CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP023747	Streptomyces nodosus strain ATCC 14899 chromosome, complete genome	13 crisprs	cas6e,cas5,cas7,cse2gr11,cas8e,cas3,WYL,csa3,DEDDh,cas4,cas1,cas2,Cas9_archaeal,Cas14u_CAS-V,casR,c2c9_V-U4,DinG	6	37	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP023747_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_2

130847-130938

TypeI-E

Consensus_repeat	Method
CCGTAGAGTCCGCGCGAGCGGGAATGACCCG	CRISPRCasFinder

1 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e

The CRISPR arrays of NZ_CP023747_2

>merge|NZ_CP023747|2|130847-130938|CRISPRCasFinder
CGGCAGCGCCCGCGCGAGCGGGAGCGCCCCAGCCTGCTGCGCCTTGCTCGGTCCGTTCGCCGCGTAAAGCCCGCGCAAGCGGGAGTGACCCG

>NZ_CP023747|2|3|130847-130938|CRISPRCasFinder
CGGCAGCGCCCGCGCGAGCGGGAGCGCCCCA	GCCTGCTGCGCCTTGCTCGGTCCGTTCGCC
GCGTAAAGCCCGCGCAAGCGGGAGTGACCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043436702.1\|143538_143844_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436670.1\|119575_120388_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379165
NZ_CP023747.1\|WP_144401403.1\|116468_118682_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_052453889.1\|136583_137324_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP023747.1\|WP_043436683.1\|133070_133529_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436691.1\|137310_138021_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP023747.1\|WP_043436688.1\|135918_136578_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_079161935.1\|124793_125432_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP023747.1\|WP_079162468.1\|125431_126922_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP023747.1\|WP_079162467.1\|122611_123421_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NZ_CP023747.1\|WP_158508299.1\|132279_133074_+\|DUF4231-domain-containing-protein	unknown	unknown	gnl\|CDD\|379418
NZ_CP023747.1\|WP_144401402.1\|115942_116443_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_150478119.1\|123417_124581_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP023747.1\|WP_043447800.1\|134555_135764_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP023747.1\|WP_043436696.1\|140699_141437_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP023747.1\|WP_043436681.1\|131785_131977_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436675.1\|121970_122615_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP023747.1\|WP_043436693.1\|138017_140663_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
NZ_CP023747.1\|WP_043436679.1\|127297_130171_-\|CRISPR-associated-endonuclease-Cas3''	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP023747.1\|WP_043436673.1\|120384_121944_-\|Mu-transposase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043436670.1\|119575_120388_-\|ATP-binding-protein	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	3.23321e-15
NZ_CP023747.1\|WP_158508299.1\|132279_133074_+\|DUF4231-domain-containing-protein	gnl\|CDD\|379418	pfam14015, DUF4231, Protein of unknown function (DUF4231). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 148 and 288 amino acids in length.	9.14884e-08
NZ_CP023747.1\|WP_052453889.1\|136583_137324_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.26402e-81
NZ_CP023747.1\|WP_043436691.1\|137310_138021_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	4.17345e-67
NZ_CP023747.1\|WP_079161935.1\|124793_125432_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.52132e-07
NZ_CP023747.1\|WP_079162468.1\|125431_126922_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	2.13197e-70
NZ_CP023747.1\|WP_043447800.1\|134555_135764_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.26084e-20
NZ_CP023747.1\|WP_150478119.1\|123417_124581_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	2.68916e-94
NZ_CP023747.1\|WP_043436696.1\|140699_141437_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.20686e-70
NZ_CP023747.1\|WP_079162467.1\|122611_123421_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	3.53317e-32
NZ_CP023747.1\|WP_043436675.1\|121970_122615_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.18474e-48
NZ_CP023747.1\|WP_043436693.1\|138017_140663_+\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	3.11809e-08
NZ_CP023747.1\|WP_043436679.1\|127297_130171_-\|CRISPR-associated-endonuclease-Cas3''	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.93297e-45
NZ_CP023747.1\|WP_043436673.1\|120384_121944_-\|Mu-transposase-C-terminal-domain-containing-protein	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.07525e-09

>NZ_CP023747.1|WP_043436679.1|127297_130171_-|CRISPR-associated-endonuclease-Cas3''
MGVIEDGRYDGVDRRPWGKLEFDRATLRMYSLLFHLIDVGAVAGVLWDRFLTPSQHKVISAGLNVPQRQARSLVCFLAAMHDIGKLIPYFQSSEPLAYVRLGEELLADTGPVVHVPHARASMHVGLHLLSELGFAVGGNDSPAVRAAQCLGGHHGRFLQLDVDGAASVQRVEATLGGPAWQDLRRRYTRLLWHLFGVDEAPGRVSVEAAVLITGLTMVADRVASQRRYWVPNADTPSFGAAEHHSRARRQAEKEVERLGLARFALDRVPFTTAHPGLEEPNALQRSVMEELPHLVAERGSGIAVVTDAMGTGKSVTALEMARIFNEHCGTQGVMWLLTATAAADQAYEVLDRYVRAHRPEYAPVTLVHHHSDLNEAYTGRCLSPADTSVLDGPPDDPFTDDQDDSFADDETEYGPGAAGPDRWLRGRDNALLAQYTVSTTDQAQMAVLPVRHSALRMLALSGKTVVIDEAHALDPFSQLQLLRLLQWLGALSCPVVVLSATMPASTATELVRAYLSGAGRTGLNGVSFAPGYPGWLFADAATAGVHRMSEPARVQQRAAQRRSARIRVRPVTYRRLGQADRSVEAGERLATIAEVLQPVIRHGGCAAVVCATVADAQDTYAYLRRMWTGPPDDLVLVHARVRGRRRQSTLGDLRHQLGPTGPRPGRRVFVTTSLLDVSLDIDVDLMVSDLASLARLLQRLGRLGRFTHLWTGQDRRPAWWDGDNSPALTVLHPVNSRGATALPPGWGTVEPAVALHETARLLPALEKEPLIVPDDVQALVEQVHGVTSGFAAETTRLQQMAVAHQTRTSRQEQLSAIHLVPPAKRVSSLADLHRQHLTTAQAATRPGLLPRRLLPCHRRADGTLTLDAAGMLPLPDQEHLSRRHLRSILEHSLSVPAAWVARTSARHHPPASWKQHPLLADIVLLPTDSVTRESEHRFGHHWLRMDEELGLQHRKQQ
>NZ_CP023747.1|WP_079162468.1|125431_126922_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDVRTGRRYDQVGLRALFLDAHRIDDLALPHPPAASALLRIAVAVTARITGLDDPELTASQWNALRRSRLAEGRFDPDAVHAYFDQHAWNVFDPLRPWLQDPSLRTQCDHSTGINAFVPGRPAGNNLAWFSPHGHHTAEPVPTAEALQILLIHHYYGRAGTGTPRTLDGVTSKKQTSGPLRSSVSFHPLGRTLHETLLAGVPAFTGDDQPPDADACPWEKAAPPGPQGTSHRPVTWPGGQLTGLSRHAILLVPGHDGTTVTDAYITWATQQPKPITTDPYLAYRFTPKRKNVARRRSIHRADASRAWWRDLETLLLAPDEHGTHRRPAIFDTLNDLPEPARRSLRIRVHGFDQDSSKAVDRQWYTAITPPLLNWTQEHDPVKAQRIAECCREAEQVAQQLATVAKQAWDTATHSRTTQPPWANRALTRYWPKAETVFRRLLEEPDTAAPTAFADAAAAALRESTEAARIHHTSAARAVAHAVRDLYRRPTTPRKTA
>NZ_CP023747.1|WP_079161935.1|124793_125432_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MPTAAEHRASCDAFVAHIHLLCAEPGVRARLSRGRGRPVEECAPMDRYLSRRTAHRSGRRAYYTIASLIAMAGPQSHTPGVRPDNDPGPPSPENDPASLLVAPADSAPPPAAPDPAAWFARPNLGATLATAVHRAGHGPERTESLLHILTRISDDQLHRRLPAPVTRLLRDGITPDWGVLLHDLVQRPYRRDRVGLRWRDAFYLAAPEPRRT
>NZ_CP023747.1|WP_150478119.1|123417_124581_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MYTPARFLDLHVLQPVTAANLNRDADNDPKTISFGNTTRAFVSPQAWKRPIRLNVEQDLGEHAARTRMVPPLVARKLQEAQWPEELATFASAQIVHSAKKDGLQHNDQEGYRTQAMLYLPTDVIDDLVALCEKHRTELEEALAAHTPKKKIAPVLPTKDLAAHLTRRTASINLFGRMLAELPAGHVEAAVQMAPAFSAHQSDPQPDFFTAVEDLPQDGDFGSAHLQTAFLTTSLFYRFATINITDLHHNLGPAATADTVNALVELFVQHFILSMPGGKKTSTAPHTVPDVVHYAVRDRRSVSYGAAFEQPVTAAPQGGYTAPARQALADYAATISRLLGTRHLVAHGHTGTSAKPIKNLGAHHASFDDLAAACAAAATADLTPAGRP
>NZ_CP023747.1|WP_079162467.1|122611_123421_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTGLILRLAGLLQSSGERGVFHYRDTCAFPTRSSLIGMFAAAQGRPREHALDPYPHLKAPGDTTAPSHRDLTITIRIDQPGTLYRDFHTVGGGRPREQSLRTGDGTRRKPSASTLVSHRDYLTDAVFTLAVTGPAPLTRHIAETLERPRFGLFLGRRACLPDEPLVLNPDSPDPVQELLTRTPLTRDRPPGPTDTHLPTTFVWEHPPPDTDPTTPPDRESTSEPTNLTRHARRHLPRPLWMTTEPLPAHLYAGPRPIHALTTYMHGEPA
>NZ_CP023747.1|WP_043436675.1|121970_122615_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTSLTRIVPDPHHTAVRADLADVDSLHKTLMRLVPDHIGPTPRATAGLLFRTEPGPDTALLVQTAHTPDLAALPTHYGTARTIDLTPLLNALTPGRTMRYRITAAPTVARSAGNPTRHPVTGKRRGKITHLTGDDAIAWWQRRATAAGLEPVTVSSLPRPFPRTHLARSAPYFTLTQFDGLARITDTTHLTHALKNGIGRAKSYGAGLLSLAPA
>NZ_CP023747.1|WP_043436673.1|120384_121944_-|Mu-transposase-C-terminal-domain-containing-protein
MQHPPDHNALRAAAIHRLYTLEQSEQLTRTRIIGVADAFGVDPRTVDRWLANARANNGTYQPQGRTSFVLTPHMLDAVTRWRGNATAAWKELRAEGHPVPSLPTFHRATNRALTPGMRAGLRAGEKARRRYDVAGERERHHRNYAWETDHVEASVKVRIEGHIRKPWITFFVDCATSAICGLAISPQRPSREGVLVAIRDAILIDEHHGPFGGIPMYVRVDGGKEFLCTTVTQALGVLGTEIIALPPFTPEGKGNVEAVNGAIKITLFAGMPGYTHAPTLRGGKPVDPNQPLLHFEAFVDQVLTWVHHWNYENTPKSLGGQTPRQAWDADPALIDTVTADDLHTYTLERHGTPLTINNCGVRWRKRNYIADWMHGRVGEKVHLRYLPHHNHRVELYDPHTGRHLGPAVMAGQATRAQTLSLKQARRREADRLRARLQKAEKNRNERFAAATRPAPPVPLDAMPEEEALEHLRTLDGFDPTAEALPDLIQLPEPDAGLTQPLDPNTAPPPHPATHPKDQP
>NZ_CP023747.1|WP_043436670.1|119575_120388_-|ATP-binding-protein
MSTTPTTVPRPSQLPPPSQDHYLGLTGANAMATKAIAETKTRILKAIKHNAIVCIHGHVGLGKTFAVHNVLRRHAPETTVRLRYNNGANMNEIRTQLWRHLDLPGQPPQSVGPCDQQIQDALEADPRVLLIDEVQGLGTKALEYFRTLWGDDARRAAIVLVGSGNARQKILNNPALHSRILDWYQFSPLTPTEVESIIPAYQRIWSGAQPELILYTDDMAGHGSFRNWARITLLLHDALEDNPNLTLSKDLIRWALSRIDPTTRHTPQRG
>NZ_CP023747.1|WP_144401403.1|116468_118682_-|hypothetical-protein
MTALLAGSIAVPTAFSAPTAQAAEACRSGIPTYVHDVSGESGGVLRKYLDWDPLTGNAAGALLDTGETAPLETYSEFFTGGRGIIYVKTPEGALKTYKDNSATGGSMLTPVRDYGGNWNAYERMWSTGDNRIFALHQDGVLDVYAVANPSSGSGDITKVRTVPRNDPAVVAIAQADDVWSAGQVVYTLRRGVVDRYGEVKAWRYSEIGFGSPFPNGSTTVVTGVDIKTRVGWSPGPGTIYTVGDNPDYTGIATSYTGAAIMSVANPDVGAGIYGDVHADIASCLASPSPEIKPSVRPVPPETETPPKAVTDGSPDPSPQDPTQFSGEFVLGDGSPAAGLPVRVEALDVTSGSSDDEVQLITLGTTVTAPDGTWTVPLPPILPAIVKRAAAGNGGIVNAMASVNGKTSSGHMMRGTHMVTAAPAAAPATARALVAAAAEDGSEPSKMRPVTDDMRKEQAQPTVAQTNLSWASKDEEVSVDLLGDKPLPEYQSDTAQGPQGDPYVIDGVDTKSLAVTPMDGGCDKTSEKIIGNQIKYTTVAEGHAYWDAKATVDYDSKLSSSVEVAVKTGTKWTIEGSVALGSAMSDASGYTNKGPYFAKQWKVPIEYTKIREKWTCNYGRDTFYRYKIMGGKYKVPFGGAVGKSGKDVSNRDGSVNYSNSPKTHRAWVEAGSYFQISKNRSTKWSGSVSAFGVKLGASTQYDRDHKQRITAGNKKNARHDIWGKNDRISGKPGVFYSY
>NZ_CP023747.1|WP_144401402.1|115942_116443_-|hypothetical-protein
MLAGCSPAQEAVQAEPGSALATDGAQSSGTVGNEHTRVGEIWYFALPVPYNTSSKPIEITKAAVEHIPSGIKVLEYGAYDLNETEGLPVLAKEGGPYTPEFAKLKNYAAKPVKVPAGKESTVFYLAKMKITAPPKETARKCRFEYEQGGRAYIQTLDCELDLKVAE
>NZ_CP023747.1|WP_043436681.1|131785_131977_+|hypothetical-protein
MDQATGLRLVDTLIDVAGGPSSDGYACQVIAAINDPLPRPYPGVHEIPVDTDNRFFDHAPLSA
>NZ_CP023747.1|WP_158508299.1|132279_133074_+|DUF4231-domain-containing-protein
MTPDPYEEYRKAFAAFSVKEADLRAGKALQRIGWLILLGSLTLTGILGYTVIVGLWKANDGVTRWLSLIIVNILWIACACWLYRHHKSLAEKTNKFRDALQQRQTAAAQLPLETTPGLRVYREASLDVIAAYRTQASRNRRVHNSFQLVIITGSIVVSTLTAMNEGSNAALSIITSSLSALVGISAGVTGYFKFRERGTTSQSTADDIEKNYNASGFQLGDYKEMEETTRLVLYAETVEAIKEEQRKREIQLEQSTSRDERSAQ
>NZ_CP023747.1|WP_043436683.1|133070_133529_+|hypothetical-protein
MSGGREHAEPSRAEERELSLTTVRWLLAPRRQWRTRRLRAAHGPTLPYETAWCLVALADDVGNLPYVRRRTRPVPSVPPGVMVDVWAQLEPAEQQRRRAWLTRHSRTPLHLLRVPEELIELAGLHVTEWALPPDVPSISLVVQQQPRPKRTD
>NZ_CP023747.1|WP_043447800.1|134555_135764_-|HAMP-domain-containing-histidine-kinase
MRQRVVRVALTAVLVALVLLAVPLALAIRSSLYADQRDALERAALAAAVRVNPDYLQGDPAELPTAASGQRLGLYDPQLRLRAGTGPQSGGDVVRRALAGKVTRSSAGGELVAAVPVAHAEQVIGVVRASSAVAQVRGRVFAGWAALVGVAVVALTVAVLVARRQARALAVPLEDLSRHCRAVAEGDLAARAAPSTIIEIDQVARTHNDMLHSLSELLRRERDFTANASHQLRTPLTGLQLTLEAGLAQDDARPVLEEALAATRRLHETVEEVLRLSSSAGLPRRTALDRPVGELLARAEKRWHALLAKDGRRLELAVQDVPDDVRIPGGPATEILGVLLDNARAHGRGTVRVAVRDLDDALAFDVADEGAVDGDGVRLFERGYSGGGPGAAGIGLAFARDC
>NZ_CP023747.1|WP_043436688.1|135918_136578_+|hypothetical-protein
MTRVRTSAIVGLVLCAALTAGCSGSGSRSGSGSGTTSDNSASTPDRTSSAGSAPDAAAPTESNPPGDIPDNQAFVAYRPSGGFTGFTVKVPEGWARTTNGATTVFTDKLNRIQISAATVTTAPTVGSVTNTVVPQLRGQVSKFAHPKVSVVQRRAGTAVLLTYQGDSAADPVTGKVVRDAFERYAFYLQGHEVDLTLSGPVNADNVDPWRTVSDSFGWR
>NZ_CP023747.1|WP_052453889.1|136583_137324_+|ABC-transporter-ATP-binding-protein
MPVRSYDDALTARELYRFFRAGAEETLALRGVSLRVARGETVAVVGPSGAGKSTLLSCLAGLDEPSGGEVHVDGVRISHRPETERARLRARHIGVLLQTRNLLPHLSVRDNVRLAQGAVRGRPAASAEALLDRVGLGERRHALPRQLSGGELARAGLAVALANSPAVLLADEPTGELDGGTERLVLQMLRDRAKDGCAVLIVTHSAEAVRIADRVIRLDDGRTTEGAETGDQSFGRAAAEVHHVSG
>NZ_CP023747.1|WP_043436691.1|137310_138021_+|ATP-binding-cassette-domain-containing-protein
MSPADILIDCQDAALTFGRGPNAVVAVHGAGLRIRAGDRLAIVGRSGSGKSSLLHLLAGLEQPTSGTVTWPGLTGPRDIGLVFQGDSLIPALDVVENTALPLVLTGIPDDRARAAALAALALVDAAELADRLPEEISGGQAQRVTAARVLAQAPRVILADEPTGRLDHATGSRVLDALLTAADETGAALVITTHDPTVAARLTARRAMRDGRLASADDADTDRADADTAHSLGEPS
>NZ_CP023747.1|WP_043436693.1|138017_140663_+|ABC-transporter-permease
MISAWASGLARHRTGRLIAAMTGIALAVALVAALGSFLTASKATMTQRAVRSVAVDWQVEVQPGADPNAALSLVRKTPGVRSAVPVSLAHSSGFTATVQGSTQTTGPGMLLGLPGNYRTLFPGEIRSLTGSPTGVLLAQQTASNLHAAPGSTVSIKLPGTTDARKVRVDGVIDLPQADSLFQKVGAPTQSQPTAPPDNVLLLPAAQLASLTGGATSVTTQIHVARHAALPHDPAAAFTAVTRAAHNLEAKGAGSVLVGDNLGAALDSARQDALYAQILFLFLGVPGAVLAASLTAAVAGADGERRRQEQALLRLRGLAPRQIVSLAGLEAALVGVVGGLAGLGIAALTGRLAFGTASFGASAGTWIVWYVIAFVLGAMVAAGAVLVPALRDLRTVTVADTRRTARRTGSPWWMRIGLDFMLLIGSWLVFRASSGNQYALVLAPEGVPSISVSYWAFLGPALLWIGAALLLWRLTLLALTRGRPVLARLARPLTSALAGTTAAVLARRRRPLARSMVLLALAVSFAVSTSVFNSTYQQQAEVDARLTNGADVTVTEPPGMQTPPSAAGALKVSGVRHVEPLQHRFAYVGSDLQDLYGVRPDTITSATSLQDAYFSGGTAHQLMRRLAQRPDNLLVSAETVSDFQLSLGDTVNLRIQDAKTKALRTVSFHYAGIVKEFPTAPKDSFFVANASYIAKATGSDAVGAFLVDTGGSNQKAVAARLRGQLGTSATVTDLTQTRGTVGTSLTSVDLAGLTRIELAFAVLLAAGAGGLVLALGLAERRRTFAITTVLGATRRHLRGMVLTEALVLTVGGLTGGALIGWALSEMLVKVLTGVFDPPPDALAVPGSYLTLTAAAAMAAVLSAALNGVRRARRPAVEELRDL
>NZ_CP023747.1|WP_043436696.1|140699_141437_+|response-regulator-transcription-factor
MRTPPAADRGRLGVLIVEDDNTIGRHLETGLRSNDYATAWFRTGAGALTEAAQASYDVLLLNLGLPDMDGLDVARTLRARFPDLLIIILTARTDDIDVIAGLDAGADDYLVKPFSLTVLLARLRAHLRRRTTASPQPEPVTLGHLVLDETARRCTLHGADIPLRPKEFELLALLSRHAGEAVSRETLMAKVWDENWFGSTKTLDVTMAGLRRRLTAAAKSSPRPARLPQITTLRGHGYRLEQEPG
>NZ_CP023747.1|WP_043436702.1|143538_143844_+|hypothetical-protein
MDVMTDPKAMNLRFPDPGQRAAIAAAARQAGVSMQEYILSAAYDRATAVEQRFLEGFKASMARSGAVFAAEPSSIDASAEQRAIEQEVLRELEQQERGRAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_1

130323-130720

TypeI-E

Consensus_repeat	Method
CCGTAGAGTCCGCGCGAGCGGGAATGACCCG	CRISPRCasFinder
AGTCCGCGCGAGCGGGAGTGACCCG	PILER-CR
CCGTAGAGTCCGCGCGAGCGGGAATGACCCG	CRISPRCasFinder

5 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e

The CRISPR arrays of NZ_CP023747_1

>merge|NZ_CP023747|1|130323-130720|CRISPRCasFinder,PILER-CR,CRISPRCasFinder
GGGTAGAGTCCGCGAGAGCGGGAGTGACCCGAGCGCAGCGGCATCCACATCCAGGCCGACACCGTAGAGTCCGCGCGAGCGGGAATGACCCGGCACGCAGGCGACTGCCGCGGCCCTTTCTGCCGTAGAGTCCGCGCGAGCGGGAGTGACCCGTCACGCAACGGCCTGCCCAAGAGCACCACCGGGCAGGACCCGCGCAAGCGGGAGTGATTCATGGCGCTGCCACTACAGCGGCCGCGCCAGGTCGCAAAGCCCGCGCGAGCGGGAGTGATCCGTCGTCCTTGCAGGACGTGGGAGTTGCACGGTCGTAGAGTCCGCGCAAGCGGGAGTGATCCGATGGGCCTGGGCATCGCCCGCCGCCTGGCCACGTAGAGTCCGCGCGAGCGGGAGTGACTCAC

>NZ_CP023747|1|1|130323-130476|CRISPRCasFinder
GGGTAGAGTCCGCGAGAGCGGGAGTGACCCG	AGCGCAGCGGCATCCACATCCAGGCCGACA
CCGTAGAGTCCGCGCGAGCGGGAATGACCCG	GCACGCAGGCGACTGCCGCGGCCCTTTCTG
CCGTAGAGTCCGCGCGAGCGGGAGTGACCCGTCACGCAACGGCCTGCCCAAGAGCACCACCGGGCAGGACCCGCGCAAGCGGGAGTGATTCATGGCGCTGCCACTACAGCGGCCGCGCCAGGTCGCAAAGCCCGCGCGAGCGGGAGTGATCCG	TCGTCCTTGCAGGACGTGGGAGTTGCACGG
TCGTAGAGTCCGCGCAAGCGGGAGTGATCCG	ATGGGCCTGGGCATCGCCCGCCGCCTGGCC


>NZ_CP023747|1|1|130329-130658|PILER-CR
AGTCCGCGAGAGCGGGAGTGACCCG	AGCGCAGCGGCATCCACATCCAGGCCGACACCGTAG
AGTCCGCGCGAGCGGGAATGACCCG	GCACGCAGGCGACTGCCGCGGCCCTTTCTGCCGTAG
AGTCCGCGCGAGCGGGAGTGACCCG	TCACGCAACGGCCTGCCCAAGAGCACCACCGGGCAG
GACCCGCGCAAGCGGGAGTGATTCA	TGGCGCTGCCACTACAGCGGCCGCGCCAGGTCGCAAAGCC
CGCGCGAGCGGGAGTGATCCGTCGT	CCTTGCAGGACGTGGGAGTTGCACGGTCGTAGAGTC
CGCGCAAGCGGGAGTGATCCG

>NZ_CP023747|1|2|130567-130720|CRISPRCasFinder
	AGCGCAGCGGCATCCACATCCAGGCCGACA
CCGTAGAGTCCGCGCGAGCGGGAATGACCCG	GCACGCAGGCGACTGCCGCGGCCCTTTCTG
CCGTAGAGTCCGCGCGAGCGGGAGTGACCCGTCACGCAACGGCCTGCCCAAGAGCACCACCGGGCAGGACCCGCGCAAGCGGGAGTGATTCATGGCGCTGCCACTACAGCGGCCGCGCCAGGTCGCAAAGCCCGCGCGAGCGGGAGTGATCCG	TCGTCCTTGCAGGACGTGGGAGTTGCACGG
TCGTAGAGTCCGCGCAAGCGGGAGTGATCCG	ATGGGCCTGGGCATCGCCCGCCGCCTGGCC
ACGTAGAGTCCGCGCGAGCGGGAGTGACTCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043436702.1\|143538_143844_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436670.1\|119575_120388_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379165
NZ_CP023747.1\|WP_144401403.1\|116468_118682_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_052453889.1\|136583_137324_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP023747.1\|WP_043436683.1\|133070_133529_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436691.1\|137310_138021_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP023747.1\|WP_043436688.1\|135918_136578_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_079161935.1\|124793_125432_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP023747.1\|WP_079162468.1\|125431_126922_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP023747.1\|WP_079162467.1\|122611_123421_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NZ_CP023747.1\|WP_158508299.1\|132279_133074_+\|DUF4231-domain-containing-protein	unknown	unknown	gnl\|CDD\|379418
NZ_CP023747.1\|WP_144401402.1\|115942_116443_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_150478119.1\|123417_124581_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP023747.1\|WP_043447800.1\|134555_135764_-\|HAMP-domain-containing-histidine-kinase	unknown	unknown	gnl\|CDD\|223715
NZ_CP023747.1\|WP_043436696.1\|140699_141437_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|223816
NZ_CP023747.1\|WP_043436681.1\|131785_131977_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043436675.1\|121970_122615_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP023747.1\|WP_043436693.1\|138017_140663_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376899
NZ_CP023747.1\|WP_043436679.1\|127297_130171_-\|CRISPR-associated-endonuclease-Cas3''	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP023747.1\|WP_043436673.1\|120384_121944_-\|Mu-transposase-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043436670.1\|119575_120388_-\|ATP-binding-protein	gnl\|CDD\|379165	pfam13401, AAA_22, AAA domain.	3.23321e-15
NZ_CP023747.1\|WP_158508299.1\|132279_133074_+\|DUF4231-domain-containing-protein	gnl\|CDD\|379418	pfam14015, DUF4231, Protein of unknown function (DUF4231). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, archaea, eukaryotes and viruses. Proteins in this family are typically between 148 and 288 amino acids in length.	9.14884e-08
NZ_CP023747.1\|WP_052453889.1\|136583_137324_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.26402e-81
NZ_CP023747.1\|WP_043436691.1\|137310_138021_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	4.17345e-67
NZ_CP023747.1\|WP_079161935.1\|124793_125432_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	3.52132e-07
NZ_CP023747.1\|WP_079162468.1\|125431_126922_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	2.13197e-70
NZ_CP023747.1\|WP_043447800.1\|134555_135764_-\|HAMP-domain-containing-histidine-kinase	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	5.26084e-20
NZ_CP023747.1\|WP_150478119.1\|123417_124581_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	2.68916e-94
NZ_CP023747.1\|WP_043436696.1\|140699_141437_+\|response-regulator-transcription-factor	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.20686e-70
NZ_CP023747.1\|WP_079162467.1\|122611_123421_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	3.53317e-32
NZ_CP023747.1\|WP_043436675.1\|121970_122615_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	4.18474e-48
NZ_CP023747.1\|WP_043436693.1\|138017_140663_+\|ABC-transporter-permease	gnl\|CDD\|376899	pfam02687, FtsX, FtsX-like permease family. This is a family of predicted permeases and hypothetical transmembrane proteins. Buchnera aphidicola LolC has been shown to transport lipids targeted to the outer membrane across the inner membrane. Both LolC and Streptococcus cristatus TptD have been shown to require ATP. This region contains three transmembrane helices.	3.11809e-08
NZ_CP023747.1\|WP_043436679.1\|127297_130171_-\|CRISPR-associated-endonuclease-Cas3''	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.93297e-45
NZ_CP023747.1\|WP_043436673.1\|120384_121944_-\|Mu-transposase-C-terminal-domain-containing-protein	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	5.07525e-09

>NZ_CP023747.1|WP_043436679.1|127297_130171_-|CRISPR-associated-endonuclease-Cas3''
MGVIEDGRYDGVDRRPWGKLEFDRATLRMYSLLFHLIDVGAVAGVLWDRFLTPSQHKVISAGLNVPQRQARSLVCFLAAMHDIGKLIPYFQSSEPLAYVRLGEELLADTGPVVHVPHARASMHVGLHLLSELGFAVGGNDSPAVRAAQCLGGHHGRFLQLDVDGAASVQRVEATLGGPAWQDLRRRYTRLLWHLFGVDEAPGRVSVEAAVLITGLTMVADRVASQRRYWVPNADTPSFGAAEHHSRARRQAEKEVERLGLARFALDRVPFTTAHPGLEEPNALQRSVMEELPHLVAERGSGIAVVTDAMGTGKSVTALEMARIFNEHCGTQGVMWLLTATAAADQAYEVLDRYVRAHRPEYAPVTLVHHHSDLNEAYTGRCLSPADTSVLDGPPDDPFTDDQDDSFADDETEYGPGAAGPDRWLRGRDNALLAQYTVSTTDQAQMAVLPVRHSALRMLALSGKTVVIDEAHALDPFSQLQLLRLLQWLGALSCPVVVLSATMPASTATELVRAYLSGAGRTGLNGVSFAPGYPGWLFADAATAGVHRMSEPARVQQRAAQRRSARIRVRPVTYRRLGQADRSVEAGERLATIAEVLQPVIRHGGCAAVVCATVADAQDTYAYLRRMWTGPPDDLVLVHARVRGRRRQSTLGDLRHQLGPTGPRPGRRVFVTTSLLDVSLDIDVDLMVSDLASLARLLQRLGRLGRFTHLWTGQDRRPAWWDGDNSPALTVLHPVNSRGATALPPGWGTVEPAVALHETARLLPALEKEPLIVPDDVQALVEQVHGVTSGFAAETTRLQQMAVAHQTRTSRQEQLSAIHLVPPAKRVSSLADLHRQHLTTAQAATRPGLLPRRLLPCHRRADGTLTLDAAGMLPLPDQEHLSRRHLRSILEHSLSVPAAWVARTSARHHPPASWKQHPLLADIVLLPTDSVTRESEHRFGHHWLRMDEELGLQHRKQQ
>NZ_CP023747.1|WP_079162468.1|125431_126922_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MDVRTGRRYDQVGLRALFLDAHRIDDLALPHPPAASALLRIAVAVTARITGLDDPELTASQWNALRRSRLAEGRFDPDAVHAYFDQHAWNVFDPLRPWLQDPSLRTQCDHSTGINAFVPGRPAGNNLAWFSPHGHHTAEPVPTAEALQILLIHHYYGRAGTGTPRTLDGVTSKKQTSGPLRSSVSFHPLGRTLHETLLAGVPAFTGDDQPPDADACPWEKAAPPGPQGTSHRPVTWPGGQLTGLSRHAILLVPGHDGTTVTDAYITWATQQPKPITTDPYLAYRFTPKRKNVARRRSIHRADASRAWWRDLETLLLAPDEHGTHRRPAIFDTLNDLPEPARRSLRIRVHGFDQDSSKAVDRQWYTAITPPLLNWTQEHDPVKAQRIAECCREAEQVAQQLATVAKQAWDTATHSRTTQPPWANRALTRYWPKAETVFRRLLEEPDTAAPTAFADAAAAALRESTEAARIHHTSAARAVAHAVRDLYRRPTTPRKTA
>NZ_CP023747.1|WP_079161935.1|124793_125432_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MPTAAEHRASCDAFVAHIHLLCAEPGVRARLSRGRGRPVEECAPMDRYLSRRTAHRSGRRAYYTIASLIAMAGPQSHTPGVRPDNDPGPPSPENDPASLLVAPADSAPPPAAPDPAAWFARPNLGATLATAVHRAGHGPERTESLLHILTRISDDQLHRRLPAPVTRLLRDGITPDWGVLLHDLVQRPYRRDRVGLRWRDAFYLAAPEPRRT
>NZ_CP023747.1|WP_150478119.1|123417_124581_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MYTPARFLDLHVLQPVTAANLNRDADNDPKTISFGNTTRAFVSPQAWKRPIRLNVEQDLGEHAARTRMVPPLVARKLQEAQWPEELATFASAQIVHSAKKDGLQHNDQEGYRTQAMLYLPTDVIDDLVALCEKHRTELEEALAAHTPKKKIAPVLPTKDLAAHLTRRTASINLFGRMLAELPAGHVEAAVQMAPAFSAHQSDPQPDFFTAVEDLPQDGDFGSAHLQTAFLTTSLFYRFATINITDLHHNLGPAATADTVNALVELFVQHFILSMPGGKKTSTAPHTVPDVVHYAVRDRRSVSYGAAFEQPVTAAPQGGYTAPARQALADYAATISRLLGTRHLVAHGHTGTSAKPIKNLGAHHASFDDLAAACAAAATADLTPAGRP
>NZ_CP023747.1|WP_079162467.1|122611_123421_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MTGLILRLAGLLQSSGERGVFHYRDTCAFPTRSSLIGMFAAAQGRPREHALDPYPHLKAPGDTTAPSHRDLTITIRIDQPGTLYRDFHTVGGGRPREQSLRTGDGTRRKPSASTLVSHRDYLTDAVFTLAVTGPAPLTRHIAETLERPRFGLFLGRRACLPDEPLVLNPDSPDPVQELLTRTPLTRDRPPGPTDTHLPTTFVWEHPPPDTDPTTPPDRESTSEPTNLTRHARRHLPRPLWMTTEPLPAHLYAGPRPIHALTTYMHGEPA
>NZ_CP023747.1|WP_043436675.1|121970_122615_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MTSLTRIVPDPHHTAVRADLADVDSLHKTLMRLVPDHIGPTPRATAGLLFRTEPGPDTALLVQTAHTPDLAALPTHYGTARTIDLTPLLNALTPGRTMRYRITAAPTVARSAGNPTRHPVTGKRRGKITHLTGDDAIAWWQRRATAAGLEPVTVSSLPRPFPRTHLARSAPYFTLTQFDGLARITDTTHLTHALKNGIGRAKSYGAGLLSLAPA
>NZ_CP023747.1|WP_043436673.1|120384_121944_-|Mu-transposase-C-terminal-domain-containing-protein
MQHPPDHNALRAAAIHRLYTLEQSEQLTRTRIIGVADAFGVDPRTVDRWLANARANNGTYQPQGRTSFVLTPHMLDAVTRWRGNATAAWKELRAEGHPVPSLPTFHRATNRALTPGMRAGLRAGEKARRRYDVAGERERHHRNYAWETDHVEASVKVRIEGHIRKPWITFFVDCATSAICGLAISPQRPSREGVLVAIRDAILIDEHHGPFGGIPMYVRVDGGKEFLCTTVTQALGVLGTEIIALPPFTPEGKGNVEAVNGAIKITLFAGMPGYTHAPTLRGGKPVDPNQPLLHFEAFVDQVLTWVHHWNYENTPKSLGGQTPRQAWDADPALIDTVTADDLHTYTLERHGTPLTINNCGVRWRKRNYIADWMHGRVGEKVHLRYLPHHNHRVELYDPHTGRHLGPAVMAGQATRAQTLSLKQARRREADRLRARLQKAEKNRNERFAAATRPAPPVPLDAMPEEEALEHLRTLDGFDPTAEALPDLIQLPEPDAGLTQPLDPNTAPPPHPATHPKDQP
>NZ_CP023747.1|WP_043436670.1|119575_120388_-|ATP-binding-protein
MSTTPTTVPRPSQLPPPSQDHYLGLTGANAMATKAIAETKTRILKAIKHNAIVCIHGHVGLGKTFAVHNVLRRHAPETTVRLRYNNGANMNEIRTQLWRHLDLPGQPPQSVGPCDQQIQDALEADPRVLLIDEVQGLGTKALEYFRTLWGDDARRAAIVLVGSGNARQKILNNPALHSRILDWYQFSPLTPTEVESIIPAYQRIWSGAQPELILYTDDMAGHGSFRNWARITLLLHDALEDNPNLTLSKDLIRWALSRIDPTTRHTPQRG
>NZ_CP023747.1|WP_144401403.1|116468_118682_-|hypothetical-protein
MTALLAGSIAVPTAFSAPTAQAAEACRSGIPTYVHDVSGESGGVLRKYLDWDPLTGNAAGALLDTGETAPLETYSEFFTGGRGIIYVKTPEGALKTYKDNSATGGSMLTPVRDYGGNWNAYERMWSTGDNRIFALHQDGVLDVYAVANPSSGSGDITKVRTVPRNDPAVVAIAQADDVWSAGQVVYTLRRGVVDRYGEVKAWRYSEIGFGSPFPNGSTTVVTGVDIKTRVGWSPGPGTIYTVGDNPDYTGIATSYTGAAIMSVANPDVGAGIYGDVHADIASCLASPSPEIKPSVRPVPPETETPPKAVTDGSPDPSPQDPTQFSGEFVLGDGSPAAGLPVRVEALDVTSGSSDDEVQLITLGTTVTAPDGTWTVPLPPILPAIVKRAAAGNGGIVNAMASVNGKTSSGHMMRGTHMVTAAPAAAPATARALVAAAAEDGSEPSKMRPVTDDMRKEQAQPTVAQTNLSWASKDEEVSVDLLGDKPLPEYQSDTAQGPQGDPYVIDGVDTKSLAVTPMDGGCDKTSEKIIGNQIKYTTVAEGHAYWDAKATVDYDSKLSSSVEVAVKTGTKWTIEGSVALGSAMSDASGYTNKGPYFAKQWKVPIEYTKIREKWTCNYGRDTFYRYKIMGGKYKVPFGGAVGKSGKDVSNRDGSVNYSNSPKTHRAWVEAGSYFQISKNRSTKWSGSVSAFGVKLGASTQYDRDHKQRITAGNKKNARHDIWGKNDRISGKPGVFYSY
>NZ_CP023747.1|WP_144401402.1|115942_116443_-|hypothetical-protein
MLAGCSPAQEAVQAEPGSALATDGAQSSGTVGNEHTRVGEIWYFALPVPYNTSSKPIEITKAAVEHIPSGIKVLEYGAYDLNETEGLPVLAKEGGPYTPEFAKLKNYAAKPVKVPAGKESTVFYLAKMKITAPPKETARKCRFEYEQGGRAYIQTLDCELDLKVAE
>NZ_CP023747.1|WP_043436681.1|131785_131977_+|hypothetical-protein
MDQATGLRLVDTLIDVAGGPSSDGYACQVIAAINDPLPRPYPGVHEIPVDTDNRFFDHAPLSA
>NZ_CP023747.1|WP_158508299.1|132279_133074_+|DUF4231-domain-containing-protein
MTPDPYEEYRKAFAAFSVKEADLRAGKALQRIGWLILLGSLTLTGILGYTVIVGLWKANDGVTRWLSLIIVNILWIACACWLYRHHKSLAEKTNKFRDALQQRQTAAAQLPLETTPGLRVYREASLDVIAAYRTQASRNRRVHNSFQLVIITGSIVVSTLTAMNEGSNAALSIITSSLSALVGISAGVTGYFKFRERGTTSQSTADDIEKNYNASGFQLGDYKEMEETTRLVLYAETVEAIKEEQRKREIQLEQSTSRDERSAQ
>NZ_CP023747.1|WP_043436683.1|133070_133529_+|hypothetical-protein
MSGGREHAEPSRAEERELSLTTVRWLLAPRRQWRTRRLRAAHGPTLPYETAWCLVALADDVGNLPYVRRRTRPVPSVPPGVMVDVWAQLEPAEQQRRRAWLTRHSRTPLHLLRVPEELIELAGLHVTEWALPPDVPSISLVVQQQPRPKRTD
>NZ_CP023747.1|WP_043447800.1|134555_135764_-|HAMP-domain-containing-histidine-kinase
MRQRVVRVALTAVLVALVLLAVPLALAIRSSLYADQRDALERAALAAAVRVNPDYLQGDPAELPTAASGQRLGLYDPQLRLRAGTGPQSGGDVVRRALAGKVTRSSAGGELVAAVPVAHAEQVIGVVRASSAVAQVRGRVFAGWAALVGVAVVALTVAVLVARRQARALAVPLEDLSRHCRAVAEGDLAARAAPSTIIEIDQVARTHNDMLHSLSELLRRERDFTANASHQLRTPLTGLQLTLEAGLAQDDARPVLEEALAATRRLHETVEEVLRLSSSAGLPRRTALDRPVGELLARAEKRWHALLAKDGRRLELAVQDVPDDVRIPGGPATEILGVLLDNARAHGRGTVRVAVRDLDDALAFDVADEGAVDGDGVRLFERGYSGGGPGAAGIGLAFARDC
>NZ_CP023747.1|WP_043436688.1|135918_136578_+|hypothetical-protein
MTRVRTSAIVGLVLCAALTAGCSGSGSRSGSGSGTTSDNSASTPDRTSSAGSAPDAAAPTESNPPGDIPDNQAFVAYRPSGGFTGFTVKVPEGWARTTNGATTVFTDKLNRIQISAATVTTAPTVGSVTNTVVPQLRGQVSKFAHPKVSVVQRRAGTAVLLTYQGDSAADPVTGKVVRDAFERYAFYLQGHEVDLTLSGPVNADNVDPWRTVSDSFGWR
>NZ_CP023747.1|WP_052453889.1|136583_137324_+|ABC-transporter-ATP-binding-protein
MPVRSYDDALTARELYRFFRAGAEETLALRGVSLRVARGETVAVVGPSGAGKSTLLSCLAGLDEPSGGEVHVDGVRISHRPETERARLRARHIGVLLQTRNLLPHLSVRDNVRLAQGAVRGRPAASAEALLDRVGLGERRHALPRQLSGGELARAGLAVALANSPAVLLADEPTGELDGGTERLVLQMLRDRAKDGCAVLIVTHSAEAVRIADRVIRLDDGRTTEGAETGDQSFGRAAAEVHHVSG
>NZ_CP023747.1|WP_043436691.1|137310_138021_+|ATP-binding-cassette-domain-containing-protein
MSPADILIDCQDAALTFGRGPNAVVAVHGAGLRIRAGDRLAIVGRSGSGKSSLLHLLAGLEQPTSGTVTWPGLTGPRDIGLVFQGDSLIPALDVVENTALPLVLTGIPDDRARAAALAALALVDAAELADRLPEEISGGQAQRVTAARVLAQAPRVILADEPTGRLDHATGSRVLDALLTAADETGAALVITTHDPTVAARLTARRAMRDGRLASADDADTDRADADTAHSLGEPS
>NZ_CP023747.1|WP_043436693.1|138017_140663_+|ABC-transporter-permease
MISAWASGLARHRTGRLIAAMTGIALAVALVAALGSFLTASKATMTQRAVRSVAVDWQVEVQPGADPNAALSLVRKTPGVRSAVPVSLAHSSGFTATVQGSTQTTGPGMLLGLPGNYRTLFPGEIRSLTGSPTGVLLAQQTASNLHAAPGSTVSIKLPGTTDARKVRVDGVIDLPQADSLFQKVGAPTQSQPTAPPDNVLLLPAAQLASLTGGATSVTTQIHVARHAALPHDPAAAFTAVTRAAHNLEAKGAGSVLVGDNLGAALDSARQDALYAQILFLFLGVPGAVLAASLTAAVAGADGERRRQEQALLRLRGLAPRQIVSLAGLEAALVGVVGGLAGLGIAALTGRLAFGTASFGASAGTWIVWYVIAFVLGAMVAAGAVLVPALRDLRTVTVADTRRTARRTGSPWWMRIGLDFMLLIGSWLVFRASSGNQYALVLAPEGVPSISVSYWAFLGPALLWIGAALLLWRLTLLALTRGRPVLARLARPLTSALAGTTAAVLARRRRPLARSMVLLALAVSFAVSTSVFNSTYQQQAEVDARLTNGADVTVTEPPGMQTPPSAAGALKVSGVRHVEPLQHRFAYVGSDLQDLYGVRPDTITSATSLQDAYFSGGTAHQLMRRLAQRPDNLLVSAETVSDFQLSLGDTVNLRIQDAKTKALRTVSFHYAGIVKEFPTAPKDSFFVANASYIAKATGSDAVGAFLVDTGGSNQKAVAARLRGQLGTSATVTDLTQTRGTVGTSLTSVDLAGLTRIELAFAVLLAAGAGGLVLALGLAERRRTFAITTVLGATRRHLRGMVLTEALVLTVGGLTGGALIGWALSEMLVKVLTGVFDPPPDALAVPGSYLTLTAAAAMAAVLSAALNGVRRARRPAVEELRDL
>NZ_CP023747.1|WP_043436696.1|140699_141437_+|response-regulator-transcription-factor
MRTPPAADRGRLGVLIVEDDNTIGRHLETGLRSNDYATAWFRTGAGALTEAAQASYDVLLLNLGLPDMDGLDVARTLRARFPDLLIIILTARTDDIDVIAGLDAGADDYLVKPFSLTVLLARLRAHLRRRTTASPQPEPVTLGHLVLDETARRCTLHGADIPLRPKEFELLALLSRHAGEAVSRETLMAKVWDENWFGSTKTLDVTMAGLRRRLTAAAKSSPRPARLPQITTLRGHGYRLEQEPG
>NZ_CP023747.1|WP_043436702.1|143538_143844_+|hypothetical-protein
MDVMTDPKAMNLRFPDPGQRAAIAAAARQAGVSMQEYILSAAYDRATAVEQRFLEGFKASMARSGAVFAAEPSSIDASAEQRAIEQEVLRELEQQERGRAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_3

479145-479302

Orphan

Consensus_repeat	Method
TCGTGGTCGTGGTGTGCGGGGGA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP023747_3

>merge|NZ_CP023747|3|479145-479302|CRISPRCasFinder
TCCACGTGGTGGTGGGCGTGGGCGGTGCCATCCTGCGCCGTCGTCTCGTGGTCGTGGTGTGCGGGGGAATCCCCATGCCCATGCCCATGCTCGTGGTCGTGGTCGTGGTGTGCGTGGGAGTGCCCATGCCCGTGCTCGTGGTCGTGGTGTCCGTGGGA

>NZ_CP023747|3|4|479145-479302|CRISPRCasFinder
TCCACGTGGTGGTGGGCGTGGGC	GGTGCCATCCTGCGCCGTCGTC
TCGTGGTCGTGGTGTGCGGGGGA	ATCCCCATGCCCATGCCCATGC
TCGTGGTCGTGGTCGTGGTGTGC	GTGGGAGTGCCCATGCCCGTGC
TCGTGGTCGTGGTGTCCGTGGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043437168.1\|483434_484523_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP023747.1\|WP_043437161.1\|477417_478698_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340887
NZ_CP023747.1\|WP_052453954.1\|466967_468527_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187556
NZ_CP023747.1\|WP_043437152.1\|469476_470823_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043437155.1\|473061_473298_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043437172.1\|486672_487476_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|237189
NZ_CP023747.1\|WP_043437175.1\|489152_490223_+\|family-43-glycosylhydrolase	unknown	unknown	gnl\|CDD\|350141
NZ_CP023747.1\|WP_043437173.1\|487611_489093_+\|glycoside-hydrolase-family-76-protein	unknown	unknown	gnl\|CDD\|367601
NZ_CP023747.1\|WP_079162481.1\|475883_477410_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224094
NZ_CP023747.1\|WP_043437153.1\|471548_472754_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP023747.1\|WP_043437159.1\|474009_475515_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173855
NZ_CP023747.1\|WP_043437158.1\|473396_473936_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP023747.1\|WP_043437163.1\|479754_480573_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_052453955.1\|471074_471452_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_052454508.1\|481549_482698_+\|epoxide-hydrolase	unknown	unknown	gnl\|CDD\|377658
NZ_CP023747.1\|WP_043437171.1\|485911_486547_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP023747.1\|WP_043437169.1\|484694_485915_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP023747.1\|WP_043437148.1\|465432_466806_+\|deoxyribodipyrimidine-photo-lyase	unknown	unknown	gnl\|CDD\|223492
NZ_CP023747.1\|WP_043437165.1\|480837_481431_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225767
NZ_CP023747.1\|WP_043437167.1\|482751_483438_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043437168.1\|483434_484523_-\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.86351e-11
NZ_CP023747.1\|WP_043437161.1\|477417_478698_+\|MFS-transporter	gnl\|CDD\|340887	cd17329, MFS_MdtH_MDR_like, Multidrug resistance protein MdtH and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli MdtH and similar multidrug resistance (MDR) transporters from bacteria and archaea, many of which remain uncharacterized. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtH confers resistance to norfloxacin and enoxacin. MdtH-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	7.94571e-73
NZ_CP023747.1\|WP_052453954.1\|466967_468527_+\|SDR-family-oxidoreductase	gnl\|CDD\|187556	cd05245, SDR_a2, atypical (a) SDRs, subgroup 2. This subgroup contains atypical SDRs, one member is identified as Escherichia coli protein ybjT, function unknown. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif consensus that generally matches the extended SDRs, TGXXGXXG, but lacks the characteristic active site residues of the SDRs. This subgroup has basic residues (HXXXR) in place of the active site motif YXXXK, these may have a catalytic role. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	2.19601e-142
NZ_CP023747.1\|WP_043437148.1\|465432_466806_+\|deoxyribodipyrimidine-photo-lyase	gnl\|CDD\|223492	COG0415, PhrB, Deoxyribodipyrimidine photolyase [DNA replication, recombination, and repair].	1.22821e-122
NZ_CP023747.1\|WP_043437172.1\|486672_487476_+\|SDR-family-oxidoreductase	gnl\|CDD\|237189	PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	1.95791e-77
NZ_CP023747.1\|WP_043437175.1\|489152_490223_+\|family-43-glycosylhydrolase	gnl\|CDD\|350141	cd18820, GH43_LbAraf43-like, Glycosyl hydrolase family 43 proteins similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans GbtXyl43B. This uncharacterized glycosyl hydrolase family 43 (GH43) subgroup belongs to a subgroup which includes enzymes with beta-xylosidase (EC 3.2.1.37), alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities, similar to Lactobacillus brevis alpha-L-arabinofuranosidase LbAraf43 and Geobacillus thermoleovorans IT-08 beta-xylosidase / exo-xylanase (GbtXyl43B). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	4.00887e-101
NZ_CP023747.1\|WP_043437173.1\|487611_489093_+\|glycoside-hydrolase-family-76-protein	gnl\|CDD\|367601	pfam03663, Glyco_hydro_76, Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.	1.36661e-41
NZ_CP023747.1\|WP_079162481.1\|475883_477410_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.52455e-47
NZ_CP023747.1\|WP_043437153.1\|471548_472754_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.85704e-16
NZ_CP023747.1\|WP_043437159.1\|474009_475515_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173855	cd08490, PBP2_NikA_DppA_OppA_like_3, The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	1.97112e-154
NZ_CP023747.1\|WP_043437158.1\|473396_473936_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.13787e-13
NZ_CP023747.1\|WP_043437171.1\|485911_486547_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.6458e-68
NZ_CP023747.1\|WP_043437169.1\|484694_485915_+\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	1.23834e-57
NZ_CP023747.1\|WP_052454508.1\|481549_482698_+\|epoxide-hydrolase	gnl\|CDD\|377658	pfam06441, EHN, Epoxide hydrolase N-terminus. This family represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (EC:3.3.2.3) comprise a group of functionally related enzymes that catalyze the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarization of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites which arise during the biotransformation of foreign compounds. This family is often found in conjunction with pfam00561.	1.53776e-40
NZ_CP023747.1\|WP_043437165.1\|480837_481431_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|225767	COG3226, COG3226, Uncharacterized protein conserved in bacteria [Function unknown].	5.62044e-24
NZ_CP023747.1\|WP_043437167.1\|482751_483438_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	1.15349e-88

>NZ_CP023747.1|WP_043437161.1|477417_478698_+|MFS-transporter
MADVFSRLLTKRPGTGRRRPPHKPIWKHLSPLLRLLILTQLAFNIGFFAVLPFLADHLGTAIGMAGWTVGLVLGLRTFSQQGLFVVGGRLIDRYGVRPAVLGGCVLRIAGFLWLGLAKETWAVIGAVLLIGFAAALFSPAVESEVARQAVVWEEEGNGSRTRVLALFSAAGQAGAFVGPLLGGLLLAVDFRTACLAGAGVFVLVLAGHAWLMPRHIPGRTRSREGSGVRELLRHRRFLALCCAYGSYLLAYNQLYLALPDEVERATGSQAPLAWLFALSSLLVVFAQLPVARWASDRLDLRRSMAAGLLLVAAGFAVVAAARPAGWTGLAGLLPAAGYVVLLTLGQMLIVPAARAWVPDLAKEGRIGLYTGALSSVSGLIVLLGSSATGSLLGMGLPPAVPWLILATVPALTVALLPRGPGSAPVR
>NZ_CP023747.1|WP_079162481.1|475883_477410_+|ABC-transporter-permease-subunit
MAGALVVAAVTVGVVCARTLRPGSRGQLGGRRPGGTGSAMLAALPEFLVASVLASVIGVQLGWLPALGWYGPRWMLLPSLALGLPVGAVLGRMLDDLLPAAFTEPWALAAAARGVPPTSLVRKALRRCAPALLPNLGLFMVGLTGGSVAVEQIFDIPGLGRLTLRAALAQDLPVLQTGTLMLMILATAATLLARTGMRGLIGPALRDGALHSLHRPTQPAPRFTPLVYGLLLAAVIALGLPRDPLALDTTARLQAPSAAHPFGTDALGRDVLARIAHGAPNTLGIALAVSAVALVGGVLFGLLPRLSGPLVDTVNSVPPVLAALLVTGVAGGGPWTPALAVAVVAWSPLAAHTSALLQQERATVHLTATRAFGAGPGYLFWHELLPAVLPPVVRHALLRLPGIALSLAALGFLGLGSQPPSPEWGLLLAENQPYVERAPWTVLAPATVLALLGALAVTAAGGARLPRPRPWPKRRPVRRGGPGPAAPQPEPTRHTALTSSPTGTPRRI
>NZ_CP023747.1|WP_043437159.1|474009_475515_+|ABC-transporter-substrate-binding-protein
MRSPRPRLIAGLLLAPLLSGCFSSAGNDSSSDSRDSGKERRLRVALAFPPAENYSPYGQDAFDLSRLGVTEGLTRLDANGSAVPGLAESWSSDKSGKNWVFTLRDAKFQDGTDVTAEAVASALTHTAGADPAPSAVSGVKLTAEAVGDNRVEVSTAEADPVLPLRLSNPSLAVFSSKAYGKDGKVNPVGTATGPFELTRITGATAASLDRFDDYWGGRAQASGVDAKFVSDGTARANALRTGDVDIAEAIPVAQVTALDKNTVHEVDTARNTSLYLNTRTGVFKDAGLRAAARKAVDASAVAEGVYEGYAEPAQGLYGPALSWAAGKRTEPTGRAKAADPQGRSITLATYNDRPELPEAAQVLQQQLKKAGFTVKLEVRAYARLESDLLAGKFDASVASRNMMLDTGDPVTVLAGDYTCEGSYNLSRLCDKSVDRLVAAAQTESDPVKRQDAAMKAEAAILGTDAVIPLVHLKVVTGVGASVKGTLLDPYERDLVGIGTRL
>NZ_CP023747.1|WP_043437158.1|473396_473936_+|GNAT-family-N-acetyltransferase
MRSYCIRTATAADLDGARAVMLDTVYRDFGTGYVPRWHADIIDPESFYLTSSRHTLLVAVDERDGTVVGTAALDARGPEHPPNPRWLAERYPSGETAQLRRVYIRPEHRRRGLARRLVDGLMDFARADGGYRSVYLHTYPHSPGAMGLWQTLGKVVCDEREEVPGGGSGVVHFEIPFTK
>NZ_CP023747.1|WP_043437155.1|473061_473298_+|hypothetical-protein
MAVCEVCSNDYEMAFEVRTADGTHTFDSLECAAQRIAPTCDNCGCRILGHGLQATDGQFFCCAHCARRHGHAQLVDHA
>NZ_CP023747.1|WP_043437153.1|471548_472754_-|MFS-transporter
MNVGVQRGAIAAVQVLGLAVWFSISAVVPSLRIDWGLTAGGAVWLTASVQFGFVAGALASTALNLADRIPPQRLLAASAAAAAACTVVLALFVDQLAAAVPLRFLTGMFLAGVYPIGMKLMASWAGSAGRGMTMGVLIAALTLGSTFPHLIAGMGVLPWRGVLLAAAGAGLLGSVTALAFVRLGPHAAPSAPVRNARYALTMFTERGPRLASLGYFGHMWELYALWTWIPSFLLATDAAEGLPVSVETAVFLTMGLGGVIGCLLGGWGADRFGRPSAALTALVLSGLCCLLSPFLFHASPAILLAFCTLWGAAVIADSGVFSTSLSEVADQRYVGTALTAQTAIGFALTAVSIQLTPLVAEATGWRYAFLLLAPGPLAGALAMRALGSRARPMVLSPQGNA
>NZ_CP023747.1|WP_052453955.1|471074_471452_+|hypothetical-protein
MLRRLYTEVGNGGFGPESGLASLTDGNRTPFHPVDWPSAVRTHERQRLQGLPASWLHLTSGGCSMEWYVSLLAVGNPVLLHDAGGWDPTWGRRPHDGLRHASHSLRRWLWTWANRGNVWDDVLSR
>NZ_CP023747.1|WP_043437152.1|469476_470823_-|hypothetical-protein
MRADSVRRALRLGACTTLAAGLVTLGLTTAPAFAETEPETDQLWITAPYEPTLPLGIDGGAPLIRTLDVRLNHDNDHIRVTDGRLTVDASGIAGVAEITWPDNCTPSGATAVCDVPEVPVTGNTGGEVRLKVRAADGAAVGARGRITFEATATGGSDGTLTAPRDSFGTTVTVASGPDLALTAGDDIEHARPGSRQTLPFTLTNHGNETAHGFTIRVTASYGVRYVNRYDACVYTTSSGDAYAPMSYANCTFDQDLAPGASFELPEPLRIALNRHALQERVDILAQPVGATDLGGYDDYVALQIGADNTADFSVTGAAVTGAAGETVTASLTFRNNGPGWLGNPVSGDPVAVVRLIVPPGTTVTGVPEGCLPRALSGDAYYQGRTGAPRYDCRLPYWVLENTEHSFAFKLRIDTVVPSATGEVSIHPPFGEFRHDPDLTNNTAVLTVN
>NZ_CP023747.1|WP_052453954.1|466967_468527_+|SDR-family-oxidoreductase
METTADRPLCLVTGASGYIGGRLVPELLAAGFRVRCLARSPGKLRDHPWADQVEVVRGDVTDPASVGAAMREVAVAYYLVHAIGTGRGFEDTDRESARVFGAQAADTGVRRIVYLGGLAPAGVPERELSPHLRSRSEVGRILLESGVPTTVLRAAVIIGSGSASFEMLRYLTERLPVMVTPTWVRTRIQPVAVRDVLRLLVGSAQMPSDVNRTFDVGGPDVLTYQDMMVRYAAVAGLPRRVILPVPVLTPRLSSYWVGLVTPVPASIARPLTESLRHEVVCRENDITRYVPDPPGHPIGFDEAVRLALKRVQDAEVATRWSSASVPGAPSDPLPTDPDWAGGSLYTDLRERTVDAPPEALWRVIEGIGGENGWYSFPLAWSVRGIADRLVGGVGMRRGRRDAHRLRVGDSVDFWRVEEIEPGRLLRLRAEMRLPGLAWLEMRAGVDDRGRTRYRQRALFHPHGLLGQAYWWSVSPFHAVVFGGMARNIARTAEQAGGHGPGHGAPSADRTASPTVRPTR
>NZ_CP023747.1|WP_043437148.1|465432_466806_+|deoxyribodipyrimidine-photo-lyase
MRTSIVVFTCDLRLSDHPPLRAALRGGRRVVPLFVRDRSVDAAGFAAPNRLAFLADCLGDLDARLRQRGGRLVLREGETVMEVCRVATEADAEEVHMAGDVSAFAIARERRLRRALEAEGRRLYVHDTVSTAVAPGAVTPASSDHFAVFTPYYRRWSAQGLRDVLDAPRAITVPEEVGSASLPERGEVSGVSPGLCAGGETEGRRRLAAWLRSGVDAYAERHDDLAGDATSRLSPHLHFGTLSPVEVVYRAGRAGGAGAEAFVRQIAWRDFNRQVLAARPDAAVRDYRTRHDRWRRGKRAEADAEAWRDGRTGYPVVDAAMRQLRQEGWMHNRGRLLAASFLTKTLYIDWRVGARHFLDLLVDGDVANNQLNWQWMAGTGTDTRPNRVLNPVAQGKRYDPDGSYVRRWVEELADVKGAVVHEPWRLPAQERSRTGYPEPVVSLAEGLARFKQARDRA
>NZ_CP023747.1|WP_043437163.1|479754_480573_-|hypothetical-protein
MSLHILARSRAQVRPTPGTLLAGAALAVFIAFAGPVPSAAAHPFGPPSTAEVSVQGSRLLLAWNTDKLDWVTLGQSLGIFKGQGGSGSSPGLSFEQRLQRSPAVRAYLLEHIAVAQAGRPCRGTVVGEMKDFLAQGAQLAFDCPAPGVEVDVTISALTDLHPAYRTMLTSQGPAEPQQALFTSAEPTTHIRFTASGGGVRRTVAVFSVGTLAAALAIGGWVFWRSRRRTAAPSGDTTITGHGFPAVSPATPNGPGGEAVTTADTGTGTRSNA
>NZ_CP023747.1|WP_043437165.1|480837_481431_+|TetR-family-transcriptional-regulator
MNEVELGETSGARRVRRHDPERRTRILDAALDVLVAEGAAGITHRKVAARADVPLGSVTYHFSSLAELQAQAFDWYVEQRTAEFESLFTEVEAREDLIEVLVELVQGGPSRRRSAVLGFELHLAALRDPALRALTQKWTRDSRAVLSRFTGPEIAGRLDALLEGLIMHALLATEPEPREATHAAIAQALPPLTGRDT
>NZ_CP023747.1|WP_052454508.1|481549_482698_+|epoxide-hydrolase
MIAVSDDELNELRARLRATRWAEPWPVSGWEAGTDPGELRRLAAYWADGYDWRAHEAAINALPSRFSDLGGTPVHYLRFDGEHPDALPIVLTHGWPSSFLELTALADRLATPSRYGGAAEDAFTVIVPSLPGFAFSPQRPALTDAEQTHDLWHRLMHDELGFERYAAHGGDLGAGVTSRLAEAHPEALVGIHLTAVAAPAAYDAAGLTPQEQDHLDSVAAWLAQEGGYQHQQSTRPLTLSQGLADSPTGLLAWLVEKYRAWSDCGGDLSARFSDDFLLTQASLYWFTGTISTSFRPYYEYARGLTRRVERVDVPTAVALFPADLSRPPRSWAERTYNVTRYTGMPRGGHFAAHEEPGLLAHDITEFFRDHRPPLSPVPRPGA
>NZ_CP023747.1|WP_043437167.1|482751_483438_-|ABC-transporter-ATP-binding-protein
MSLDLTDITLTYPDGDTRLTALDRVSLKVPKGSLTAVVGPSGSGKSSLLAVAATLITPDAGTVTLDGTSTTGLSRGELTDLRRHKIGIVFQQPNLIASLTAAEQLQVMAQLDGRKPRTARNRALELLESVGLADQADRRPHQLSGGQRQRVNIARALMNGPTVLLVDEPTSALDHERGAAVIDLITRLTHQQCAATVLVTHDRTHLTAVDRIAEVHDGRLSLPAAVAT
>NZ_CP023747.1|WP_043437168.1|483434_484523_-|ABC-transporter-permease
MFVAWRDLKFAKGRFTLMGTVIVLITLLVGLLSGLTAGLARQNVSAITGLPADKIAFQAPSGGQDLSYTDSTVTEQQWQQWSRTPGVEGAEPLGISTVKATAGDKGTAVSAFGVRPGSRLAPASGTIDNASVVLSTGAAAGLGVKAGDMLTLAGQRVKVAAVRGDAWFSHTPVVWTSLHTWQKTAPPTDGKEGPTATVIALNITSEADAAAADQQAGTRTLSIDDSLSAIGSYTSENGSLQLMRGFLFAISALVIGAFFTVWTIQRSSDVAVLKALGASTANLLKDALGQAVVLLAGGTLVGTGIAAAVGALVAGSAVPFLLTPATVLLPAAVTITLGALGAALSIRRITSVDPLTALGSAR
>NZ_CP023747.1|WP_043437169.1|484694_485915_+|sensor-histidine-kinase
MNTAAPVLTPTTRALAWCLHLLVIGLLALAAGRALTAGRPDAGVIVAVATACGLVYAAGPLLPRIRSSRPAAAWWLAAVGAVWLVLLALSPDAVWVAFPLYFLQLHLLPRRVGLAAVAATAAAAIAGFAAHQHSFSPAMAIGPALGAAVAVAVVWGYQALYRESEHRRRLIEELTAARADLAAAQHTAGVLAERERLAREIHDTLAQGLSSIQLLLRAAERSLPHAPENAARYVDQARQAAVDDLAEARRFVAALTPPALEGTTLADALERLCATTSARHRLTARFHLTGDPAPLATTHEVALLRIAQSALANTVRHAEATTAEVTLGYLGDQVTLDVVDDGRGFDPDRLPAPGPETGGFGLPAMRARMRALGGTLFVTSAPGQGAALAARIPLIPPAETEPEARP
>NZ_CP023747.1|WP_043437171.1|485911_486547_+|response-regulator-transcription-factor
MTDAPIRLLLADDHPVVRAGLRAVLETEPGLVVVAEAATAEDAVTRAAEGDIDVVLMDLQFGKGMGGAEATARITARSHAPRVLIVTTYDTDADTLPAIEAGATGYLLKDAPPEDLATAVRTAAAGRTTLAPTVADRLMNRLRTPGTSLTRRETEVLALVAEGLSNQAVGNRLHLTEGTVKSHLARIYVKLDVDSRTAAVATATELGLIRR
>NZ_CP023747.1|WP_043437172.1|486672_487476_+|SDR-family-oxidoreductase
MTTNADHDQPACGPGSPAGRPLALITGVGRTVGIGAGIAGRLAAAGWDIAFTYWTPYDDRMSWGSEPGATEAIGRALAEHGASTIAIEADLADPDTPARVFDEVGQRMGRVTALVMSHCESVDSGLLDTTVESFDRHFAVNARATWLLIREFGRRFAAERGTGRIVSLTSDHTVGNLPYGASKGALDRITLAAAHELAHLGVTANVINPGPVDTGWMLEEVREHCVRSTPLGRLGTPQDTAHLVAFLCSKEGGWINGQLLMSNGGLA
>NZ_CP023747.1|WP_043437173.1|487611_489093_+|glycoside-hydrolase-family-76-protein
MTPVRRSRRARLLAGGAAAFALALLAGLAPQSASAAGTAVTATVCNRYCDARDPALSPGDRVPVTAALYGRSIALHLDDNDAMGWASIDNGDPGDEVWLDRSFDGGRTWSSGSKLGDTTVPSGQRGWRTLMYNVDDWNNQGVGALRACGKAGDRAEIACTAWARVTWNAGDRRTAAATGLMAFYNNSTGLFDTTGWWNSANALTAVIDNIRVSGMGSYSYAISRTYDRNLNAQGGQFRNEYIDDTGWWGLAWIAAYDLTGDSRYLNTARADADHMAAYWDGTCGGGVWWSTAKTYKNAIANSLYIQLSAALHNRVPGDTTYLDRARAGWSWFQGTGMINGSNLVNDGIDLSTCRNNGQPVWSYNQGVLLGALTELNRATGDGALLTRARQIADAATTNSSLHTADGILRDPCESGDCGGDGPSFKGAHVRGLGKLNAALPDHPYTTYLRRQADRAHTSDRNALDQYGLRWSGPVDKLDAARQQSALDLLDAAP
>NZ_CP023747.1|WP_043437175.1|489152_490223_+|family-43-glycosylhydrolase
MKALRGLYSAVVFALAAVLAAAISLTSVGPARASQTALRAADPSVIRVGSTYVSVQSTGAGIAVRQAASTDTLAAAPARQVWSDTRGRGEVWAPELVRDGGRYYIYFTAGVGANHRMFVISSASPDSGYTAETQLALPDDKWAIDGTMFTFSGQRWFVWSGWEGDTDVEQNLYIARMSSPTTPTGARYIISQPRESWERVVGNPFINEGPEAIKDPDGRLHIVYSANGSWSDRYCLADLRLRSGGDPTYVWDWYKSNGCLFGSDAATMMPGWDPTLYVNGPGHHSFVLLDGDIATSPPAGPTFPLMFHAVPKGTPYTWDNRYWYTGTFCWWGGVTYSRANVPGPNTDTGWGLKFFE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_4

1960127-1960826

TypeI-E

Consensus_repeat	Method
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CRISPRCasFinder
NNNNNNNNNNNCGGTTCACCTCCGCTCGCGCGGAGAGGAC	CRT
GTCCTCTCCGCGCGAGCGGAGGTGAACCG	PILER-CR

11 spacers

cas3,cas8e,cse2gr11,cas7,cas5,cas6e,cas1,cas2

The CRISPR arrays of NZ_CP023747_4

>merge|NZ_CP023747|4|1960127-1960826|CRISPRCasFinder,CRT,PILER-CR
CAATTCACCTCCGCTCGCGCTGAGAGGACCTCTTCGCGACCGCGCTGATAGCCCGGCAGAACGGTTCACCTCCGCTCGCGCGGAGAGGACAGCTCCTGCACGCGGACGGGCGCCCGCACCTCCGGTTCACCTCCGCTCGCGCGGAGAGGACACCGTGCGGGCGGGCGCTCATGCCGCCACCTGCGGTTCACCTCCGCTCGCGCGGAGAGGACCCCTGTGCCATGCGGGCGACGACGGCCCAGTTCGGTTCACCTCCGCTCGCGCGGAGAGGACTCTTTCGCTGCCTCACCCGCGCGCGTCTGTGGCGGTTCACCTCCGCTCGCGCGGAGAGGACCCGCCCGGGAACTACGGCAGGTGATGACGGACCGGTTCACCTCCGCTCGCGCGGAGAGGACTGCCTCATCGACCGACTCTTTGACGTCGAAGACGGTTCACCTCCGCTCGCGCGGAGAGGACGGGCGTCCGGAGTTGCTGCCGGGGCTGTACACCGGTTCACCTCCGCTCGCGCGGAGAGGACACGCTGGTCATCCCGAAGACTCACGTGGAGGACGGTTCACCTCCGCTCGCGCGGAGAGGACCGGCCGTGGCCGACCAGCCAGATCTCCCCCTTCGGTTCACCTCCGCTCGCGCGGAGAGGACGCGCACCGCCCCCGTCCTCAAGCACTGGCTGGCGGTTCACCTCCGCTCGCGCGGAGAGGAC

>NZ_CP023747|4|5|1960127-1960826|CRISPRCasFinder
CAATTCACCTCCGCTCGCGCTGAGAGGAC	CTCTTCGCGACCGCGCTGATAGCCCGGCAGAA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	AGCTCCTGCACGCGGACGGGCGCCCGCACCTC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	ACCGTGCGGGCGGGCGCTCATGCCGCCACCTG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCCTGTGCCATGCGGGCGACGACGGCCCAGTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TCTTTCGCTGCCTCACCCGCGCGCGTCTGTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCGCCCGGGAACTACGGCAGGTGATGACGGAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TGCCTCATCGACCGACTCTTTGACGTCGAAGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GGGCGTCCGGAGTTGCTGCCGGGGCTGTACAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	ACGCTGGTCATCCCGAAGACTCACGTGGAGGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CGGCCGTGGCCGACCAGCCAGATCTCCCCCTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GCGCACCGCCCCCGTCCTCAAGCACTGGCTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC

>NZ_CP023747|4|1|1960127-1960826|CRT
CAATTCACCTCCGCTCGCGCTGAGAGGAC	CTCTTCGCGACCGCGCTGATAGCCCGGCAGAA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	AGCTCCTGCACGCGGACGGGC
GCCCGCACCTCCGGTTCACCTCCGCTCGC	GCGGAGAGGACACCGTGCGGGCGGGCGCTCATGCCGCCACCTG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCCTGTGCCATGCGGGCGACGACGGCCCAGTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TCTTTCGCTGCCTCACCCGCGCGCGTCTGTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCGCCCGGGAACTACGGCAGGTGATGACGGAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TGCCTCATCGACCGACTCTTTGACGTCGAAGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GGGCGTCCGGAGTTGCTGCCGGGGCTGTACAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	ACGCTGGTCATCCCGAAGACTCACGTGGAGGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CGGCCGTGGCCGACCAGCCAGATCTCCCCCTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GCGCACCGCCCCCGTCCTCAAGCACTGGCTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC

>NZ_CP023747|4|2|1960188-1960826|PILER-CR
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	AGCTCCTGCACGCGGACGGGCGCCCGCACCTC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	ACCGTGCGGGCGGGCGCTCATGCCGCCACCTG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCCTGTGCCATGCGGGCGACGACGGCCCAGTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TCTTTCGCTGCCTCACCCGCGCGCGTCTGTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CCGCCCGGGAACTACGGCAGGTGATGACGGAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	TGCCTCATCGACCGACTCTTTGACGTCGAAGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GGGCGTCCGGAGTTGCTGCCGGGGCTGTACAC
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	ACGCTGGTCATCCCGAAGACTCACGTGGAGGA
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	CGGCCGTGGCCGACCAGCCAGATCTCCCCCTT
CGGTTCACCTCCGCTCGCGCGGAGAGGAC	GCGCACCGCCCCCGTCCTCAAGCACTGGCTGG
CGGTTCACCTCCGCTCGCGCGGAGAGGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_150478378.1\|1965804_1966452_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP023747.1\|WP_043439204.1\|1970230_1970542_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP023747.1\|WP_043439185.1\|1955517_1955799_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_150478172.1\|1966524_1967706_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP023747.1\|WP_043439206.1\|1972781_1973576_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP023747.1\|WP_043439183.1\|1953484_1954417_+\|sirohydrochlorin-chelatase	unknown	unknown	gnl\|CDD\|239507
NZ_CP023747.1\|WP_043448306.1\|1957177_1958128_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_079162503.1\|1969284_1970202_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP023747.1\|WP_043439187.1\|1958395_1958809_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413
NZ_CP023747.1\|WP_043448308.1\|1959881_1960100_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NZ_CP023747.1\|WP_043439191.1\|1961004_1963893_+\|CRISPR-associated-endonuclease-Cas3''	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP023747.1\|WP_043439196.1\|1967702_1968563_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NZ_CP023747.1\|WP_043439179.1\|1951224_1952907_+\|precorrin-3B-C(17)-methyltransferase	unknown	unknown	gnl\|CDD\|381173
NZ_CP023747.1\|WP_043439194.1\|1964089_1965676_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|187860
NZ_CP023747.1\|WP_079162064.1\|1954406_1955555_+\|threonine-phosphate-decarboxylase	unknown	unknown	gnl\|CDD\|236128
NZ_CP023747.1\|WP_043439199.1\|1968559_1969231_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NZ_CP023747.1\|WP_043439205.1\|1971668_1972760_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP023747.1\|WP_150478377.1\|1956229_1957099_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP023747.1\|WP_043439181.1\|1952903_1953488_+\|precorrin-8X-methylmutase	unknown	unknown	gnl\|CDD\|376825
NZ_CP023747.1\|WP_043439189.1\|1959017_1959869_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_150478378.1\|1965804_1966452_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	2.36831e-20
NZ_CP023747.1\|WP_043439204.1\|1970230_1970542_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.84072e-41
NZ_CP023747.1\|WP_043439205.1\|1971668_1972760_-\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	5.93306e-68
NZ_CP023747.1\|WP_150478172.1\|1966524_1967706_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.50616e-138
NZ_CP023747.1\|WP_043439206.1\|1972781_1973576_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	2.69349e-155
NZ_CP023747.1\|WP_043439183.1\|1953484_1954417_+\|sirohydrochlorin-chelatase	gnl\|CDD\|239507	cd03414, CbiX_SirB_C, Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both CbiX and SirB are found in a wide range of bacteria.	8.40068e-48
NZ_CP023747.1\|WP_043439194.1\|1964089_1965676_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	1.22414e-87
NZ_CP023747.1\|WP_079162503.1\|1969284_1970202_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.40772e-129
NZ_CP023747.1\|WP_043439187.1\|1958395_1958809_-\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	1.50812e-15
NZ_CP023747.1\|WP_043448308.1\|1959881_1960100_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	4.49805e-16
NZ_CP023747.1\|WP_043439191.1\|1961004_1963893_+\|CRISPR-associated-endonuclease-Cas3''	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.9852e-75
NZ_CP023747.1\|WP_043439196.1\|1967702_1968563_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	3.01441e-46
NZ_CP023747.1\|WP_043439179.1\|1951224_1952907_+\|precorrin-3B-C(17)-methyltransferase	gnl\|CDD\|381173	cd11646, Precorrin_3B_C17_MT, Precorrin-3B C(17)-methyltransferase (also named CobJ or CbiH). Precorrin-3B C(17)-methyltransferase participates in the pathway toward the biosynthesis of cobalamin (vitamin B12). There are two distinct cobalamin biosynthetic pathways. The aerobic pathway requires oxygen, and cobalt is inserted late in the pathway; the anaerobic pathway does not require oxygen, and cobalt insertion is the first committed step towards cobalamin synthesis. This model includes CobJ of the aerobic pathway and CbiH of the anaerobic pathway, both as stand-alone enzymes and when CobJ or CbiH form part of bifunctional enzymes, such as in Mycobacterium tuberculosis CobIJ where CobJ fuses with a precorrin-2 C(20)-methyltransferase domain, or Bacillus megaterium CbiH60, where CbiH is fused to a nitrite and sulfite reductase-like domain. In the aerobic pathway, once CobG has generated precorrin-3b, CobJ catalyzes the methylation of precorrin-3b at C-17 to form precorrin-4 (the extruded methylated C-20 fragment is left attached as an acyl group at C-1). In the corresponding anaerobic pathway, CbiH carries out this ring contraction, using cobalt-precorrin-3b as a substrate to generate a tetramethylated delta-lactone.	7.83502e-123
NZ_CP023747.1\|WP_079162064.1\|1954406_1955555_+\|threonine-phosphate-decarboxylase	gnl\|CDD\|236128	PRK07908, PRK07908, threonine-phosphate decarboxylase.	3.4238e-158
NZ_CP023747.1\|WP_043439199.1\|1968559_1969231_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.61759e-59
NZ_CP023747.1\|WP_150478377.1\|1956229_1957099_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.7007e-09
NZ_CP023747.1\|WP_043439181.1\|1952903_1953488_+\|precorrin-8X-methylmutase	gnl\|CDD\|376825	pfam02570, CbiC, Precorrin-8X methylmutase. This is a family Precorrin-8X methylmutases also known as Precorrin isomerase, CbiC/CobH, EC:5.4.1.2. This enzyme catalyzes the reaction: Precorrin-8X <=> hydrogenobyrinate. This enzyme is part of the Cobalamin (vitamin B12) biosynthetic pathway and catalyzes a methyl rearrangement.	1.73564e-72
NZ_CP023747.1\|WP_043439189.1\|1959017_1959869_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.25649e-07

>NZ_CP023747.1|WP_043448308.1|1959881_1960100_+|DUF397-domain-containing-protein
MATPSNWRKSSYSGPGDGNDCVEIAKSPTHVSIRDSKALAKATLSFPTRAFTTFVEALKTHPTSTDSARLRG
>NZ_CP023747.1|WP_043439189.1|1959017_1959869_+|helix-turn-helix-domain-containing-protein
MPARRHPTARQGRLGTELRKLREAAGLKATEVASLLGASSVQMSQIESAISGVSEQRLRRLAAHYACTDDAFIDALAAMATDRTRGWWAGYRTLLPAPFLDLAELEHHATFLQEVALPYIPGLLQTEDYARAVYSFRVPELPKPELELRVRHRMQRKVILKEPTPVPYEAVIHETALRIRVSDRNTSRAQLAGLLELSEEQHITLRVIPFDLDGFAGATSTMKYAGGAMPRLDTVVRDAPHGTAFIDSEDQLDAFRTLFRKVEAVSLPPDQSRDFIHRLAKEL
>NZ_CP023747.1|WP_043439187.1|1958395_1958809_-|ATP-binding-protein
MSEDVNEPWEYCLYIPNDLRAVTISRRTLRLILAMHGLTCLADTAELLATELISNAVRHTKGPAALRVRWSAGVLRIGAWDADPEPPQPPVPPERVADAEEGRGLGLVRACADLWGWQPLARGGNRGKVVWCELVSA
>NZ_CP023747.1|WP_043448306.1|1957177_1958128_-|LPXTG-cell-wall-anchor-domain-containing-protein
MNGNNFRMSARRCAAVALAAGPVTLAGAGSAQASGAHEGRASASVLRTGLDVSLLNKTVNVPLAVSLNEVQAPRSAHQTALSARLDGVDHGRPFSVLAADVAKADATTSEDKSEGTVELAHARIHVPGLPLLSLIEVEQVTSTATCEAGEAPVATSNVLGSVKVLGKRVSLTAGGTTDVKVPGVGEVRLDLSKRETTSTTAAASALELKVSVNPLKLNVAEVEGTVTLARATCESPAAPTTPADQESPEESAPAAPADDTPADTAPKTEAKAQGAHAESNLAETGGSSLTPYIAAGSVVLLGAGGGALVLARRRRG
>NZ_CP023747.1|WP_150478377.1|1956229_1957099_+|CPBP-family-intramembrane-metalloprotease
MRRRPLTWFFVLAYVLSWAAWTPYVLSDNGLGILHFGFPSLLGTTQLLGVLPGAYLGPIFSAFLVTATAQGRPGLRAWAGRLAKWRVSWRWYVAVIVGVPAVLTLSLTALGGSVPAAPSAALLAAFLPGLILQMVTTGIAEEPGWRDFVMPIVQRRYGPLAGTLIVGPLWGAWHLPLFWTEWGGPHVTWEQPVEFILTAIAFSFVMTWVFNRTGESLPLAMLLHTGVNNFFSFAAAGMFPELTQQDTVQAFLVASLVVAAVVLTATRGRLGYRKPPTVTGTHPEATVRP
>NZ_CP023747.1|WP_043439185.1|1955517_1955799_-|hypothetical-protein
MTNSRTTVAPASADATAFSAPAAAGAVGSYGEQAPAGRTDVLRIVLWTVLGLSATGNLVASITGAGTGPHLLFGVVSALSGVTLGVRFLRAHR
>NZ_CP023747.1|WP_079162064.1|1954406_1955555_+|threonine-phosphate-decarboxylase
MRTEPDGGPHDLRHHGDAEVRDGGAALVDLAVNVRQDTPPPWLRERIAASLGALAAYPDGRAARAAVAARHGLPVERVLLTAGAAEAFVLLARALKVRRPVVVHPQFTEPEAALRDAGHTVDRVLLREEDGFRLDPAAVPEDADLVVVGNPTNPTSVLHPAAVLSRLARPGRTLVVDEAFMDAVPGEREALAGRTDVPGLVVLRSLTKTWGLAGLRIGYVLSSPEVIAELERAQPLWPVSTPALAAAVACMEPRALAEAEAAARRIAVDRARLVTGLASFAGAGVRVAGPAEAPFVLLRVEGAARIRRRLRDLGHAVRRGDTFPGLGDAWLRVAVRGPETTEGFLTALEAALATPLGPSEGWEHRETPRPLTDGPAGSGRPG
>NZ_CP023747.1|WP_043439183.1|1953484_1954417_+|sirohydrochlorin-chelatase
MTTPPPALLIAGHGTRDEAGAEAFRDFVRELGRRHPELPVAGGFIELSPPPLGEAVAELVERGVRRFAAVPLMLVSAGHAKGDIPAALAREKERHPGISYAYGRPLGPHPALLRVLERRLDEALGAAGPDGVPVDRSEVTVLLVGRGSTDPDANAEVHRAARLLWEGRGYAGVETAFVSLAAPDVPSGLDRCVRLGARRIVVLPYFLFTGILPERVRRQTEDWAAAHPETEVRSAEVIGPEPELLDLVMERYEEAVKGDLRMNCDSCVYRIALPGFEDKVGLPQQPHFHPDDDDHHHGHHHGGHAHSHAH
>NZ_CP023747.1|WP_043439181.1|1952903_1953488_+|precorrin-8X-methylmutase
MNRVVHPIEQESFRRLRARLDTSRLPPLTRAVVERVVHSSADLGYADDLVMDEAELERAHTALHAGAPVVVDVEMVAAGITRHPTVCRLKDAGSGPGLTRSAQAVRLAHQEVGPGALWVIGCAPTALEELLTLDASPALVIGVPVGFVGAAESKAALRESGLPAVSNVSEKGGSAVAAAALNALLYHPTSKETA
>NZ_CP023747.1|WP_043439179.1|1951224_1952907_+|precorrin-3B-C(17)-methyltransferase
MIGLMSATAAGAAARDRLAAAWPDRTRVYEGPVGEAARTAFAECEQLVCFLATGAVVRLLAPLLRDKASDPGVVCVDEGGRFAVSLVGGHAGGANELARAVAEVLGAEPVVTTATDSVGLPGLDMLGLPVEGDVAGVSRALLDGEPVALQAEVSWPLPPLKVTGEGRHTLRVTDALVEPAEREAVLRPPSLVVGVGASRGAPTEEILGLVEGALADAGLSVRSLAELATVDAKAGEPGIVEAAERLGVPLVTYSAEELAGIEVPNPSEAPLAAVGTPSVAEAAALVRGGELLVPKRKSAARPAMATCAVVRRPGRGRLAVVGLGPGARDLLTPRAEAELRRASVLVGLDQYVDQIRDLLRPGTRILQSGLGAEEERARTAVAEARAGHAVALIGSGDAGVYAMASPALAEASDDIDVVGVPGVTAALAAGALLGAPLGHDHVSISLSDLHTPWEVIERRVRAAAEADLVVTFYNPRSRGRDWQLPKALAILAEHREPTTPVGVVRNASRPDESSRVTALAALDPATVDMMTVVTVGNTATREIAGRMVTPRGYRWQEETR
>NZ_CP023747.1|WP_043439191.1|1961004_1963893_+|CRISPR-associated-endonuclease-Cas3''
MTEAQGVPSVPACPDPRLWGKEHGLSQPYPVMCHLLDVAAAFTTLWDELLGERTRLRFAKQLGLHGEDCRSVLSLWAGLHDLGKITPAFQAQIPKLFDAVRDEPAYVFAPGAERDRGFRHEMATHWALTGLLTGVGYPNRRIKSSSGGSGAPLAHWVAQLLGGHHGLFGTALSVSHMRQPNRYQAGLGEDGWNEQRRVHFEQLRRVTGGCAVPTGALSADLAVVLAGLVITADWLASQTHAIVGVRPPTTWQGRTGEIDAHFERAQAAAPGLVAAARLGRARFEAGDFAEMFPFEPNPLQADVVAHLPGLVAEHGPGLVLVTAPTGDGKTEAALYAASVLGRAAGTRGVYVALPTMATADAMFGRVRTYASRALGGERALTLLHSMSWLNPLYGQSVEEVSYGEPQQPTTGISTDGVTAVEADAWLRGPKRGFLAPLSVGTIDQVLSGVLPLRYNVLRLFGLFEKVFVVDEAHAYGPWMHKLLLTLLEWLGAFRAPVALLSATLTGSTAASLVNAYRRGAGFVAPAVIAPRYPGWLYASAENGEVSLPRTTSTGRPRTLDVAVRRVAWDVLSADPGTAVSPGGRRAVLREELRPVVEEGGTALVCCTTVTEAQSTFRDLRAAFPELAARDGGVRLLHSRFPAETRQRITAECEAAYGKPQEGEPVRLREASVLVATQVVEQSLDLDFDLVVSDLAPLAQLLQRAGRGRRHRRGLGGRPAWARAENRPRLVVLDPFQRPQKADKPHSWGSVYDTSLLIRTSLLLEEHVESGIVVPNGVQELVDAVYAPDFVDGLDTAVEQELRLLDGERLASTMAETSLADMVGIKGPGDVQGNLHLISRQLEGVTEELLTTRLGADTGRVLCVYVQGDGRQTLDAVGSLPLPGADGQPLNQDAVARIVARVAPVPGKWVRNSRTSEPPAAWDKKSALRDLVVLSMTRAGDGRWNCRCGDRMIVTSEVGLEQF
>NZ_CP023747.1|WP_043439194.1|1964089_1965676_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MPATVNILYEPLFPVSWSPVAEHHADGPSARVGLLDLLLRSHEIEGLAVPDAPAHSALLRILYALTARVTGLDEALEGPDDWQLLRDEVLADGCLPWKGIERYFARHRERFFLFDPEPGGRPWMQDPRLSDQCDPTSTAGVNKLVVTRPSGNNHSWFRHVRDASPDASTASEAVLNLLTWHYYGPSGRCSSRTVNGVTTASAKAGPLRTSLSYHPEGDTLFETLLAGLVPPTRDVAAERDLCPWEWDDLPDPDGPPPVLTGPCSRLTAGSMHALLLVPEEDGEGVRDAYITWAYRTGRQTRPDDDYLIWQISKQGNAYPRPADSGRALWRDLDALLLIDPPGVAQPRRPTVFEWAVEVSAELRVHALGFEQDGQAKDTQFVDAVTPPVLGFVEKRSARTQPAVGRLRALGERFGSRLDRALRRAWRTYVNDPKDSAHAWAQEGAGRYWPAAEREFWDRFGLLDRTGTALDGGLDATAARTAFLRLAVRAFDDVTASAARTQRGAKAVEEARIELFGDRRSKPVRPDAA
>NZ_CP023747.1|WP_150478378.1|1965804_1966452_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MRTCESDPGARAALRSGVGKNLDAVPRMHRIIAHLVPANAGAATERAYYAVAAMIAEQARRRGTTNETADDTCSEAVEPSGEETPAKAPTPTGKNDDGVREYGTSLGASFALAVVDSPGRERQMRRGTAESRLNILCKQGTTGLHRHLPASVRYLRSLDVLVDWARLLQDLDDWHRRSGHVTRRWLQDFYRRCQEDARREANRNDTHKPTDATDA
>NZ_CP023747.1|WP_150478172.1|1966524_1967706_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTAKPSARFLCAHVLQTVPFANLNRDDTNSVKTVQYGGVLRTRVSSQCWKRAVRTDFQQRIGQTALRTRRIGERVSRLLTEERGWPEDLAARAGAHLAVASGIKFELEEKEKQVQVNKVIGNALVYVPQTAVDELADLAEEHRADLEKAKDIKKSNDKSILPKDRVTAVLRTRNGVISVFGRMLAEVDNAGVDGAVQVAHVMTTHATDIEIDYFSAVDDVTDDWNDSTGSGHMGHAEFSAGTFYRYATIDLEELADNLGADTKAARELAEAFLHSFVTSLPQAKKNSTAPNTVPDLIHLTVRADRPLSLAAAFEKPVQMAQDGGYAAASRDALAQYADAVNTFMGDDGILLAGWTGLDAKDHTGLGDRHTALNALVTAAIETAFVVGDSGAAE
>NZ_CP023747.1|WP_043439196.1|1967702_1968563_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MNAEPAAAAPGLLLHCSGPLQSWGHHSHFNQRDTAAFPTRSGIIGLLAAALGHSRTEPIDGLAHLRITVRVDRPGVVLRDLHTVGGGLPPSGTVTTAQGKKRSGDTTTLLSHRHYLADAAFTVALTPSPDTPAHVGLLQECAEALRAPRWPLYLGRRACPPTGPLLLSFFDDALHHLVRLPVAATAPRPGGPTRVVEFLADQPLDRLPLPADTAASDPAEAAHPTARINDQPTTFHPRLRTYQARPLYRRTFTPPSGQWGGLGTDYLTSLAAYLEQALPTGEGSRR
>NZ_CP023747.1|WP_043439199.1|1968559_1969231_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MSALWLTRIVPHPASRDARRDLADAVALHRRLMSLFPDGAGDDPRATLGVLHRTDDAPTGPSVLLQSRHQPDLGRLPEHYGQAVTRTLDPLLSALRSGAHINFRCTASPVRKPGATTRALYNLPAVVPLHGAHAEQWWLRQADTAGLKVLTLHAQPLDSATGVRGKRGSGDQQRVRHARTRFDGTAVIIDSDLLRTKIAEGIGRGKAYGCGLLTIAPSHGGAV
>NZ_CP023747.1|WP_079162503.1|1969284_1970202_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MLPRVTDSLSFLYLDVVRVLQDDTGVCAEVTSERHGRQTVYLPTAALSCVLLGPGTSITARALATLARHGTTVLVTGSGGVRCYAGAQPDSLSTTWLERQVRAWADDSLRLVVATAMYEKRFGGGTVPPGTTLEQLRGMEGQRVKAQYRILAQQYKIGRFRRAYDPAQWHGQDPVNLALSSANTCLYGIVHAAVLALGCSPALGFVHSGNQQALVYDIADLYKAELTIPLAFSLHAATNPEAEARRSFREGLRLFRLLPRIVHDLQDLLDPSGDREVPDPEEQLVDLWDPVAGSLPGGANHGTGS
>NZ_CP023747.1|WP_043439204.1|1970230_1970542_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MASMIVLAASAVPDHLRGALTRWLLEVTPELYIGTVSARVRDELWESVTACADSGTAVLAYPSDNEQGFELRTAGDQRRVPVDFDGLTLVSFTRDSKEMANLL
>NZ_CP023747.1|WP_043439205.1|1971668_1972760_-|amidohydrolase-family-protein
MSDHAVLHVKGRMLVGPQEVRDELWVVGGRISYDRPAGAQDVRTVEGWALPGLVDAHCHVGLDAHGPVPADVSEKQALTDRDAGTLLIRDAGSPSDTRWIDDREDLPKIIRAGRHIARTRRYIRNYAWEVEPEDLVAYVAQEARRGDGWVKLVGDWIDREAGDLTACWPRGAVEAAIAEAHRLGARVTAHCFAEDSLRDLVEAGIDCVEHATGLTEETIPLFAERGVAIVPTLVNIATFPRLADGGETKFPRWSAHMRRLHEGRYDTVRAAYDAGIPVYVGTDAGGSLPHGLVAAEVEELVTAGIPPLQALSATTWSAHRWLGRPGLEEGAPADLVVYDEDPRTDVRVLAAPRRVVLNGRVVG
>NZ_CP023747.1|WP_043439206.1|1972781_1973576_-|amino-acid-ABC-transporter-ATP-binding-protein
MSTVPEILVRGLHKSFGDNEVLRGIDLEIGRGEVVCVIGPSGSGKSTLLRCVNLLEEPTRGQVFVGGTELTDPDVDIDAVRRRIGMVFQQFNLFPHLTVTENLTLPQRRVLGRGKARAGEIAAENLARVGLSEKADAYPSSLSGGQQQRVAIARALAMGPEVMLFDEPTSALDPELVGDVLAVMRMLADEGMTMMVVTHEMGFAREVADRVIFMDGGVIVEDGAPDRVIGDPAHERTRHFLSRLLDPARAEVEEEIPDRAGTGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_5

1970561-1971565

TypeI-E

Consensus_repeat	Method
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	PILER-CR
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CRISPRCasFinder
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CRT

16 spacers

cas2,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of NZ_CP023747_5

>merge|NZ_CP023747|5|1970561-1971565|PILER-CR,CRISPRCasFinder,CRT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCGTCTTCGACGTGAAAGAGTCCGTCGACGACGCTGTCCTCTCCGCGCGAGCGGAGGTGAGTCGGTCCCGGAGGTGGTCCTGTCACCGTCCGCGAAGTCCTCTCCGCGCGAGCGGAGGTGAGTCGTCGGTGAAAAGTACAGCTGTCATCGCGTGCCAGTCCTCTCCGCGCGAGCGGAGGTGAGTCGACCGCGTGACTGCTCCCGTTCGGGTGGGCCCGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGTAATCGGAGCAGAACATGCCCTACATCACCGTGTCCTCTCCGCGCGAGCGGAGGTGAGTCGCAGGCCCCCAGGTTGCTGCGGGTGATGCGCAAGTCCTCTCCGCGCGAGCGGAGGTGAGTCGTACAGGTCGAAAGCGAGCCTGCGGAGGTCGGTGTCCTCTCCGCGCGAGCGGAGGTGAGTCGCGTTCATCACCGCCGCCCGGCAGGCGCAGCAGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGACGTCGCCACCACCGTAGACGGCCCCGGCCCGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGGCACTCCGAGACCAGGCAAAGGCAGCCGAGCGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGTTTCTCGGGTCCGAAGTCGTCGGGCGTCTCGAGTCCTCTCCGCGCGAGCGGAGGTGAGTCGGACACTTCGCCCCCGCCTCCGCCGAGAGGTTCGTCCTCTCCGCGCGAGCGGAGGTGAGTCGGGAGTACCGATACGGTCAGCGCTCGCACAGGCGTCCTCTCCGCGCGAACGGAGGTGAGTCGGTGTCCGACGCCGTGATCGGGGTGCTGTTCGGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGATCACTGCGAGGCACCCGCCGAGGTCCCGGAGGTCCTCTCCGCGCGAGCGGAGGTGAGTCGTCCACGTCAGTCTCCAGTCGTTGGGGGCTGGTGTCCTCTCCGCGCGAGCGGAGGTGAGCAG

>NZ_CP023747|5|3|1970561-1971504|PILER-CR
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCTTCGACGTGAAAGAGTCCGTCGACGACGCT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GTCCCGGAGGTGGTCCTGTCACCGTCCGCGAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCGGTGAAAAGTACAGCTGTCATCGCGTGCCA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACCGCGTGACTGCTCCCGTTCGGGTGGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TAATCGGAGCAGAACATGCCCTACATCACCGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CAGGCCCCCAGGTTGCTGCGGGTGATGCGCAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TACAGGTCGAAAGCGAGCCTGCGGAGGTCGGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CGTTCATCACCGCCGCCCGGCAGGCGCAGCAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACGTCGCCACCACCGTAGACGGCCCCGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GCACTCCGAGACCAGGCAAAGGCAGCCGAGCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TTTCTCGGGTCCGAAGTCGTCGGGCGTCTCGA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GACACTTCGCCCCCGCCTCCGCCGAGAGGTTC
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GGAGTACCGATACGGTCAGCGCTCGCACAGGC
GTCCTCTCCGCGCGAACGGAGGTGAGTCG	GTGTCCGACGCCGTGATCGGGGTGCTGTTCGG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ATCACTGCGAGGCACCCGCCGAGGTCCCGGAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG

>NZ_CP023747|5|6|1970561-1971565|CRISPRCasFinder
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCTTCGACGTGAAAGAGTCCGTCGACGACGCT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GTCCCGGAGGTGGTCCTGTCACCGTCCGCGAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCGGTGAAAAGTACAGCTGTCATCGCGTGCCA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACCGCGTGACTGCTCCCGTTCGGGTGGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TAATCGGAGCAGAACATGCCCTACATCACCGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CAGGCCCCCAGGTTGCTGCGGGTGATGCGCAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TACAGGTCGAAAGCGAGCCTGCGGAGGTCGGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CGTTCATCACCGCCGCCCGGCAGGCGCAGCAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACGTCGCCACCACCGTAGACGGCCCCGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GCACTCCGAGACCAGGCAAAGGCAGCCGAGCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TTTCTCGGGTCCGAAGTCGTCGGGCGTCTCGA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GACACTTCGCCCCCGCCTCCGCCGAGAGGTTC
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GGAGTACCGATACGGTCAGCGCTCGCACAGGC
GTCCTCTCCGCGCGAACGGAGGTGAGTCG	GTGTCCGACGCCGTGATCGGGGTGCTGTTCGG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ATCACTGCGAGGCACCCGCCGAGGTCCCGGAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCCACGTCAGTCTCCAGTCGTTGGGGGCTGGT
GTCCTCTCCGCGCGAGCGGAGGTGAGCAG

>NZ_CP023747|5|2|1970561-1971565|CRT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCTTCGACGTGAAAGAGTCCGTCGACGACGCT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GTCCCGGAGGTGGTCCTGTCACCGTCCGCGAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCGGTGAAAAGTACAGCTGTCATCGCGTGCCA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACCGCGTGACTGCTCCCGTTCGGGTGGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TAATCGGAGCAGAACATGCCCTACATCACCGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CAGGCCCCCAGGTTGCTGCGGGTGATGCGCAA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TACAGGTCGAAAGCGAGCCTGCGGAGGTCGGT
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	CGTTCATCACCGCCGCCCGGCAGGCGCAGCAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ACGTCGCCACCACCGTAGACGGCCCCGGCCCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GCACTCCGAGACCAGGCAAAGGCAGCCGAGCG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TTTCTCGGGTCCGAAGTCGTCGGGCGTCTCGA
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GACACTTCGCCCCCGCCTCCGCCGAGAGGTTC
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	GGAGTACCGATACGGTCAGCGCTCGCACAGGC
GTCCTCTCCGCGCGAACGGAGGTGAGTCG	GTGTCCGACGCCGTGATCGGGGTGCTGTTCGG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	ATCACTGCGAGGCACCCGCCGAGGTCCCGGAG
GTCCTCTCCGCGCGAGCGGAGGTGAGTCG	TCCACGTCAGTCTCCAGTCGTTGGGGGCTGGT
GTCCTCTCCGCGCGAGCGGAGGTGAGCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_150478378.1\|1965804_1966452_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	pfam09485_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP023747.1\|WP_043439204.1\|1970230_1970542_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	cas2	pfam09707_cas2_CAS-I-E	gnl\|CDD\|378244
NZ_CP023747.1\|WP_043439205.1\|1971668_1972760_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP023747.1\|WP_043439199.1\|1968559_1969231_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|187858
NZ_CP023747.1\|WP_043448310.1\|1975493_1976594_+\|alanine--glyoxylate-aminotransferase-family-protein	unknown	unknown	gnl\|CDD\|223153
NZ_CP023747.1\|WP_043439218.1\|1980226_1981276_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223594
NZ_CP023747.1\|WP_043439210.1\|1974414_1975272_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270342
NZ_CP023747.1\|WP_043439194.1\|1964089_1965676_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|187860
NZ_CP023747.1\|WP_043439211.1\|1976944_1977487_+\|diaminobutyrate-acetyltransferase	unknown	unknown	gnl\|CDD\|131459
NZ_CP023747.1\|WP_043448308.1\|1959881_1960100_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NZ_CP023747.1\|WP_043439189.1\|1959017_1959869_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP023747.1\|WP_043439196.1\|1967702_1968563_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|273842
NZ_CP023747.1\|WP_043439208.1\|1973572_1974418_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP023747.1\|WP_043439214.1\|1978874_1979270_+\|ectoine-synthase	unknown	unknown	gnl\|CDD\|183953
NZ_CP023747.1\|WP_043439212.1\|1977531_1978803_+\|diaminobutyrate--2-oxoglutarate-transaminase	unknown	unknown	gnl\|CDD\|236437
NZ_CP023747.1\|WP_079162503.1\|1969284_1970202_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP023747.1\|WP_150478172.1\|1966524_1967706_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP023747.1\|WP_043439191.1\|1961004_1963893_+\|CRISPR-associated-endonuclease-Cas3''	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP023747.1\|WP_043439206.1\|1972781_1973576_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP023747.1\|WP_043439215.1\|1979274_1980165_+\|ectoine-hydroxylase	unknown	unknown	gnl\|CDD\|131461

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_150478378.1\|1965804_1966452_+\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	2.36831e-20
NZ_CP023747.1\|WP_043439204.1\|1970230_1970542_+\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.84072e-41
NZ_CP023747.1\|WP_043439205.1\|1971668_1972760_-\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	5.93306e-68
NZ_CP023747.1\|WP_043439199.1\|1968559_1969231_+\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|187858	cd09727, Cas6_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas6e. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6e is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-E subtype; Homologous to Cas6 (RAMP superfamily protein); Possesses double RRM/ferredoxin fold; also known as Cse3 family.	1.61759e-59
NZ_CP023747.1\|WP_043448310.1\|1975493_1976594_+\|alanine--glyoxylate-aminotransferase-family-protein	gnl\|CDD\|223153	COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism].	3.4009e-83
NZ_CP023747.1\|WP_043439218.1\|1980226_1981276_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223594	COG0520, csdA, Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones].	4.43788e-43
NZ_CP023747.1\|WP_043439210.1\|1974414_1975272_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270342	cd13624, PBP2_Arg_Lys_His, Substrate binding domain of the arginine-, lysine-, histidine-binding protein ArtJ; the type 2 periplasmic binding protein fold. This group includes the periplasmic substrate-binding protein ArtJ of the ATP-binding cassette (ABC) transport system from the thermophilic bacterium Geobacillus stearothermophilus, which is specific for arginine, lysine, and histidine. ArtJ belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.98224e-73
NZ_CP023747.1\|WP_043439194.1\|1964089_1965676_+\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|187860	cd09729, Cse1_I-E, CRISPR/Cas system-associated protein Cse1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Large proteins, some contain Zn-finger domain; subunit of the Cascade complex; signature gene for I-E subtype; also known as Cse1/CasA/YgcL family.	1.22414e-87
NZ_CP023747.1\|WP_043439211.1\|1976944_1977487_+\|diaminobutyrate-acetyltransferase	gnl\|CDD\|131459	TIGR02406, L-24-diaminobutyric_acid_acetyltransferase, diaminobutyrate acetyltransferase. This enzyme family is the EctA of ectoine biosynthesis. Ectoine is a compatible solute, analagous to trehalose, betaines, etc., found often in halotolerant organisms. EctA is L-2,4-diaminobutyric acid acetyltransferase, also called DABA acetyltransferase. [Cellular processes, Adaptations to atypical conditions].	4.29896e-71
NZ_CP023747.1\|WP_043448308.1\|1959881_1960100_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	4.49805e-16
NZ_CP023747.1\|WP_043439189.1\|1959017_1959869_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.25649e-07
NZ_CP023747.1\|WP_043439196.1\|1967702_1968563_+\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|273842	TIGR01868, hypothetical_protein, CRISPR-associated protein Cas5/CasD, subtype I-E/ECOLI. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is part of the ECOLI subtype CRISPR/Cas locus, and now characterized as part of the CASCADE complex of that system. It shares a small N-terminal homology region with members of several other CRISPR/Cas subtypes, and we view the families that share this region as being Cas5.	3.01441e-46
NZ_CP023747.1\|WP_043439208.1\|1973572_1974418_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.29294e-56
NZ_CP023747.1\|WP_043439214.1\|1978874_1979270_+\|ectoine-synthase	gnl\|CDD\|183953	PRK13290, ectC, L-ectoine synthase; Reviewed.	6.16079e-78
NZ_CP023747.1\|WP_043439212.1\|1977531_1978803_+\|diaminobutyrate--2-oxoglutarate-transaminase	gnl\|CDD\|236437	PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate transaminase.	0
NZ_CP023747.1\|WP_079162503.1\|1969284_1970202_+\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	4.40772e-129
NZ_CP023747.1\|WP_150478172.1\|1966524_1967706_+\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	1.50616e-138
NZ_CP023747.1\|WP_043439191.1\|1961004_1963893_+\|CRISPR-associated-endonuclease-Cas3''	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	1.9852e-75
NZ_CP023747.1\|WP_043439206.1\|1972781_1973576_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	2.69349e-155
NZ_CP023747.1\|WP_043439215.1\|1979274_1980165_+\|ectoine-hydroxylase	gnl\|CDD\|131461	TIGR02408, putative_L-proline_4-hydroxylase, ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.	3.93209e-171

>NZ_CP023747.1|WP_043439204.1|1970230_1970542_+|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MASMIVLAASAVPDHLRGALTRWLLEVTPELYIGTVSARVRDELWESVTACADSGTAVLAYPSDNEQGFELRTAGDQRRVPVDFDGLTLVSFTRDSKEMANLL
>NZ_CP023747.1|WP_079162503.1|1969284_1970202_+|type-I-E-CRISPR-associated-endonuclease-Cas1
MLPRVTDSLSFLYLDVVRVLQDDTGVCAEVTSERHGRQTVYLPTAALSCVLLGPGTSITARALATLARHGTTVLVTGSGGVRCYAGAQPDSLSTTWLERQVRAWADDSLRLVVATAMYEKRFGGGTVPPGTTLEQLRGMEGQRVKAQYRILAQQYKIGRFRRAYDPAQWHGQDPVNLALSSANTCLYGIVHAAVLALGCSPALGFVHSGNQQALVYDIADLYKAELTIPLAFSLHAATNPEAEARRSFREGLRLFRLLPRIVHDLQDLLDPSGDREVPDPEEQLVDLWDPVAGSLPGGANHGTGS
>NZ_CP023747.1|WP_043439199.1|1968559_1969231_+|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MSALWLTRIVPHPASRDARRDLADAVALHRRLMSLFPDGAGDDPRATLGVLHRTDDAPTGPSVLLQSRHQPDLGRLPEHYGQAVTRTLDPLLSALRSGAHINFRCTASPVRKPGATTRALYNLPAVVPLHGAHAEQWWLRQADTAGLKVLTLHAQPLDSATGVRGKRGSGDQQRVRHARTRFDGTAVIIDSDLLRTKIAEGIGRGKAYGCGLLTIAPSHGGAV
>NZ_CP023747.1|WP_043439196.1|1967702_1968563_+|type-I-E-CRISPR-associated-protein-Cas5/CasD
MNAEPAAAAPGLLLHCSGPLQSWGHHSHFNQRDTAAFPTRSGIIGLLAAALGHSRTEPIDGLAHLRITVRVDRPGVVLRDLHTVGGGLPPSGTVTTAQGKKRSGDTTTLLSHRHYLADAAFTVALTPSPDTPAHVGLLQECAEALRAPRWPLYLGRRACPPTGPLLLSFFDDALHHLVRLPVAATAPRPGGPTRVVEFLADQPLDRLPLPADTAASDPAEAAHPTARINDQPTTFHPRLRTYQARPLYRRTFTPPSGQWGGLGTDYLTSLAAYLEQALPTGEGSRR
>NZ_CP023747.1|WP_150478172.1|1966524_1967706_+|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTAKPSARFLCAHVLQTVPFANLNRDDTNSVKTVQYGGVLRTRVSSQCWKRAVRTDFQQRIGQTALRTRRIGERVSRLLTEERGWPEDLAARAGAHLAVASGIKFELEEKEKQVQVNKVIGNALVYVPQTAVDELADLAEEHRADLEKAKDIKKSNDKSILPKDRVTAVLRTRNGVISVFGRMLAEVDNAGVDGAVQVAHVMTTHATDIEIDYFSAVDDVTDDWNDSTGSGHMGHAEFSAGTFYRYATIDLEELADNLGADTKAARELAEAFLHSFVTSLPQAKKNSTAPNTVPDLIHLTVRADRPLSLAAAFEKPVQMAQDGGYAAASRDALAQYADAVNTFMGDDGILLAGWTGLDAKDHTGLGDRHTALNALVTAAIETAFVVGDSGAAE
>NZ_CP023747.1|WP_150478378.1|1965804_1966452_+|type-I-E-CRISPR-associated-protein-Cse2/CasB
MRTCESDPGARAALRSGVGKNLDAVPRMHRIIAHLVPANAGAATERAYYAVAAMIAEQARRRGTTNETADDTCSEAVEPSGEETPAKAPTPTGKNDDGVREYGTSLGASFALAVVDSPGRERQMRRGTAESRLNILCKQGTTGLHRHLPASVRYLRSLDVLVDWARLLQDLDDWHRRSGHVTRRWLQDFYRRCQEDARREANRNDTHKPTDATDA
>NZ_CP023747.1|WP_043439194.1|1964089_1965676_+|type-I-E-CRISPR-associated-protein-Cse1/CasA
MPATVNILYEPLFPVSWSPVAEHHADGPSARVGLLDLLLRSHEIEGLAVPDAPAHSALLRILYALTARVTGLDEALEGPDDWQLLRDEVLADGCLPWKGIERYFARHRERFFLFDPEPGGRPWMQDPRLSDQCDPTSTAGVNKLVVTRPSGNNHSWFRHVRDASPDASTASEAVLNLLTWHYYGPSGRCSSRTVNGVTTASAKAGPLRTSLSYHPEGDTLFETLLAGLVPPTRDVAAERDLCPWEWDDLPDPDGPPPVLTGPCSRLTAGSMHALLLVPEEDGEGVRDAYITWAYRTGRQTRPDDDYLIWQISKQGNAYPRPADSGRALWRDLDALLLIDPPGVAQPRRPTVFEWAVEVSAELRVHALGFEQDGQAKDTQFVDAVTPPVLGFVEKRSARTQPAVGRLRALGERFGSRLDRALRRAWRTYVNDPKDSAHAWAQEGAGRYWPAAEREFWDRFGLLDRTGTALDGGLDATAARTAFLRLAVRAFDDVTASAARTQRGAKAVEEARIELFGDRRSKPVRPDAA
>NZ_CP023747.1|WP_043439191.1|1961004_1963893_+|CRISPR-associated-endonuclease-Cas3''
MTEAQGVPSVPACPDPRLWGKEHGLSQPYPVMCHLLDVAAAFTTLWDELLGERTRLRFAKQLGLHGEDCRSVLSLWAGLHDLGKITPAFQAQIPKLFDAVRDEPAYVFAPGAERDRGFRHEMATHWALTGLLTGVGYPNRRIKSSSGGSGAPLAHWVAQLLGGHHGLFGTALSVSHMRQPNRYQAGLGEDGWNEQRRVHFEQLRRVTGGCAVPTGALSADLAVVLAGLVITADWLASQTHAIVGVRPPTTWQGRTGEIDAHFERAQAAAPGLVAAARLGRARFEAGDFAEMFPFEPNPLQADVVAHLPGLVAEHGPGLVLVTAPTGDGKTEAALYAASVLGRAAGTRGVYVALPTMATADAMFGRVRTYASRALGGERALTLLHSMSWLNPLYGQSVEEVSYGEPQQPTTGISTDGVTAVEADAWLRGPKRGFLAPLSVGTIDQVLSGVLPLRYNVLRLFGLFEKVFVVDEAHAYGPWMHKLLLTLLEWLGAFRAPVALLSATLTGSTAASLVNAYRRGAGFVAPAVIAPRYPGWLYASAENGEVSLPRTTSTGRPRTLDVAVRRVAWDVLSADPGTAVSPGGRRAVLREELRPVVEEGGTALVCCTTVTEAQSTFRDLRAAFPELAARDGGVRLLHSRFPAETRQRITAECEAAYGKPQEGEPVRLREASVLVATQVVEQSLDLDFDLVVSDLAPLAQLLQRAGRGRRHRRGLGGRPAWARAENRPRLVVLDPFQRPQKADKPHSWGSVYDTSLLIRTSLLLEEHVESGIVVPNGVQELVDAVYAPDFVDGLDTAVEQELRLLDGERLASTMAETSLADMVGIKGPGDVQGNLHLISRQLEGVTEELLTTRLGADTGRVLCVYVQGDGRQTLDAVGSLPLPGADGQPLNQDAVARIVARVAPVPGKWVRNSRTSEPPAAWDKKSALRDLVVLSMTRAGDGRWNCRCGDRMIVTSEVGLEQF
>NZ_CP023747.1|WP_043448308.1|1959881_1960100_+|DUF397-domain-containing-protein
MATPSNWRKSSYSGPGDGNDCVEIAKSPTHVSIRDSKALAKATLSFPTRAFTTFVEALKTHPTSTDSARLRG
>NZ_CP023747.1|WP_043439189.1|1959017_1959869_+|helix-turn-helix-domain-containing-protein
MPARRHPTARQGRLGTELRKLREAAGLKATEVASLLGASSVQMSQIESAISGVSEQRLRRLAAHYACTDDAFIDALAAMATDRTRGWWAGYRTLLPAPFLDLAELEHHATFLQEVALPYIPGLLQTEDYARAVYSFRVPELPKPELELRVRHRMQRKVILKEPTPVPYEAVIHETALRIRVSDRNTSRAQLAGLLELSEEQHITLRVIPFDLDGFAGATSTMKYAGGAMPRLDTVVRDAPHGTAFIDSEDQLDAFRTLFRKVEAVSLPPDQSRDFIHRLAKEL
>NZ_CP023747.1|WP_043439205.1|1971668_1972760_-|amidohydrolase-family-protein
MSDHAVLHVKGRMLVGPQEVRDELWVVGGRISYDRPAGAQDVRTVEGWALPGLVDAHCHVGLDAHGPVPADVSEKQALTDRDAGTLLIRDAGSPSDTRWIDDREDLPKIIRAGRHIARTRRYIRNYAWEVEPEDLVAYVAQEARRGDGWVKLVGDWIDREAGDLTACWPRGAVEAAIAEAHRLGARVTAHCFAEDSLRDLVEAGIDCVEHATGLTEETIPLFAERGVAIVPTLVNIATFPRLADGGETKFPRWSAHMRRLHEGRYDTVRAAYDAGIPVYVGTDAGGSLPHGLVAAEVEELVTAGIPPLQALSATTWSAHRWLGRPGLEEGAPADLVVYDEDPRTDVRVLAAPRRVVLNGRVVG
>NZ_CP023747.1|WP_043439206.1|1972781_1973576_-|amino-acid-ABC-transporter-ATP-binding-protein
MSTVPEILVRGLHKSFGDNEVLRGIDLEIGRGEVVCVIGPSGSGKSTLLRCVNLLEEPTRGQVFVGGTELTDPDVDIDAVRRRIGMVFQQFNLFPHLTVTENLTLPQRRVLGRGKARAGEIAAENLARVGLSEKADAYPSSLSGGQQQRVAIARALAMGPEVMLFDEPTSALDPELVGDVLAVMRMLADEGMTMMVVTHEMGFAREVADRVIFMDGGVIVEDGAPDRVIGDPAHERTRHFLSRLLDPARAEVEEEIPDRAGTGG
>NZ_CP023747.1|WP_043439208.1|1973572_1974418_-|amino-acid-ABC-transporter-permease
MSDTTGTADPELRAPRKRLTRSRRRSLSRGAQYAVFAVAVIAFAATADWGRLGNQFAQADIARRMFPDVITLALKNTVLYTVSGFAVGLLLGMVIALMRLSSVGPYRWAAGVYIEIFRGLPALLIFIFVGVAVPLAFPGTEIIGGTYGKVALALGLVSAAYMAETIRAGIQAVPRGQLEAARSLGFSPARAMISIVVPQAFRIILPPLTNELVLLFKDSSLVLFLGVTLEERELSKFGRDLASQTANSTPILVAGLCYLLITIPLGLVVRRMESKAQGAAK
>NZ_CP023747.1|WP_043439210.1|1974414_1975272_-|transporter-substrate-binding-domain-containing-protein
MNTLLGRRVRILAAITATAGAVLVAGCTSSGSGGTATSADGGVDLVKAGKLTTCTHLPYPPFQSEIDGKVQGFDVSLIDLVAKDLGVQQYVFDTPFENFKTGAFLNSGQCDLAAAGMTITEERKKNVDFSDPYFDATQAVLVDRKSGVTSLADLKAKGKKLGAQAQTTGEDYVRGKGFDPVSFESSDAVLNGLRTGQVQAVVIDYPVVQGWLKNKADADAFKVVENLDTGEQYGFTVKKGNTELLAAVNKAIKDAKADGTYQKLYEQWIGPYTPSAADSPSPTAS
>NZ_CP023747.1|WP_043448310.1|1975493_1976594_+|alanine--glyoxylate-aminotransferase-family-protein
MTHPFLDLAPLSAERFASIEDRVARLLSTQQDVLITQGEALLPLEGVIRGCAGPGTTALNVITGPYGQTFGDWLRDCGATVHDLAVPFHAAVTAEQVRAALAEHPEIDFVSLVHAEAATGNTNPVAEIGAVVREHGALFSVDAVASIGAEPVLPDAWGVDLCVIGAQKAMGGPAGVSAVSVSERAWARMAANPRAPRRSYLSLLDWKERWIDGGRRALLHAPAQLEMLALEACVERIEAEGLETVTARHRSAAAATRAGALALGGGLEPYVHEARDAAPVATTLRAPAHLDASELVAKALAVDPGVPLAAGGGSLAAEMIRVNHYGTAASATTVQASLAALGAALTDSGATPDVPAARRAVTQAWT
>NZ_CP023747.1|WP_043439211.1|1976944_1977487_+|diaminobutyrate-acetyltransferase
MTAAQADPKTDSPEISRGLWIDRPRVADGAALWRIAKDSGTLDLNSSYSYLