0A2H4J946	uncultured_Caudovirales_phage	2.5e-18	62.9
WP_150348744.1\|44194_44656_-\|head	head completion/stabilization protein	A0A2H4JCS4	uncultured_Caudovirales_phage	3.1e-39	53.8
WP_150348745.1\|44756_45455_-\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	1.2e-74	67.3
WP_150348746.1\|45458_46490_-\|capsid	phage major capsid protein, P2 family	A0A2H4JCR7	uncultured_Caudovirales_phage	1.4e-143	75.9
WP_150348747.1\|46518_47361_-\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	2.7e-73	55.6
WP_150348748.1\|47540_49301_+\|terminase	terminase ATPase subunit family protein	A0A2H4JGK4	uncultured_Caudovirales_phage	1.9e-286	83.6
WP_150348749.1\|49300_50329_+\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	1.5e-150	78.0
WP_150348750.1\|50592_50922_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_150348751.1\|51040_51325_+	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	9.5e-31	71.0
WP_150348752.1\|51482_52220_+	HNH endonuclease	NA	NA	NA	NA
WP_150348753.1\|52458_53886_-	hypothetical protein	NA	NA	NA	NA
WP_150348754.1\|54086_54479_-	GFA family protein	NA	NA	NA	NA
WP_150348755.1\|54746_55022_-	hypothetical protein	NA	NA	NA	NA
WP_010799301.1\|55985_56222_-	hypothetical protein	NA	NA	NA	NA
WP_150348756.1\|56562_57411_+	hypothetical protein	NA	NA	NA	NA
WP_150348757.1\|58240_58891_+	recombinase family protein	NA	NA	NA	NA
WP_150348758.1\|59267_61064_-\|protease	trypsin-like serine protease	Q7M2A9	Enterobacteria_phage	7.4e-12	37.0
WP_150348760.1\|61760_62492_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
WP_150348761.1\|63106_63397_-	hypothetical protein	NA	NA	NA	NA
WP_150348762.1\|63393_64062_-	AAA family ATPase	E5FFJ3	Burkholderia_phage	7.2e-45	47.4
WP_150348763.1\|65041_65920_-	hypothetical protein	NA	NA	NA	NA
WP_150348764.1\|65980_66343_-	hypothetical protein	NA	NA	NA	NA
WP_167517305.1\|66339_66621_-	ogr/Delta-like zinc finger family protein	NA	NA	NA	NA
WP_150348802.1\|66754_67201_-	PTS sugar transporter subunit IIA	A0A2H4JG61	uncultured_Caudovirales_phage	5.7e-46	63.4
WP_150348766.1\|67263_67476_-	DNA-binding protein	A0A2H4JE67	uncultured_Caudovirales_phage	1.3e-08	58.2
WP_150348767.1\|67529_67889_+	transcriptional regulator	A0A2H4JFL3	uncultured_Caudovirales_phage	2.9e-16	42.7
WP_150348803.1\|68361_68685_-	hypothetical protein	NA	NA	NA	NA
WP_150348768.1\|68725_69997_-	phage late control D family protein	Q9ZXJ8	Pseudomonas_virus	3.6e-162	69.6
WP_150348769.1\|69993_70434_-\|tail	phage tail protein	Q9ZXJ9	Pseudomonas_virus	7.3e-54	69.9
WP_150348770.1\|70440_73167_-\|tail	phage tail tape measure protein	E5G6Q1	Salmonella_phage	3.1e-110	33.6
WP_010799791.1\|73153_73276_-\|tail	GpE family phage tail protein	Q9ZXK1	Pseudomonas_virus	2.2e-08	71.1
WP_150348771.1\|73284_73623_-\|tail	phage tail assembly protein	E5FFG7	Burkholderia_phage	9.0e-20	61.2
WP_150348772.1\|73701_74217_-\|tail	phage major tail tube protein	Q9ZXK3	Pseudomonas_virus	2.0e-71	76.6
WP_150348773.1\|74265_75432_-\|tail	phage tail sheath protein	F1BUU3	Erwinia_phage	1.2e-151	69.9
WP_150348774.1\|75569_76097_-	hypothetical protein	NA	NA	NA	NA
WP_150348796.1\|76100_76433_-	hypothetical protein	NA	NA	NA	NA
WP_150348797.1\|77458_77896_-	hypothetical protein	A0A2H4J973	uncultured_Caudovirales_phage	2.4e-41	55.4
WP_150348775.1\|77895_78477_-	hypothetical protein	R9U4D4	Rhizobium_phage	1.5e-19	42.3
WP_150348776.1\|78488_79808_-\|tail	phage tail protein	A0A077K818	Ralstonia_phage	2.9e-82	59.2
WP_150348713.1\|79804_80413_-\|tail	phage tail protein I	A0A2H4JAU2	uncultured_Caudovirales_phage	3.3e-73	65.8
WP_150348804.1\|80409_81327_-\|plate	baseplate assembly protein	Q9ZXK8	Pseudomonas_virus	2.5e-96	62.8
WP_150348714.1\|81328_81670_-\|plate	baseplate assembly protein	A0A2H4JE52	uncultured_Caudovirales_phage	1.3e-29	57.7
WP_150348715.1\|81666_82224_-\|plate	phage baseplate assembly protein V	A0A2H4JFJ8	uncultured_Caudovirales_phage	6.6e-52	58.8
WP_150348777.1\|82334_82877_+	hypothetical protein	NA	NA	NA	NA
WP_150348778.1\|83036_83489_-	phage virion morphogenesis protein	Q9ZXL2	Pseudomonas_virus	1.0e-39	58.0
WP_150348717.1\|83491_84019_-\|tail	phage tail protein	Q9ZXL3	Pseudomonas_virus	2.1e-55	61.5
WP_167517306.1\|84011_84155_-	hypothetical protein	A0A2H4JCP0	uncultured_Caudovirales_phage	2.4e-06	53.7
WP_167517307.1\|84114_84558_-\|lysis	LysB family phage lysis regulatory protein	Q9ZXL5	Pseudomonas_virus	2.9e-18	43.3
WP_150348718.1\|84554_84764_-	hypothetical protein	NA	NA	NA	NA
WP_150348780.1\|84763_85573_-	DUF3380 domain-containing protein	Q9ZXL6	Pseudomonas_virus	1.1e-82	63.0
WP_150348798.1\|85569_85890_-\|holin	phage holin, lambda family	A0A2H4JFM8	uncultured_Caudovirales_phage	1.8e-17	50.0
WP_150348719.1\|85916_86138_-\|tail	phage tail protein	A0A2H4J946	uncultured_Caudovirales_phage	7.2e-18	61.4
WP_150348720.1\|86137_86599_-\|head	head completion/stabilization protein	A0A2H4JCS4	uncultured_Caudovirales_phage	4.2e-36	50.0
WP_150348781.1\|86700_87399_-\|terminase	terminase endonuclease subunit	Q9ZXM2	Pseudomonas_virus	9.1e-75	67.7
WP_004574516.1\|87553_88480_-	recombinase family protein	E5FFF9	Burkholderia_phage	1.8e-41	46.4
WP_004574517.1\|88681_88921_+	hypothetical protein	NA	NA	NA	NA
WP_004574518.1\|88920_89331_+	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_004574519.1\|89334_92331_+\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	9.1e-265	48.3

DBSCAN-SWA_2

97595 : 106244

uncultured_Caudovirales_phage(62.5%)

terminase,portal,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150348782.1\|97595_98537_-\|capsid	phage major capsid protein, P2 family	A0A2H4JCR7	uncultured_Caudovirales_phage	3.1e-134	79.5
WP_150348783.1\|98564_99407_-\|capsid	GPO family capsid scaffolding protein	A0A2H4J928	uncultured_Caudovirales_phage	1.0e-72	55.2
WP_150348784.1\|99586_101347_+\|terminase	terminase ATPase subunit family protein	A0A2H4JGK4	uncultured_Caudovirales_phage	5.0e-287	84.0
WP_150348785.1\|101346_102375_+\|portal	phage portal protein	A0A2H4J922	uncultured_Caudovirales_phage	3.3e-150	77.5
WP_150348786.1\|102405_103200_+	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	5.6e-129	83.5
WP_150348787.1\|103307_103490_+	addiction module toxin, HicA family	A0A2H4JDU5	uncultured_Caudovirales_phage	3.8e-09	55.9
WP_150348788.1\|103605_104028_+	type II toxin-antitoxin system HicB family antitoxin	Q7Y3V7	Yersinia_phage	5.4e-30	51.8
WP_150348789.1\|104105_105545_+	TIR domain-containing protein	NA	NA	NA	NA
WP_150348805.1\|105920_106244_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.9e-06	36.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1408968 : 1415716

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010794652.1\|1408968_1410249_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.2e-98	45.2
WP_150347193.1\|1410248_1411640_+	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_150347194.1\|1411636_1412644_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_010794649.1\|1412674_1413646_-	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	4.0e-129	67.9
WP_010794648.1\|1413642_1413957_-	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	2.6e-37	74.7
WP_037029547.1\|1413953_1414253_-	sulfurtransferase complex subunit TusB	NA	NA	NA	NA
WP_010794646.1\|1414249_1414609_-	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	1.9e-31	62.5
WP_037029544.1\|1414608_1415001_-	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	3.4e-47	70.3
WP_010794644.1\|1415047_1415716_-	Bax inhibitor-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	3.0e-83	74.4

DBSCAN-SWA_2

1419661 : 1458879

uncultured_Caudovirales_phage(41.3%)

tail,portal,capsid,terminase,integrase,head

attL 1419534:1419592|attR 1465025:1465083

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1419534:1419592	attL	NA	NA	NA	NA
WP_150347196.1\|1419661_1420693_-\|integrase	tyrosine-type recombinase/integrase	C8CLF4	Xylella_phage	9.9e-102	56.9
WP_150347197.1\|1420695_1420902_-	DUF4224 domain-containing protein	NA	NA	NA	NA
WP_167517219.1\|1420949_1421120_-	hypothetical protein	NA	NA	NA	NA
WP_150347198.1\|1421219_1421564_+	hypothetical protein	NA	NA	NA	NA
WP_150347199.1\|1421678_1421951_-	hypothetical protein	A0A2H4J5S5	uncultured_Caudovirales_phage	3.6e-19	59.6
WP_150347200.1\|1422060_1422288_-	hypothetical protein	NA	NA	NA	NA
WP_150347201.1\|1422280_1422835_-	DUF629 domain-containing protein	NA	NA	NA	NA
WP_167517220.1\|1422827_1422998_-	hypothetical protein	NA	NA	NA	NA
WP_150347202.1\|1423187_1424054_-	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	1.7e-176	100.0
WP_167517221.1\|1424087_1424249_-	hypothetical protein	A0A2H4J135	uncultured_Caudovirales_phage	2.6e-17	100.0
WP_150347203.1\|1424261_1424450_-	hypothetical protein	A0A2H4J9E3	uncultured_Caudovirales_phage	3.2e-27	96.8
WP_150347204.1\|1424465_1424672_-	hypothetical protein	A0A2H4J113	uncultured_Caudovirales_phage	9.9e-30	95.6
WP_150347205.1\|1424679_1425291_-	ERF family protein	A0A2H4J2M9	uncultured_Caudovirales_phage	3.6e-43	52.4
WP_150347206.1\|1425321_1426068_-	hypothetical protein	M4MB35	Vibrio_phage	4.1e-41	38.1
WP_150347207.1\|1426525_1426786_-	hypothetical protein	A0A2H4J123	uncultured_Caudovirales_phage	3.9e-39	95.3
WP_167517222.1\|1426785_1427208_-	hypothetical protein	NA	NA	NA	NA
WP_167517223.1\|1427188_1427404_-	hypothetical protein	A0A2H4J127	uncultured_Caudovirales_phage	1.0e-13	87.0
WP_150347209.1\|1427567_1427765_-	hypothetical protein	A0A0S2SYA6	Pseudomonas_phage	1.1e-22	73.8
WP_150347210.1\|1427769_1428015_-	hypothetical protein	NA	NA	NA	NA
WP_150347211.1\|1428325_1428580_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_150347212.1\|1428700_1429609_-	hypothetical protein	NA	NA	NA	NA
WP_150347213.1\|1429595_1430180_-	hypothetical protein	NA	NA	NA	NA
WP_150347214.1\|1430220_1430907_-	helix-turn-helix domain-containing protein	H2BDH4	Pseudomonas_virus	6.7e-54	48.0
WP_150347215.1\|1431008_1431251_+	helix-turn-helix domain-containing protein	D0UIL8	Aggregatibacter_phage	7.6e-05	44.6
WP_010794618.1\|1431275_1431491_+	hypothetical protein	A0A2H4J528	uncultured_Caudovirales_phage	4.0e-05	41.1
WP_167517224.1\|1431806_1432628_+	hypothetical protein	W6MYB0	Pseudomonas_phage	1.0e-56	50.6
WP_150347218.1\|1432617_1433400_+	ATP-binding protein	A0A059VK34	Pseudomonas_phage	1.3e-61	45.7
WP_150347219.1\|1433396_1433792_+	hypothetical protein	NA	NA	NA	NA
WP_150347220.1\|1433788_1433986_+	hypothetical protein	NA	NA	NA	NA
WP_167517225.1\|1434093_1434249_+	hypothetical protein	NA	NA	NA	NA
WP_150347221.1\|1434245_1434530_+	hypothetical protein	NA	NA	NA	NA
WP_150347222.1\|1434529_1434964_+	hypothetical protein	A0A1B1ITH8	uncultured_Mediterranean_phage	2.8e-18	45.1
WP_150347223.1\|1434960_1435248_+	hypothetical protein	A0A2H4J993	uncultured_Caudovirales_phage	1.4e-21	57.0
WP_150347224.1\|1435244_1435889_+	recombination protein NinG	A0A2H4JA27	uncultured_Caudovirales_phage	6.2e-62	63.2
WP_150347225.1\|1435873_1436506_+	hypothetical protein	A0A2I7RQG7	Vibrio_phage	1.8e-50	46.7
WP_150347226.1\|1436569_1437259_+	hypothetical protein	A0A2H4J2J2	uncultured_Caudovirales_phage	5.5e-125	97.8
WP_150347227.1\|1437483_1437819_+	hypothetical protein	A0A2H4J8L0	uncultured_Caudovirales_phage	2.0e-40	100.0
WP_150347228.1\|1437811_1438165_+	hypothetical protein	A0A2H4J840	uncultured_Caudovirales_phage	3.9e-26	100.0
WP_150347229.1\|1438172_1438664_+	glycoside hydrolase family 108 protein	A0A2H4J0Z0	uncultured_Caudovirales_phage	2.0e-89	96.9
WP_150347230.1\|1438660_1439164_+	hypothetical protein	NA	NA	NA	NA
WP_150347231.1\|1439210_1440740_+	cellulase family glycosylhydrolase	A0A2H4J3X4	uncultured_Caudovirales_phage	4.9e-73	42.1
WP_167517226.1\|1440749_1440905_+	hypothetical protein	A0A2H4J0W9	uncultured_Caudovirales_phage	2.6e-22	98.0
WP_150347232.1\|1440901_1441114_+	hypothetical protein	NA	NA	NA	NA
WP_167517227.1\|1441174_1441327_+	hypothetical protein	H2BDJ7	Pseudomonas_virus	1.9e-06	63.6
WP_073450260.1\|1441331_1441631_+	HNH endonuclease	A0A0R6PHK1	Moraxella_phage	5.1e-27	61.5
WP_150347233.1\|1441806_1442250_+	hypothetical protein	Q3HQS6	Burkholderia_phage	4.2e-09	40.8
WP_150347234.1\|1442249_1443911_+\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	9.4e-195	61.1
WP_150347235.1\|1443969_1445976_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	1.3e-150	48.4
WP_150347236.1\|1446161_1446947_+	hypothetical protein	NA	NA	NA	NA
WP_150347237.1\|1446955_1447234_+	hypothetical protein	NA	NA	NA	NA
WP_150347238.1\|1447237_1448599_+\|portal	phage portal protein	S4TTG7	Salmonella_phage	3.4e-126	48.7
WP_150348610.1\|1448591_1449509_+\|portal	phage portal protein	S4TNN1	Salmonella_phage	1.2e-47	61.9
WP_150347239.1\|1449505_1449823_+\|head,tail	phage gp6-like head-tail connector protein	B5WZS4	Pseudomonas_phage	9.3e-19	44.4
WP_150348611.1\|1449825_1450158_+\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	3.9e-36	68.2
WP_150347240.1\|1450150_1450645_+	HK97 gp10 family phage protein	A0A0U3TGT7	Pseudomonas_phage	1.5e-31	53.9
WP_150348612.1\|1450644_1451010_+	DUF3168 domain-containing protein	A0A1J0GUW9	Halomonas_phage	9.7e-36	60.3
WP_150347241.1\|1451071_1451551_+\|tail	phage tail protein	A0A2H4PI27	Pseudomonas_phage	9.4e-47	56.5
WP_150347242.1\|1451547_1451898_+\|tail	phage tail protein	Q9MCA4	Pseudomonas_phage	2.8e-40	72.4
WP_150347243.1\|1451930_1452194_+	hypothetical protein	A0A0U4J8S9	Pseudomonas_phage	2.4e-20	59.8
WP_150347244.1\|1452208_1452526_-	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	2.6e-05	31.8
WP_150347245.1\|1452537_1452819_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.5e-08	42.6
WP_150347246.1\|1452904_1455259_+\|tail	phage tail tape measure protein	A0A0H5AWE4	Pseudomonas_phage	1.1e-92	43.2
WP_150347247.1\|1455255_1455747_+	DUF1833 family protein	A0A2H4J983	uncultured_Caudovirales_phage	3.4e-60	68.1
WP_150347248.1\|1455743_1456145_+	hypothetical protein	Q9MC96	Pseudomonas_phage	1.4e-16	40.2
WP_167517228.1\|1456134_1458879_+	hypothetical protein	A0A2H4J0V9	uncultured_Caudovirales_phage	0.0e+00	66.7
1465025:1465083	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1473225 : 1519992

uncultured_Caudovirales_phage(80.7%)

tail,transposase,coat,terminase,integrase,capsid

attL 1473099:1473147|attR 1518619:1518667

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1473099:1473147	attL	NA	NA	NA	NA
WP_150347255.1\|1473225_1474395_-\|integrase	tyrosine-type recombinase/integrase	A0A059VF45	Pseudomonas_phage	8.1e-161	71.3
WP_167517229.1\|1474976_1475147_-	hypothetical protein	NA	NA	NA	NA
WP_150347198.1\|1475246_1475591_+	hypothetical protein	NA	NA	NA	NA
WP_150347256.1\|1475705_1475957_-	hypothetical protein	NA	NA	NA	NA
WP_150347200.1\|1476066_1476294_-	hypothetical protein	NA	NA	NA	NA
WP_150347201.1\|1476286_1476841_-	DUF629 domain-containing protein	NA	NA	NA	NA
WP_167517220.1\|1476833_1477004_-	hypothetical protein	NA	NA	NA	NA
WP_150347202.1\|1477193_1478060_-	hypothetical protein	A0A2H4J418	uncultured_Caudovirales_phage	1.7e-176	100.0
WP_167517221.1\|1478093_1478255_-	hypothetical protein	A0A2H4J135	uncultured_Caudovirales_phage	2.6e-17	100.0
WP_150347257.1\|1478267_1478456_-	hypothetical protein	A0A2H4J9E3	uncultured_Caudovirales_phage	8.5e-28	100.0
WP_150347258.1\|1478470_1478677_-	hypothetical protein	A0A2H4J113	uncultured_Caudovirales_phage	2.4e-31	100.0
WP_150347259.1\|1478684_1479287_-	ERF family protein	A0A2H4J2M9	uncultured_Caudovirales_phage	2.5e-105	100.0
WP_150347260.1\|1479283_1479553_-	hypothetical protein	A0A2H4J8P8	uncultured_Caudovirales_phage	1.5e-46	100.0
WP_150347261.1\|1479612_1479885_-	hypothetical protein	A0A2H4J5S5	uncultured_Caudovirales_phage	3.4e-46	100.0
WP_150347262.1\|1480005_1480578_-	hypothetical protein	A0A2H4J878	uncultured_Caudovirales_phage	2.4e-113	100.0
WP_150347263.1\|1480574_1480835_-	hypothetical protein	A0A2H4J123	uncultured_Caudovirales_phage	3.2e-41	100.0
WP_073450199.1\|1480834_1481131_-	hypothetical protein	A0A2H4J410	uncultured_Caudovirales_phage	3.4e-47	100.0
WP_167517230.1\|1481117_1481264_-	hypothetical protein	A0A2H4J127	uncultured_Caudovirales_phage	1.2e-16	95.8
WP_150347264.1\|1481762_1481960_-	hypothetical protein	NA	NA	NA	NA
WP_150347265.1\|1482263_1482452_-	hypothetical protein	NA	NA	NA	NA
WP_150347266.1\|1482520_1482727_-	hypothetical protein	A0A2H4J2M2	uncultured_Caudovirales_phage	2.1e-35	91.2
WP_150347267.1\|1482723_1482930_-	hypothetical protein	A0A2H4J8N9	uncultured_Caudovirales_phage	8.1e-32	98.5
WP_150347268.1\|1483593_1483836_-	DUF1654 domain-containing protein	A0A0S2SYC9	Pseudomonas_phage	3.3e-08	36.9
WP_150347269.1\|1483933_1484581_-	helix-turn-helix domain-containing protein	A0A2H4J8I0	uncultured_Caudovirales_phage	3.0e-48	64.5
WP_150348614.1\|1484680_1484866_+	hypothetical protein	NA	NA	NA	NA
WP_150347270.1\|1484891_1485095_+	hypothetical protein	A0A2H4J115	uncultured_Caudovirales_phage	1.5e-30	100.0
WP_150347271.1\|1485438_1485669_+	hypothetical protein	A0A2H4J9B6	uncultured_Caudovirales_phage	4.0e-11	91.9
WP_150347272.1\|1486476_1487274_+	ATP-binding protein	A0A2H4J2L2	uncultured_Caudovirales_phage	8.3e-149	98.1
WP_150347273.1\|1487270_1488626_+	AAA family ATPase	A0A2H4J8N1	uncultured_Caudovirales_phage	4.0e-252	100.0
WP_150347274.1\|1488625_1488931_+	hypothetical protein	A0A2H4J5Q4	uncultured_Caudovirales_phage	2.0e-50	100.0
WP_150347275.1\|1488974_1489241_+	hypothetical protein	NA	NA	NA	NA
WP_150347276.1\|1489237_1489429_+	hypothetical protein	A0A2H4J858	uncultured_Caudovirales_phage	2.4e-30	98.4
WP_150347278.1\|1489681_1490152_+	hypothetical protein	A0A2H4J106	uncultured_Caudovirales_phage	4.8e-88	100.0
WP_150347279.1\|1490148_1490463_+	DUF1364 domain-containing protein	A0A2H4J3Y8	uncultured_Caudovirales_phage	2.0e-37	98.7
WP_150347280.1\|1490459_1490744_+	hypothetical protein	A0A2H4J993	uncultured_Caudovirales_phage	2.8e-51	100.0
WP_150347281.1\|1490740_1491106_+	RusA family crossover junction endodeoxyribonuclease	A0A0H5AUD2	Pseudomonas_phage	1.6e-35	63.9
WP_150347282.1\|1491102_1491792_+	hypothetical protein	A0A2H4J2J2	uncultured_Caudovirales_phage	7.7e-127	100.0
WP_150347227.1\|1492038_1492374_+	hypothetical protein	A0A2H4J8L0	uncultured_Caudovirales_phage	2.0e-40	100.0
WP_150347283.1\|1492366_1492720_+	hypothetical protein	A0A2H4J840	uncultured_Caudovirales_phage	3.9e-26	100.0
WP_150347284.1\|1492727_1493219_+	glycoside hydrolase family 108 protein	A0A2H4J0Z0	uncultured_Caudovirales_phage	2.6e-92	100.0
WP_150347285.1\|1493227_1493731_+	DUF2514 domain-containing protein	A0A2H4J0Y8	uncultured_Caudovirales_phage	2.6e-71	100.0
WP_150347286.1\|1493793_1495386_+	glycoside hydrolase family 5 protein	A0A2H4J3X4	uncultured_Caudovirales_phage	2.6e-311	100.0
WP_150347287.1\|1495391_1495607_+	hypothetical protein	A0A2H4J0Y9	uncultured_Caudovirales_phage	3.3e-36	100.0
WP_159435136.1\|1495611_1495767_+	hypothetical protein	A0A2H4J0W9	uncultured_Caudovirales_phage	6.7e-23	100.0
WP_150347288.1\|1495766_1496291_+	hypothetical protein	A0A2H4J2I6	uncultured_Caudovirales_phage	8.3e-89	100.0
WP_150347289.1\|1496293_1497778_+\|terminase	terminase	A0A2H4J8J8	uncultured_Caudovirales_phage	1.6e-299	100.0
WP_150347290.1\|1497777_1499226_+	DUF4055 domain-containing protein	A0A2H4J5M6	uncultured_Caudovirales_phage	4.8e-280	100.0
WP_150347291.1\|1499200_1500307_+\|capsid	minor capsid protein	A0A2H4J831	uncultured_Caudovirales_phage	1.2e-198	100.0
WP_150347292.1\|1500336_1501644_+	SGNH/GDSL hydrolase family protein	A0A2H4J0Y4	uncultured_Caudovirales_phage	8.6e-252	100.0
WP_150347293.1\|1502450_1503473_+\|coat	coat protein	A0A2H4J3W6	uncultured_Caudovirales_phage	5.2e-188	100.0
WP_150347294.1\|1503554_1503875_+	hypothetical protein	A0A2H4J0Y2	uncultured_Caudovirales_phage	4.6e-50	100.0
WP_150347295.1\|1503880_1504381_+	hypothetical protein	A0A2H4J970	uncultured_Caudovirales_phage	1.0e-88	100.0
WP_150347296.1\|1504382_1504748_+	hypothetical protein	A0A2H4J5T3	uncultured_Caudovirales_phage	2.7e-62	100.0
WP_150347297.1\|1504744_1505191_+	HK97 gp10 family phage protein	A0A2H4J887	uncultured_Caudovirales_phage	1.7e-79	100.0
WP_150347298.1\|1505187_1505601_+	hypothetical protein	A0A2H4J130	uncultured_Caudovirales_phage	9.8e-61	90.4
WP_150347299.1\|1505671_1506316_+\|tail	phage tail protein	A0A2H4J6K6	uncultured_Caudovirales_phage	2.0e-68	63.3
WP_150347300.1\|1506324_1506639_+	hypothetical protein	A0A0S2SYT8	Pseudomonas_phage	1.3e-25	52.4
WP_150347301.1\|1506692_1506956_+	DUF1799 domain-containing protein	A0A2H4JBP7	uncultured_Caudovirales_phage	4.5e-19	52.4
WP_150347302.1\|1506966_1507263_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_150348615.1\|1507259_1507625_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A088CBP5	Shigella_phage	4.0e-05	40.0
WP_150347303.1\|1507859_1508249_+	hypothetical protein	NA	NA	NA	NA
WP_150347304.1\|1508301_1511124_+\|tail	phage tail tape measure protein	A0A2H4J107	uncultured_Caudovirales_phage	1.1e-187	51.6
WP_150347305.1\|1511142_1511727_+	hypothetical protein	A0A2H4IYI9	uncultured_Caudovirales_phage	8.1e-69	63.9
WP_150347306.1\|1511726_1512326_+	hypothetical protein	A0A059VA31	Pseudomonas_phage	2.7e-91	78.8
WP_150347307.1\|1512329_1512728_+	hypothetical protein	A0A059VK01	Pseudomonas_phage	2.3e-54	70.5
WP_150347308.1\|1512727_1515763_+	DUF1983 domain-containing protein	A0A059VFW9	Pseudomonas_phage	0.0e+00	59.9
WP_150347309.1\|1515762_1516044_+	hypothetical protein	NA	NA	NA	NA
WP_150347310.1\|1516040_1516748_+	hypothetical protein	A0A0A0YT77	Pseudomonas_phage	1.7e-12	32.7
WP_150347311.1\|1516759_1517212_+	hypothetical protein	NA	NA	NA	NA
WP_150347312.1\|1517929_1518373_+	DUF1353 domain-containing protein	A0A2H4P720	Pseudomonas_phage	1.7e-26	52.0
WP_112297852.1\|1518775_1519992_-\|transposase	IS3 family transposase	A0A1B0Z042	Pseudomonas_phage	3.8e-145	89.0
1518619:1518667	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1723619 : 1733585

uncultured_Caudovirales_phage(62.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150347395.1\|1723619_1724513_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	1.2e-47	37.1
WP_150347396.1\|1724985_1725456_-	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	8.7e-21	41.2
WP_010798306.1\|1726101_1726416_+	hypothetical protein	NA	NA	NA	NA
WP_150347397.1\|1726499_1727114_-	cyclodeaminase/cyclohydrolase family protein	NA	NA	NA	NA
WP_150347398.1\|1727263_1727620_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.4e-34	60.2
WP_150347399.1\|1727650_1728934_+	arsenical efflux pump membrane protein ArsB	A0A2H4J144	uncultured_Caudovirales_phage	2.7e-189	79.8
WP_150347400.1\|1728949_1729417_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.2e-49	61.9
WP_125888468.1\|1729454_1730141_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	2.5e-109	86.7
WP_150347401.1\|1730125_1731187_-	NAD(P)-binding domain-containing protein	A0A2H4J2Q2	uncultured_Caudovirales_phage	3.5e-102	63.4
WP_150347402.1\|1731362_1733585_+	GAF domain-containing protein	B5LWN8	Feldmannia_species_virus	1.0e-26	22.1

DBSCAN-SWA_5

2164799 : 2172622

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150347637.1\|2164799_2165729_-	dTDP-4-dehydrorhamnose reductase	A0A1D8EQE2	Escherichia_phage	3.3e-32	34.0
WP_150348640.1\|2165725_2166262_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	5.4e-59	62.6
WP_010797914.1\|2166261_2167143_-	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	5.6e-106	65.2
WP_074825235.1\|2167205_2168270_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	4.0e-98	51.9
WP_074825233.1\|2168610_2170599_-	polysaccharide biosynthesis protein	A0A1V0SAI8	Catovirus	3.4e-18	25.4
WP_150347638.1\|2170643_2171663_-	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_010797910.1\|2171662_2172622_-	SDR family oxidoreductase	Q58M85	Prochlorococcus_phage	3.3e-11	26.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP044084

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6545

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345602.1\|1340_1817_-	RES domain-containing protein	NA	NA	NA	NA
WP_150345603.1\|1816_2281_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_150345604.1\|3181_3925_-	hypothetical protein	NA	NA	NA	NA
WP_010799261.1\|4331_5060_+	suppressor of fused domain protein	NA	NA	NA	NA
WP_150345605.1\|5417_6545_-	HNH endonuclease	A0A1S6KZY3	Salmonella_phage	8.7e-19	40.3

DBSCAN-SWA_2

10427 : 16775

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345610.1\|10427_16775_-	DEAD/DEAH box helicase	A0A1B1IUF6	uncultured_Mediterranean_phage	8.4e-42	22.1

DBSCAN-SWA_3

24019 : 32221

Bodo_saltans_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010799245.1\|24019_25624_-	SAM-dependent DNA methyltransferase	A0A2H4UVB0	Bodo_saltans_virus	1.7e-20	31.6
WP_150345615.1\|25667_29054_-	DEAD/DEAH box helicase family protein	Q5YA94	Bacillus_phage	1.2e-15	26.6
WP_150345902.1\|29102_30527_-	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_112297486.1\|31240_32221_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	3.2e-94	57.7

DBSCAN-SWA_4

43650 : 52959

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167517143.1\|43650_45486_+	hypothetical protein	M1HM59	Paramecium_bursaria_Chlorella_virus	1.2e-30	34.0
WP_150345623.1\|45612_46041_-	hypothetical protein	NA	NA	NA	NA
WP_150345624.1\|46086_49497_-	TM0106 family RecB-like putative nuclease	X4XVM6	Casuarina_virus	7.7e-10	23.3
WP_150345625.1\|49734_50328_-	hypothetical protein	NA	NA	NA	NA
WP_150345626.1\|50835_52959_+	AAA family ATPase	A0A0R6PCP6	Moraxella_phage	1.7e-15	32.2

DBSCAN-SWA_5

74005 : 75508

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345636.1\|74005_75508_-	AAA family ATPase	A0A2I7RIK5	Vibrio_phage	4.7e-52	33.0

DBSCAN-SWA_6

86472 : 92999

Lactobacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010799181.1\|86472_87270_+	AAA family ATPase	E9LUK9	Lactobacillus_phage	4.6e-14	29.0
WP_150345642.1\|87266_88235_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	2.4e-09	38.2
WP_010799179.1\|88235_89078_+	hypothetical protein	NA	NA	NA	NA
WP_167517144.1\|89097_89241_-	hypothetical protein	NA	NA	NA	NA
WP_085985622.1\|90303_91453_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-102	66.7
WP_150345643.1\|91545_91761_+	hypothetical protein	NA	NA	NA	NA
WP_150345644.1\|91940_92999_+	DUF1016 family protein	Q9JMP5	Wolbachia_phage	4.6e-38	31.0

DBSCAN-SWA_7

98084 : 98975

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345649.1\|98084_98975_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.9e-15	28.2

DBSCAN-SWA_8

108434 : 109211

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345660.1\|108434_109211_+	1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	4.6e-11	26.0

DBSCAN-SWA_9

112378 : 113440

Wolbachia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345663.1\|112378_113440_+	DUF1016 family protein	Q9JMP5	Wolbachia_phage	8.9e-114	58.6

DBSCAN-SWA_10

120133 : 121699

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345671.1\|120133_121699_-	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	4.4e-45	53.0

DBSCAN-SWA_11

125079 : 126978

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345675.1\|125079_126978_+	diguanylate cyclase	G3MA91	Bacillus_virus	8.9e-24	37.3

DBSCAN-SWA_12

130084 : 147375

Shigella_phage(28.57%)

integrase,transposase

attL 130133:130149|attR 145267:145283

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345680.1\|130084_131620_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.1e-15	36.0
130133:130149	attL	NA	NA	NA	NA
WP_150345681.1\|131942_133436_+	response regulator	A0A1V0SGX0	Hokovirus	4.1e-08	23.0
WP_084213930.1\|133618_133855_-	EAL domain-containing protein	NA	NA	NA	NA
WP_010799403.1\|134683_135004_+	hypothetical protein	NA	NA	NA	NA
WP_010799402.1\|135067_136267_-\|integrase	site-specific integrase	A0A077KET4	Ralstonia_phage	4.0e-78	42.0
WP_150345682.1\|136263_136779_-	hypothetical protein	NA	NA	NA	NA
WP_150345683.1\|136858_137335_-	hypothetical protein	NA	NA	NA	NA
WP_150345684.1\|137511_138507_-	hypothetical protein	NA	NA	NA	NA
WP_125890151.1\|138826_139099_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	1.2e-17	55.1
WP_125890152.1\|139124_139859_-	hypothetical protein	NA	NA	NA	NA
WP_125890154.1\|141002_143000_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-29	30.7
WP_125890153.1\|143388_143793_+	response regulator	NA	NA	NA	NA
WP_085985622.1\|144398_145548_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-102	66.7
145267:145283	attR	NA	NA	NA	NA
WP_150345685.1\|145545_145836_-	hypothetical protein	NA	NA	NA	NA
WP_150345686.1\|145839_147375_-	hypothetical protein	A0A0H4IPK0	Shigella_phage	2.2e-12	33.1

DBSCAN-SWA_13

151779 : 159342

Ralstonia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345691.1\|151779_152802_-	endonuclease	U6C712	Ralstonia_phage	1.6e-06	24.4
WP_150345692.1\|152892_153939_-	phage recombination protein Bet	A0A0S2SY88	Pseudomonas_phage	9.2e-47	53.5
WP_150345693.1\|154160_154706_-	hypothetical protein	NA	NA	NA	NA
WP_150345694.1\|154790_155339_-	hypothetical protein	NA	NA	NA	NA
WP_150345695.1\|155352_156336_-	AAA domain-containing protein	L7TKP0	Rhizobium_phage	2.9e-26	31.4
WP_150345696.1\|156644_157010_-	hypothetical protein	NA	NA	NA	NA
WP_150345697.1\|157372_157807_+	hypothetical protein	NA	NA	NA	NA
WP_150345698.1\|157901_158081_-	hypothetical protein	NA	NA	NA	NA
WP_010799380.1\|158287_158467_-	hypothetical protein	NA	NA	NA	NA
WP_150345699.1\|159018_159342_+	hypothetical protein	A0A1B1IUF2	uncultured_Mediterranean_phage	7.8e-13	41.9

DBSCAN-SWA_14

174322 : 174592

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345712.1\|174322_174592_-	hypothetical protein	A0A0U4JX18	Pseudomonas_phage	3.1e-15	44.9

DBSCAN-SWA_15

189936 : 193217

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167517166.1\|189936_192159_+	DNA topoisomerase 3	A0A1X9I6W8	Streptococcus_phage	1.0e-34	28.0
WP_167517149.1\|192161_193217_+	S49 family peptidase	E5AFY0	Erwinia_phage	4.4e-12	25.8

DBSCAN-SWA_16

202532 : 204296

Bifidobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167517150.1\|202532_204296_+	PRTRC system ParB family protein	I3NLC2	Bifidobacterium_phage	4.7e-11	37.3

DBSCAN-SWA_17

210889 : 235019

uncultured_Caudovirales_phage(44.44%)

integrase,transposase

attL 207783:207796|attR 213282:213295

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
207783:207796	attL	NA	NA	NA	NA
WP_010791757.1\|210889_212572_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	3.7e-05	24.7
WP_150345736.1\|212574_213483_+	AAA family ATPase	NA	NA	NA	NA
213282:213295	attR	NA	NA	NA	NA
WP_000801210.1\|213479_214697_+	TniQ family protein	NA	NA	NA	NA
WP_000904941.1\|214757_215372_+	recombinase family protein	A0A0A7NPV4	Enterobacteria_phage	6.6e-37	50.3
WP_001087809.1\|215424_215661_-	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_003465059.1\|215657_216023_-	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_000136268.1\|216039_217686_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.0e-39	28.3
WP_000654684.1\|217682_217928_-	mercury resistance system transport protein MerF	NA	NA	NA	NA
WP_000735441.1\|217930_218206_-	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_001294667.1\|218221_218572_-	mercuric ion transporter MerT	NA	NA	NA	NA
WP_000429838.1\|218643_219078_+	Hg(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_019367236.1\|219316_219760_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	1.9e-22	46.7
WP_083848906.1\|219752_219887_+	DNA-directed DNA polymerase	A0A218MNF2	uncultured_virus	8.2e-09	73.5
WP_019367235.1\|219987_220539_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	6.1e-82	83.8
WP_019367234.1\|220609_221680_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	7.3e-132	81.7
WP_019367233.1\|221719_222142_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	1.5e-61	82.1
WP_019367232.1\|222168_222882_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.0e-121	91.6
WP_019367231.1\|222929_223400_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	5.0e-69	85.9
WP_019367230.1\|223416_224700_-	arsenic transporter	A0A2H4J144	uncultured_Caudovirales_phage	5.5e-211	89.9
WP_019367229.1\|224725_225082_-	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	8.5e-53	85.8
WP_167517151.1\|225806_225968_+	DNA-directed DNA polymerase	A0A218MNF2	uncultured_virus	4.7e-11	68.0
WP_125913034.1\|226076_226943_+	DUF4113 domain-containing protein	I6RSM4	Salmonella_phage	7.6e-63	44.8
WP_026004153.1\|226980_227232_-	DUF1654 domain-containing protein	A0A2H4J8G7	uncultured_Caudovirales_phage	3.5e-13	49.4
WP_026004152.1\|227338_227602_-	hypothetical protein	NA	NA	NA	NA
WP_019367224.1\|227788_228400_+	hypothetical protein	NA	NA	NA	NA
WP_150345737.1\|228399_229455_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	3.3e-28	37.1
WP_150345738.1\|229431_229890_-	hypothetical protein	NA	NA	NA	NA
WP_019364534.1\|229873_230278_-	hypothetical protein	NA	NA	NA	NA
WP_019364533.1\|230343_230646_-	hypothetical protein	NA	NA	NA	NA
WP_019364532.1\|230809_230992_-	hypothetical protein	NA	NA	NA	NA
WP_019364531.1\|231039_231459_-	hypothetical protein	NA	NA	NA	NA
WP_026003782.1\|231528_231801_-	DUF4326 domain-containing protein	A0A160DCT3	Gordonia_phage	1.0e-18	44.6
WP_019364529.1\|231992_232148_-	hypothetical protein	NA	NA	NA	NA
WP_019364528.1\|232195_232459_-	hypothetical protein	NA	NA	NA	NA
WP_150345739.1\|232463_232892_-	hypothetical protein	NA	NA	NA	NA
WP_150345740.1\|232946_233810_+	hypothetical protein	NA	NA	NA	NA
WP_085985622.1\|233869_235019_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-102	66.7

DBSCAN-SWA_18

242175 : 247913

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016487025.1\|242175_242850_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	4.6e-31	33.6
WP_004576066.1\|242846_244265_+	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	6.5e-19	28.4
WP_004576065.1\|244323_244911_-	hypothetical protein	NA	NA	NA	NA
WP_003253450.1\|245177_245399_+	hypothetical protein	NA	NA	NA	NA
WP_004576064.1\|245481_246936_-	glycosyltransferase family 39 protein	NA	NA	NA	NA
WP_033726583.1\|246929_247913_-	glycosyltransferase family 2 protein	U5P087	Shigella_phage	5.4e-49	39.2

DBSCAN-SWA_19

252807 : 258654

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004576057.1\|252807_254805_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.6e-116	39.3
WP_004576056.1\|255006_255330_-	DUF2790 domain-containing protein	NA	NA	NA	NA
WP_004576055.1\|255492_258654_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	5.4e-74	24.9

DBSCAN-SWA_20

263506 : 265385

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345742.1\|263506_264127_+	response regulator	W8CYM9	Bacillus_phage	2.4e-18	33.2
WP_004574636.1\|264095_265385_-\|transposase	ISL3-like element ISPpu12 family transposase	A0A2D1GQC1	Lysinibacillus_phage	9.5e-86	40.4

DBSCAN-SWA_21

269058 : 270208

Shigella_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085983004.1\|269058_270208_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.2e-100	65.9

DBSCAN-SWA_22

278118 : 281268

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004374632.1\|278118_281268_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.6e-54	21.1

DBSCAN-SWA_23

288468 : 289449

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_014003920.1\|288468_289449_+\|transposase	IS5-like element ISPa41 family transposase	Q38213	Escherichia_phage	1.4e-102	59.2

DBSCAN-SWA_24

295723 : 302447

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023662984.1\|295723_298084_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	8.1e-83	35.6
WP_003246761.1\|298089_298338_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_004577569.1\|298417_298951_-	cupredoxin family protein	NA	NA	NA	NA
WP_004577570.1\|299098_299656_-	hypothetical protein	NA	NA	NA	NA
WP_016487037.1\|299823_300183_-	hypothetical protein	NA	NA	NA	NA
WP_004577572.1\|300390_301068_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	8.6e-30	32.1
WP_004577573.1\|301064_302447_+	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	8.5e-16	24.8

DBSCAN-SWA_25

309176 : 327096

Bacillus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004574524.1\|309176_310859_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-38	28.0
WP_004574523.1\|310879_311296_+	hypothetical protein	NA	NA	NA	NA
WP_004574522.1\|311295_311658_+	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
WP_004574521.1\|311650_311887_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_004574520.1\|312010_312223_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_004574519.1\|312360_315357_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	9.1e-265	48.3
WP_004574518.1\|315360_315771_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_004574517.1\|315770_316010_-	hypothetical protein	NA	NA	NA	NA
WP_004574516.1\|316211_317138_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.8e-41	46.4
WP_073450589.1\|317903_319121_-	TolC family protein	NA	NA	NA	NA
WP_010799563.1\|319608_320283_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-34	37.7
WP_150345745.1\|320279_321707_+	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	7.4e-23	29.0
WP_150345746.1\|321716_322622_+	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_150345747.1\|322799_323444_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_010799567.1\|323578_323935_-	copper-binding protein	NA	NA	NA	NA
WP_150345748.1\|323931_327096_-	CusA/CzcA family heavy metal efflux RND transporter	S5VTK5	Leptospira_phage	2.4e-53	20.1

DBSCAN-SWA_26

330350 : 332442

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345750.1\|330350_331760_-	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	2.8e-14	23.1
WP_150345751.1\|331752_332442_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	35.3

DBSCAN-SWA_27

338633 : 339779

Phage_Gifsy-1(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345754.1\|338633_339779_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	2.4e-157	74.5

DBSCAN-SWA_28

355188 : 410540

Bacillus_phage(12.5%)

integrase,transposase

attL 405928:405945|attR 414385:414402

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345758.1\|355188_356691_-	AAA family ATPase	A0A126DN25	Acinetobacter_phage	2.0e-50	33.3
WP_150345759.1\|357283_360298_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	5.0e-69	24.8
WP_019365448.1\|360294_360657_+	hypothetical protein	NA	NA	NA	NA
WP_019365447.1\|360782_361409_-	HAD family hydrolase	NA	NA	NA	NA
WP_026003894.1\|361718_364082_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.7e-59	29.0
WP_019365444.1\|364747_365104_+	copper-binding protein	NA	NA	NA	NA
WP_019365443.1\|365241_365559_+	hypothetical protein	NA	NA	NA	NA
WP_019365442.1\|365591_365849_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_150345760.1\|365872_366136_+	hypothetical protein	NA	NA	NA	NA
WP_085985621.1\|366161_367014_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	5.4e-21	45.0
WP_019365440.1\|367115_368489_+	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	4.5e-17	24.9
WP_019365439.1\|368594_370304_+	hypothetical protein	NA	NA	NA	NA
WP_019365438.1\|370816_371272_+	DUF305 domain-containing protein	W6GVI1	Samba_virus	1.5e-06	40.8
WP_150345761.1\|371558_372593_-	SDR family NAD(P)-dependent oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	2.6e-09	30.3
WP_019365436.1\|372970_373300_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_019365435.1\|373775_374585_-	cytochrome c	NA	NA	NA	NA
WP_026003893.1\|374594_375593_-	copper resistance protein B	NA	NA	NA	NA
WP_019365433.1\|375582_375885_-	hypothetical protein	NA	NA	NA	NA
WP_150345762.1\|375897_377751_-	copper resistance system multicopper oxidase	NA	NA	NA	NA
WP_112297486.1\|377863_378844_+\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	3.2e-94	57.7
WP_019366369.1\|379513_379723_-	hypothetical protein	NA	NA	NA	NA
WP_019366370.1\|380145_380826_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	33.0
WP_019366371.1\|380916_382230_-	three-Cys-motif partner protein TcmP	NA	NA	NA	NA
WP_019366372.1\|382251_382995_-	phage Gp37/Gp68 family protein	A0A088F7U1	Mycobacterium_phage	2.7e-61	44.2
WP_019366373.1\|383024_383996_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_019366374.1\|384174_385206_+	DNA-binding protein	NA	NA	NA	NA
WP_019366375.1\|385308_385617_-	hypothetical protein	NA	NA	NA	NA
WP_019365854.1\|385900_386317_+	hypothetical protein	NA	NA	NA	NA
WP_019365855.1\|386306_386552_+	hypothetical protein	NA	NA	NA	NA
WP_150345763.1\|386631_387678_-	hypothetical protein	NA	NA	NA	NA
WP_150345764.1\|387738_388701_-	replication terminus site-binding protein	NA	NA	NA	NA
WP_019365327.1\|389138_389354_+	hypothetical protein	NA	NA	NA	NA
WP_150345765.1\|389489_389729_-	hypothetical protein	NA	NA	NA	NA
WP_019364813.1\|390142_391324_+	AAA family ATPase	A0A240F4U1	Ochrobactrum_phage	5.2e-30	27.3
WP_019364814.1\|391323_392421_+	ParB/RepB/Spo0J family partition protein	A0A240F4U0	Ochrobactrum_phage	9.1e-13	30.0
WP_100217720.1\|392696_393791_+	hypothetical protein	NA	NA	NA	NA
WP_019364817.1\|393970_394186_+	hypothetical protein	NA	NA	NA	NA
WP_150345766.1\|394187_395768_+	exodeoxyribonuclease VII large subunit	M1NLU2	Moumouvirus	3.9e-17	33.7
WP_019364509.1\|395896_396628_+	DUF4145 domain-containing protein	A0A1L2JZ52	Aeribacillus_phage	6.9e-33	36.3
WP_150345767.1\|396676_398452_+	hypothetical protein	NA	NA	NA	NA
WP_019364511.1\|398541_398865_-	hypothetical protein	NA	NA	NA	NA
WP_150345768.1\|399122_399644_+	hypothetical protein	NA	NA	NA	NA
WP_150345769.1\|399861_400047_-	hypothetical protein	NA	NA	NA	NA
WP_150345770.1\|400162_400555_-	hypothetical protein	NA	NA	NA	NA
WP_150345909.1\|400569_400863_-	hypothetical protein	NA	NA	NA	NA
WP_150345771.1\|400977_401451_-	hypothetical protein	NA	NA	NA	NA
WP_150345772.1\|401743_402514_+	protein KlaA	NA	NA	NA	NA
WP_150345773.1\|402533_403655_+	toxic anion resistance protein	NA	NA	NA	NA
WP_150345774.1\|403651_404659_+	hypothetical protein	NA	NA	NA	NA
WP_150345775.1\|404694_405213_+	hypothetical protein	NA	NA	NA	NA
WP_150345776.1\|405285_405660_+	DUF3225 domain-containing protein	NA	NA	NA	NA
405928:405945	attL	NA	NA	NA	NA
WP_150345777.1\|406426_407500_+\|integrase	tyrosine-type recombinase/integrase	A0A1S6L1B6	Ralstonia_phage	1.7e-59	40.3
WP_167517154.1\|407652_408291_-	EcsC family protein	NA	NA	NA	NA
WP_150345780.1\|409025_410540_+\|transposase	IS21 family transposase	K4I413	Acidithiobacillus_phage	3.4e-143	51.8
414385:414402	attR	NA	NA	NA	NA

DBSCAN-SWA_29

435031 : 444685

Shigella_phage(25.0%)

integrase,transposase

attL 424219:424232|attR 448016:448029

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
424219:424232	attL	NA	NA	NA	NA
WP_085985622.1\|435031_436182_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.2e-102	66.7
WP_150345796.1\|436340_436931_+	response regulator	NA	NA	NA	NA
WP_010799403.1\|438177_438498_+	hypothetical protein	NA	NA	NA	NA
WP_150345797.1\|438561_439761_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	1.2e-74	40.6
WP_150345798.1\|439921_441097_-	hypothetical protein	NA	NA	NA	NA
WP_150345799.1\|441236_441509_-	HU family DNA-binding protein	A0A0H3UZA0	Geobacillus_virus	2.3e-18	55.1
WP_150345800.1\|441534_442269_-	hypothetical protein	NA	NA	NA	NA
WP_150345801.1\|442428_442806_+	H-NS histone family protein	NA	NA	NA	NA
WP_150345802.1\|442870_443164_-	hypothetical protein	NA	NA	NA	NA
WP_150345803.1\|443167_444685_-	hypothetical protein	A0A1B5FPA8	Escherichia_phage	8.2e-12	37.9
448016:448029	attR	NA	NA	NA	NA

DBSCAN-SWA_30

449561 : 453969

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345809.1\|449561_450584_-	endonuclease	U6C712	Ralstonia_phage	1.0e-05	24.3
WP_150345810.1\|450675_451710_-	phage recombination protein Bet	A0A0H5BBT9	Pseudomonas_phage	8.2e-48	55.3
WP_150345811.1\|451805_452348_-	hypothetical protein	NA	NA	NA	NA
WP_150345812.1\|452432_452978_-	hypothetical protein	NA	NA	NA	NA
WP_150345813.1\|452994_453969_-	AAA domain-containing protein	L7TKP0	Rhizobium_phage	3.7e-26	31.1

DBSCAN-SWA_31

458054 : 458378

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345816.1\|458054_458378_+	hypothetical protein	A0A1B1IUF2	uncultured_Mediterranean_phage	3.5e-13	41.9

DBSCAN-SWA_32

470708 : 470978

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_125890181.1\|470708_470978_-	hypothetical protein	A0A0U1W088	Pseudomonas_phage	3.1e-15	46.1

DBSCAN-SWA_33

486045 : 489326

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167517168.1\|486045_488268_+	DNA topoisomerase 3	A0A1X9I6W8	Streptococcus_phage	1.2e-35	28.0
WP_167517157.1\|488270_489326_+	S49 family peptidase	E5AFY0	Erwinia_phage	5.7e-12	25.8

DBSCAN-SWA_34

494184 : 499155

Aureococcus_anophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345836.1\|494184_499155_-	AAA family ATPase	A0A076FFX0	Aureococcus_anophage	4.3e-09	20.1

DBSCAN-SWA_35

505888 : 506869

Ralstonia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_112297486.1\|505888_506869_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	3.2e-94	57.7

DBSCAN-SWA_36

512826 : 514593

Bifidobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345845.1\|512826_514593_+	PRTRC system ParB family protein	I3NLC2	Bifidobacterium_phage	4.3e-12	38.1

DBSCAN-SWA_37

526588 : 538962

Erysipelothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004574524.1\|526588_528271_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	1.9e-38	28.0
WP_004574523.1\|528291_528708_+	hypothetical protein	NA	NA	NA	NA
WP_004574522.1\|528707_529070_+	mercuric resistance transcriptional repressor protein MerD	NA	NA	NA	NA
WP_004574521.1\|529062_529299_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_004574520.1\|529422_529635_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_004574519.1\|529772_532769_-\|transposase	Tn3 family transposase	Q1MVP5	Enterobacteria_phage	9.1e-265	48.3
WP_004574518.1\|532772_533183_-	putative toxin-antitoxin system toxin component, PIN family	NA	NA	NA	NA
WP_004574517.1\|533182_533422_-	hypothetical protein	NA	NA	NA	NA
WP_004574516.1\|533623_534550_+	recombinase family protein	E5FFF9	Burkholderia_phage	1.8e-41	46.4
WP_150345857.1\|534708_535986_+	MFS transporter	NA	NA	NA	NA
WP_125889998.1\|536311_536866_+	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.6e-61	64.3
WP_150345858.1\|536913_537996_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_150345916.1\|538072_538174_-	hypothetical protein	NA	NA	NA	NA
WP_150345859.1\|538375_538666_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	1.6e-09	41.7
WP_150345860.1\|538662_538962_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	9.7e-26	60.0

DBSCAN-SWA_38

552099 : 552555

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345870.1\|552099_552555_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.9e-07	29.2

DBSCAN-SWA_39

559899 : 562211

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345920.1\|559899_560184_-	DUF4326 domain-containing protein	A0A160DCT3	Gordonia_phage	1.9e-18	45.0
WP_150345883.1\|560510_562211_-	DUF4942 domain-containing protein	A0A059VA49	Pseudomonas_phage	1.6e-144	49.9

DBSCAN-SWA_40

573055 : 573912

Wolbachia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345890.1\|573055_573556_+	DNA repair protein RadC	A0A1B2LRS6	Wolbachia_phage	8.9e-16	30.4
WP_010799281.1\|573636_573912_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	6.2e-19	56.2

DBSCAN-SWA_41

577128 : 578661

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150345895.1\|577128_578661_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.1e-07	26.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP044085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044085_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044085_1

669196-669290

Orphan

Consensus_repeat	Method
CCTTTCTTGCCCGCTTCAGAGGCTTTCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044085_1

>merge|NZ_CP044085|1|669196-669290|CRISPRCasFinder
CCTTTCTTGCCCGCTTCAGAGGCTTTCTCGCGATCATTGGCAAAGTTGCCACCGCTGTTTTGACCGCCTTTCTTGCCTGCTTCAGAGGCTTTCTC

>NZ_CP044085|1|1|669196-669290|CRISPRCasFinder
CCTTTCTTGCCCGCTTCAGAGGCTTTCTC	GCGATCATTGGCAAAGTTGCCACCGCTGTTTTGACCG
CCTTTCTTGCCTGCTTCAGAGGCTTTCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044085.1\|WP_150346310.1\|675155_676067_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|273359
NZ_CP044085.1\|WP_150346297.1\|652904_657854_-\|alpha-2-macroglobulin-family-protein	unknown	unknown	gnl\|CDD\|225248
NZ_CP044085.1\|WP_150346304.1\|667793_668816_-\|chemotaxis-protein-CheB	unknown	unknown	gnl\|CDD\|319752
NZ_CP044085.1\|WP_150346300.1\|659921_661130_+\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238868
NZ_CP044085.1\|WP_150346311.1\|678441_679482_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380489
NZ_CP044085.1\|WP_150346469.1\|676216_676672_+\|Hsp20-family-protein	unknown	unknown	gnl\|CDD\|182691
NZ_CP044085.1\|WP_150346295.1\|649561_650518_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|227311
NZ_CP044085.1\|WP_150346303.1\|665653_667684_+\|response-regulator	unknown	unknown	gnl\|CDD\|237425
NZ_CP044085.1\|WP_150346301.1\|661699_662029_-\|DHCW-motif-cupin-fold-protein	unknown	unknown	gnl\|CDD\|380338
NZ_CP044085.1\|WP_150346306.1\|671422_671962_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379901
NZ_CP044085.1\|WP_150346305.1\|670456_670882_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP044085.1\|WP_150346298.1\|658151_658541_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|319905
NZ_CP044085.1\|WP_150346307.1\|672007_672991_+\|acryloyl-CoA-reductase	unknown	unknown	gnl\|CDD\|176248
NZ_CP044085.1\|WP_150346296.1\|650546_652877_-\|peptidoglycan-glycosyltransferase-PbpC	unknown	unknown	gnl\|CDD\|183049
NZ_CP044085.1\|WP_150346309.1\|674136_675021_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP044085.1\|WP_150346299.1\|658537_659332_-\|DeoR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP044085.1\|WP_150346308.1\|673636_674026_-\|response-regulator	unknown	unknown	gnl\|CDD\|381085
NZ_CP044085.1\|WP_019366131.1\|676764_678123_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|273326
NZ_CP044085.1\|WP_150346302.1\|663855_664926_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182242
NZ_CP044085.1\|WP_010798746.1\|669657_670179_-\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496

Protein	Function_ID	Function_description	E-value
NZ_CP044085.1\|WP_150346310.1\|675155_676067_+\|EamA-family-transporter	gnl\|CDD\|273359	TIGR00950, Uncharacterized_inner_membrane_transporter_YicL, Carboxylate/Amino Acid/Amine Transporter. [Transport and binding proteins, Amino acids, peptides and amines].	1.39204e-13
NZ_CP044085.1\|WP_150346297.1\|652904_657854_-\|alpha-2-macroglobulin-family-protein	gnl\|CDD\|225248	COG2373, COG2373, Large extracellular alpha-helical protein [General function prediction only].	0
NZ_CP044085.1\|WP_150346304.1\|667793_668816_-\|chemotaxis-protein-CheB	gnl\|CDD\|319752	cd16433, CheB, Chemotaxis response regulator protein-glutamate methylesterase, CheB. This family contains the methylesterase CheB (EC 3.1.1.61; also known as CheB methylesterase, chemotaxis-specific methylesterase, methyl-accepting chemotaxis protein methyl-esterase, or protein methyl-esterase) domain, a phosphorylation-activated response regulator involved in reversible modification of bacterial chemotaxis receptors. Signaling output of the chemotaxis receptors is modulated by CheB and methyltransferase CheR by controlling the level of receptor methylation. cheR and cheB have a strong preference to occur in the same operon, and a subgroup contains multidomain proteins with CheB-CheR fusions. Reversible methylation of transmembrane chemoreceptors plays an important role in ligand-dependent signaling and cellular adaptation in bacterial chemotaxis. Phosphorylated CheB catalyzes deamidation of specific glutamine residues in the cytoplasmic region of the chemoreceptors and demethylation of specific methyl glutamate residues introduced into the chemoreceptors by CheR.	5.94705e-88
NZ_CP044085.1\|WP_150346300.1\|659921_661130_+\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	3.56112e-106
NZ_CP044085.1\|WP_150346311.1\|678441_679482_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380489	cd01575, PBP1_GntR, ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. This group represents the ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of GntR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type 1 periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type 1 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding, which in turn changes the DNA binding affinity of the repressor.	4.32228e-108
NZ_CP044085.1\|WP_150346469.1\|676216_676672_+\|Hsp20-family-protein	gnl\|CDD\|182691	PRK10743, PRK10743, heat shock chaperone IbpA.	2.80999e-43
NZ_CP044085.1\|WP_150346295.1\|649561_650518_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|227311	COG4977, COG4977, Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription].	1.49159e-94
NZ_CP044085.1\|WP_150346303.1\|665653_667684_+\|response-regulator	gnl\|CDD\|237425	PRK13557, PRK13557, histidine kinase; Provisional.	8.36372e-128
NZ_CP044085.1\|WP_150346301.1\|661699_662029_-\|DHCW-motif-cupin-fold-protein	gnl\|CDD\|380338	cd02208, cupin_RmlC-like, RmlC-like cupin superfamily. This superfamily contains proteins similar to the RmlC (dTDP (deoxythymidine diphosphates)-4-dehydrorhamnose 3,5-epimerase)-like cupins. RmlC is a dTDP-sugar isomerase involved in the synthesis of L-rhamnose, a saccharide required for the virulence of some pathogenic bacteria. Cupins are a functionally diverse superfamily originally discovered based on the highly conserved motif found in germin and germin-like proteins. This conserved motif forms a beta-barrel fold found in all of the cupins, giving rise to the name cupin ('cupa' is the Latin term for small barrel). The active site of members of this superfamily is generally located at the center of a conserved barrel and usually includes a metal ion. The different functional classes in this superfamily include single domain bacterial isomerases and epimerases involved in the modification of cell wall carbohydrates, two domain bicupins such as the desiccation-tolerant seed storage globulins, and multidomain nuclear transcription factors involved in legume root nodulation.	0.000736744
NZ_CP044085.1\|WP_150346306.1\|671422_671962_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|379901	pfam16925, TetR_C_13, Bacterial transcriptional repressor C-terminal.	7.79631e-61
NZ_CP044085.1\|WP_150346305.1\|670456_670882_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.49333e-12
NZ_CP044085.1\|WP_150346298.1\|658151_658541_-\|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein	gnl\|CDD\|319905	cd07241, VOC_BsYyaH, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YyaH. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.21281e-49
NZ_CP044085.1\|WP_150346307.1\|672007_672991_+\|acryloyl-CoA-reductase	gnl\|CDD\|176248	cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases. Yhdh putative quinone oxidoreductases (QOR). QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR actin the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP044085.1\|WP_150346296.1\|650546_652877_-\|peptidoglycan-glycosyltransferase-PbpC	gnl\|CDD\|183049	PRK11240, PRK11240, penicillin-binding protein 1C; Provisional.	0
NZ_CP044085.1\|WP_150346309.1\|674136_675021_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.77962e-28
NZ_CP044085.1\|WP_150346299.1\|658537_659332_-\|DeoR-family-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	6.89859e-66
NZ_CP044085.1\|WP_150346308.1\|673636_674026_-\|response-regulator	gnl\|CDD\|381085	cd00156, REC, phosphoacceptor receiver (REC) domain of response regulators (RRs) and pseudo response regulators (PRRs). Two-component systems (TCSs) involving a sensor and a response regulator are used by bacteria to adapt to changing environments. Processes regulated by two-component systems in bacteria include sporulation, pathogenicity, virulence, chemotaxis, and membrane transport. Response regulators (RRs) share the common phosphoacceptor REC domain and different effector/output domains such as DNA, RNA, ligand-binding, protein-binding, or enzymatic domains. Response regulators regulate transcription, post-transcription or post-translation, or have functions such as methylesterases, adenylate or diguanylate cyclase, c-di-GMP-specific phosphodiesterases, histidine kinases, serine/threonine protein kinases, and protein phosphatases, depending on their output domains. The function of some output domains are still unknown. TCSs are found in all three domains of life - bacteria, archaea, and eukaryotes, however, the presence and abundance of particular RRs vary between the lineages. Archaea encode very few RRs with DNA-binding output domains; most are stand-alone REC domains. Among eukaryotes, TCSs are found primarily in protozoa, fungi, algae, and green plants. REC domains function as phosphorylation-mediated switches within RRs, but some also transfer phosphoryl groups in multistep phosphorelays.	7.54508e-16
NZ_CP044085.1\|WP_019366131.1\|676764_678123_-\|MFS-transporter	gnl\|CDD\|273326	TIGR00893, Probable_glucarate_transporter, D-galactonate transporter. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids].	4.28833e-157
NZ_CP044085.1\|WP_150346302.1\|663855_664926_+\|hypothetical-protein	gnl\|CDD\|182242	PRK10101, csgB, curlin minor subunit CsgB; Provisional.	1.26491e-08
NZ_CP044085.1\|WP_010798746.1\|669657_670179_-\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.57338e-49

>NZ_CP044085.1|WP_150346304.1|667793_668816_-|chemotaxis-protein-CheB
MKLDADIRNIVVIGASAGGVQALTTLFQSLPPVLPAAFLVVLHIPAYAPSVLPEVLSRVTQMRVVPADDSQPLEAGSVYVATSDRHLMLEEEGLRVTRGPKECRVRPAIDVLFRSAAVSHGACVIGVILTGALDDGTAGLWAIKDREGLALVQDPSEAMHESMPESAIKHVKVDFIGSIEALAQQIVRAVGTQIDRQHARPAREGHVIEKLIELKGNGLEAGVMSLGAVSKYTCPECHGVLVQIEEGSIIRFRCHTGHAFSMKTLIAEVNEAIDNGLWDTLRAVEERVVLLRQMAELADRAGSYDEAAQCRYQADESEKRLQPLRELVLDSGFFGHDQMG
>NZ_CP044085.1|WP_150346303.1|665653_667684_+|response-regulator
MKQELNFQTLFEALPHLVLVLSTGPEFIMLAANEGRLRGTNTRREDCIGRSIFEVFGKNPDERTEFGAGVLRASLERVVQTRAPDRMAITKYDIPRPAAQDGGFEVRYWSPLNTPVLDEKGEVIYIIHQTEDVTEQVVEQQRSNSSLKVVDERFRAALLASEAGIFDWYIDEDRLYFDSALQQLFKLPDTLTHNAIERFLGYVHPEDQAQVRLSFAQCMQGGNFTVEFRLQRNQDERWLVCKGNVFRDAAGNPSYVTGTCVDISARKHAENALRELNETLEARVASEVAERTRVEETLHQAQKMEAVGQLTGGIAHDFNNLLTGIIGSLELMQRRHSAGSSKDDERYINAAVTSAQRAAALTQRLLAFSRRQTLDLKAIDVNQLVASLEDLLNRTTGENIKVVTALSAGLPLACMDANQLESALINLVINARDAMPHGGTITISTAAFDVESDQQARWAELKEGQYIQLTVTDTGMGMAPDVLAKVFEPFYTTKPIGQGTGLGLSMVYGYLKQAKGSVQILSEPGNGTSVYLYMPCHKGDANTLPAEKNRVAPLGSGEIVLVVEDEAVVRSLIVEVLDELGYRALQAADAQEAIPLLESDQRIDLMISDVGLPGMNGRQLADFARLSRPNLKVLFATGYAEGSNVSGYLAPNMEIITKPFAIEALASKIKEILKAP
>NZ_CP044085.1|WP_150346302.1|663855_664926_+|hypothetical-protein
MFKLKPLAFIVLVSLGGTAVAANNSATQLQDGNNNEVTLDQRGENNKATQNQTGDNNRSAVLQDGNANVAETIQQGFNNSIDLSQTGSGNTASVYQQGGEYDDQSAIVTQLGEANTLTLSQDSYHHATLYQEGNNNIYNIEQRDALTGGNLEARTVGNNNQLTVQQGSAVDAQLFQTGDDNILVVNQGGGYMPGSVYVSQDGDQNAATVNQGGTSRDAAGFTSLSQEGNANTATIYHGSGSSSTSFAQQGNNNELSIYQGVRAVRASGHSIGDDNVVDIAQSGDASSAGIVQEGGGNLGRIHQEELAWNSQASITQIGFSNEAAVSQRWSIASFRADNVATVMQNGTGNTASVIQQ
>NZ_CP044085.1|WP_150346301.1|661699_662029_-|DHCW-motif-cupin-fold-protein
MQIDNIPFGTTDWSTIEPTTHPGETGSAYWRTQTYGSIRVRMVEYSAGYLADHWCSKGHILFCLEGELQTELDDGRQFTLKPGMSYQVADNAEAHRSYTASGAKLFVVD
>NZ_CP044085.1|WP_150346300.1|659921_661130_+|SGNH/GDSL-hydrolase-family-protein
MSTLAAALLMAGNYSLAAQPQSPHWVGSWAAAPQANGASAGSKETVVRVNNQTIRQIVHTSIGGYKFRVRLSNALGKTPLVIGEARVALSAGKNTINPDTDRPLTFGGISSTTIPPGAVMYSDPVDMRFSSQADLAISLYLPEQTETKTVHTLGKQTNYISTSGNHTKARALQTKSTSTSWYFLTGVDILTHKDTTAVVAFGDSITDGLNAAVDTNNRWTDYLARRLLNRSDINTKGVLNLGISGNRILHEQVGPSALSRFDRDVIAQPGVTHLILLEGINDIGYSDLPGSREKVSAKQIIAGYKQLIARAKTHGLKVIGATLIPYEGGSYYTRQGEAKRQEVNKWIRESGAYDAVIDFDKTMRDPKRPTRLNPLFDSGDHIHPNETGFLAMANAVNLDWLK
>NZ_CP044085.1|WP_150346299.1|658537_659332_-|DeoR-family-transcriptional-regulator
MPILKDILPHERQSVILQRLDSQGRVIAADLAKEMSVSEDSIRRDLRELAQRGLCRRVYGGALSVAPDPGPLNKRIQNSTPILSVLAEAAAALVGPGQTIFLDAGSTNRAIALALPSQANLTVITNAPAIGEALLSKPGVETILIGGRLDSKAGGSLGAKALREIQAIHADIYFMGACALSFETGVTAFNFEEAELKRALVNAANATVITLSADKFDTLAPYQVIPSEAIDHLVIETNNQVEPRLKAFRKSGCSVQTVHIQEAL
>NZ_CP044085.1|WP_150346298.1|658151_658541_-|glyoxalase/bleomycin-resistance/extradiol-dioxygenase-family-protein
MKIAHVALWTLDLERAADFWHQTFSARIGQPYHSQTNKGFISRFVTLEDGPTIELMTHPRLNQATISSDTPVTGWAHIAISLGSEDAVRKLAEHMDGEQALVSAPRWTGDGFFEAVIRDPDGNLIEITA
>NZ_CP044085.1|WP_150346297.1|652904_657854_-|alpha-2-macroglobulin-family-protein
MRLKGILLSAILCLLAACDASQDAPTGSTSKTAPESSGSPASATIDAKTAESAPVSKTQDIAQTAERYAGRALTVVDASEIQLDGASTLSATFSVPLQREQAFHQYLHLADKTAGPVDGAWELSDNQMELRLRHLQPKRELTLTIDAGLKAINGNALNAPYTTSLNTRNITPSVGFASRGSLLPTRLAEGLPVIALNVDKINVDFFRIKPDALPAFLARWGNRATMGYWESSEILPMAELVYTGRFNLSPKLNTRETVLLPLTGIEPLKESGVYLAVMQQAGKYDYQQSTTLLTLSDIGLSAHRYRDRIDVFTQALNGGHPLGKIAIRVLDKDSAVLAETQTDAQGHAQLTVNGNARVLLAQHDGQTSLLRLDNPALDLAEYKIDGPRQQPQQFFVFGPRDLYRPGETVFLNALLRDGDGHALPPHPVPVEVRRPDNQTSRRFVWKPDANGLYQYELQLGEEAPTGRWQLVMQVDGATPQLYEFSVEDFLPERMALELKGEDAPLAPDEPFEVNVTGRYLYGAPANGNTLSSQLYVRPLREAVATLPGYQFGSITEADLSQDLDLDDLTLDTKGRGLLSQDTRWSEARSPLQLILQSSLQESGGRPVTRRLVQPVWPAQHLPGIRPLFNDGEVDADSQAGFEIVMANAQGKKLQASQLRVRLVRERRDYYWGFSDDEGWSSRYNEKAIIMSEETIDVAANGSAKVSFPVEWGPYRVEVEDPETDLVSSIRFWAGYRWQDNTDNGSVRPDQVKLSLDRPAYPAGDQARITVTPPTAGNGYLLVESAEGPLWWQPIEVPEGGKTFDVPIAKDWSRHDLYVTALVIRPGEAKTGVTPKRAVGLLHLPLDREARRLNLTVNTPARMEPGQPLKVRLQARNADGSTPQQAHVLVSAVDTGVLSITRYTTPDPFSAFFGRKAYTADQFDVYGQLIEAGRGRLAALAFGGDADLSAGGKRPPTKVKILSEQSQAVTFDAEGNAEVSLPVEDFNGELRVMAQVWTEDRFGAGESKVTVAAPLVAELAAPRFLASGDETTLALDVTNLSGRAQQLVVKTEVSGRLALQETVDKPLALKEGQRVTLKVPVKALGGYGTGKVTVRITGLVMPEGSSSLSRDWTLGVRPAYPARRDQFSVALDASTPSWSLPASVLEAYAPETREAMLAVSSQPPLNLAEHIKALEAYPYGCLEQTTSGLYPSLYADAESLKRLGIRGEQESDRRRKIEVGIDRLLGMQRYSGGFGLWSAESSEEYWLTAYVTDFLLRARERGFAVPAESLNKATQRLLRYLQDPNQIDVGYSENATHDRFAVQAYAAYVLARSKQAPLGALRSLFDRREAAASGLPLVHLAIALQRMGDNDRAMQALTAGLAQVRASKAWFHDYGSVLRDEAQILALLEENDLAENQRTQRLFALAEELSTHRWLSTQERNWLYLAGRSIMSKPAQPWKVELTLAGVPRELADNRDVTQHIDGAELNTPLSVRNTGDAVVYQQMTVTGYGMQAPAPTSENLSIERSYLGMDGRPVNLSQLHSGELVLVHLAVRAHQRVPDALVVDLLPAGLELENQNLAQSAASLEDAGSNVREWVKAMQNGTLKHQEYRDDRYVAAVDVNGYGTTHLVYLARAVTPGRYLVPPPQVESMYRPAWQALGATPDQLVVLPR
>NZ_CP044085.1|WP_150346296.1|650546_652877_-|peptidoglycan-glycosyltransferase-PbpC
MKKGLHAAKYWSRLALSLFSVLAAMLWLADQLWPLPVPDDGLAHVILAEDGEPLYRFADGQGIWRYPATPDTVSPYYLDALLAYEDRWFYQHPGINPAALARAAWLNLSSGRVVSGGSTLSMQVARLLEPHSRTFAGKLRQLFRTAQLECHLSKQEILTLYLNRAPFGGTLEGVAAASWTYLGKSPVNLTRAEAALLAVLPQAPSRLRPDRFPERAQAARDKVLARLDSEGVWPAKAVKEAMEEPVWLAPRQSPDQAPLLARRLNTPGESPAIHTTIDIALQRRLESLLLDWRARLPERTSAAIIVVDTGSMAVKAYLGSVDITDDRRFGHVDMVSAIRSPGSTLKPFLYAQALDAGLIHSESLLQDVPRRFGDYRPGNFSSGFSGPVAASEALHRSLNLPAVQLLEAYGSKRFSGELRSAGVPLFYPRGAEPNLSLILGGVGARLEDLASGYSAFAREGKVARLRFRPEEPVMERRLMSPGAAWIVRRMLADRSDPLLDEAQLPPALAYKTGTSYGFRDAWSIGITPGYVIGVWIGRPDGTPVAGQFGLASAAPLLFQVNDILLNRDTQRGRLSPIQTRPASVGVESICWPGGQPLPADDENCRVRRWAFTLDKQTPPTMQAPDQPLGQGLDETYWVNEAGKQVAPSCSGARPVRFLAWPASLEPWLAARERRMSRLPSVDSNCAPTLGTAASPLQITGLRDGARLQAPAGQSEPVSITVTAQGGEGSRWWFVNGEPVAEQSEQLSYTFPRPGAYEISVLDDSGQTEHVNVTVVR
>NZ_CP044085.1|WP_150346295.1|649561_650518_+|helix-turn-helix-domain-containing-protein
MTRLVAILALPGVQLLDVAGPLDVFAQANLDSGTPSYLCRVIGLESGPVQSSSGARLYADGVVNEQPERYDTVLVAGAPHISNLKPDPITQAWIRGAAKRARRFGSVCTGAFVLAHSGLLDGRRVTTHWACAPALAQAYPSVQVEEDAMYIRDGKLRTSAGVTAGLDLALALVEEDLGRNIARQVASQLVMYFKRPGGQLQFSRHGQSSVGGRSVLQETQRWAMANLSSPLSVDALAAHAGMSSRHFARLFSAEIGETPAVWVERARISAARLLLEEQGDVPKQVATKVGFASTDTLRRAFMKHVGITPAEYRKRFHA
>NZ_CP044085.1|WP_010798746.1|669657_670179_-|cysteine-hydrolase
MHALLILDMQVGLFQGPDKPWLGDRLLSTLNDLIYRAQKAGSPVFLARHTGPAGSPIEPGSPFTQLVNGLALEGSEIIFDKTRPNAFAFTNLAEQLRSKGVDTVLIAGMKTQYCIDSTCRAARDLGFEAILIEDGHTCSDTPVMSANAIIDHHNATLVGAFCQVMKATECEFK
>NZ_CP044085.1|WP_150346305.1|670456_670882_-|GNAT-family-N-acetyltransferase
MSARIEIAINPKENERSAILKPLRAHNHSKAGDPKPESIALLVRDEDTNEIIGGLYGEIYYRWLFIELLAIPEETRGQGIGSRLVNMAEDVARERSCVGIWLDTFDFQAPGFYQKHGFTEFGHLDSFPPEHTRFFFQKRLS
>NZ_CP044085.1|WP_150346306.1|671422_671962_+|TetR-family-transcriptional-regulator
MEIFTEQGFAATGIDLVLKRIQVPKGSFYHYFDSKEAFGQAVLRSYAAYFARKLDRWLLDESVDPIQRLKNFVEDAKVGMARYEFRRGCLVGNLGQEVLVLPDSFRSQLEATLLDWQRRLADCLREAAKRGQLRSGCNCDDLAAYFWIGWEGAVLRARLSQTARPLDCFIEGFLNGIKA
>NZ_CP044085.1|WP_150346307.1|672007_672991_+|acryloyl-CoA-reductase
MFKAILIDKNASTYNARLADMSEDQLPEGDVTVRVSYSTLNFKDGLAITGNSPVVRKFPMVPGIDFAGIVEESTHPRYKAGDRVLLNGWGVGESHWGGLAQKVSVQGDWLIPLPSGLDEHQAMAIGTAGYTAMLCLMALERHGITPDKGDILVTGANGGVGSFAVSLLARNGYSVIAATGRPEESEYLKKLGAQSVINRNELSEPGRPLSKERWAGAIDSVGSHTLANVCAATRAEGAVAACGLAQGMDLPATVAPFILRGVSLLGINSVTQVYERRVEAWNRLQTDLDLSMLSEITREITLGEAISASTDLLQGKIRGRLVVNVNR
>NZ_CP044085.1|WP_150346308.1|673636_674026_-|response-regulator
MDAHNAETPQRYAPIALVAEDEVMLRELMSDVLQNEGFEVAAFGTADEALSFLEDKALLVSVVVSNVRMPGHINGIDLAHIVSKRWPFLPIVLTSGYTGLEIQLPKDVPFLRKPWTIDQLATAVKEMRR
>NZ_CP044085.1|WP_150346309.1|674136_675021_-|helix-turn-helix-domain-containing-protein
MQQADNFQVFRTLDQASNAHRLRHTALGNGMALAQWYRSDADVLGYSSPDHHTLSLYLEGGWQTFRLDQPGHYGAPDRFCVLPAGHDSDWSVTQGLGFMHLYVTPEQLMLETIRVLDKEPRAIHLQERTYMEDPALVAICRALERSDWQEPGERLLCSSLAHEAVSHLLLNGCGPRQEVHWRGGLSPSVRRRIRDYIDTHLDKPLELSTLAEEAALSTFHFSRMFTLSFGIPPHRYVLARRLARARELLINTTLPLAQITLDCGFSSASHLSRRFAQVHGATPGQYRTALSRAG
>NZ_CP044085.1|WP_150346310.1|675155_676067_+|EamA-family-transporter
MNLTLYLLTVLIWGTTWIAIKFQIEFVAIPLSIAYRFALAALVLFLILIPTRRLQPLDQRGQLFCMAQGTCLFCLNFICFYSASQYIASGLIAVVFSTATLWNALNARLWFKQTIAANVLAGGVLGLLGLALLFWPELGSHTASHETWLGLGLSLLGTLCFSAGNMISSLQQRVGIRPLTSNAWGMLYGALILLVICLVQGVPFTVDLSTRYISSLVYLAVPGSVIGFTAYLTLVGRLGAERAAYCTVLFPVVALNISAWMEGYQWTWPALFGLALVLLGNILVFRKPKGSSTLLKPATSMGR
>NZ_CP044085.1|WP_150346469.1|676216_676672_+|Hsp20-family-protein
MMTGLSLAPLFRSTVGFDRFNDLFESALRDSVPGYPPYNVEKHGENDYRIVIAAAGLHEDDLDIQVERGVLTISADRREHTAEGVTYLHQGIAQRAFRLFFRLDEHIEVKGASLRNGLLNIDLVRRVPEEAKPKRITIASEARPALNDEAA
>NZ_CP044085.1|WP_019366131.1|676764_678123_-|MFS-transporter
MGDTRQTRVRYLILLMLFLVTTINYADRATISIGGSSMQKDLGIDAVTLGYIFSAFGWAYVLGQIPGGWLLDRFGSKRVYATGIFIWSLFTLLQGFVGMMPVAWAVVTLFVLRFLVGFAEAPSFPGNARIVAAWFPTAERGTASAVFNSAQYFATALFAPLMGWIVYSFGWEHVFVVMGVLGIIFSGIWMKTIYNPKDHPRANAAEIAHIEKNGGLVDMDQARGTNNGPKWHYISQLLTNRMMLGVYLGQYCINAITYFFLTWFPVYLVQERGMTILKAGFIASLPAICGFIGGVLGGIISDWLLRRGNTLTFSRKLPIVCGLLLSTSMVFCNYVDAEWMVVGFMTLAFFGKGLGALGWAVVSDTSPKQIAGLSGGLFNTFGNIASITTPIIIGYIIAVTGSFRWALVYVGANALVAVFSYLFIVGKIQRVELRDENGKQLADTSVPAPASA
>NZ_CP044085.1|WP_150346311.1|678441_679482_-|substrate-binding-domain-containing-protein
MARKSSKTASGPSSGTPALTLIDVAKVAGVSPITVSRALHRPEIVSEAAREKVLAAVKATGYVPNMLAGGLASNKSRLVAIFLPTIAHSIFADTVQALIDQLTASGYQTMIGLTGYSPEQEEQLLAAVLGRRPDGIVLTGTLHTEESRDRLSRSSIPVVEAWELGTEPIDMQIGFSHEAVGRAMADYLYGKGYRQFGLVSVDDIRALKRGRALLDQLASLGITDVPVEIMQTPATLLSGREGLRQLKGRGSLPEVVVCSSDTVAQGILAEAASQGIKVPEELAVLGFGDLSSAAHVYPALSTVNVDGARMGKLIAKALLARFQNPDQHTEPVQLDTGFTIVERSTT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044087

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044086

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP044084

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP044085

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection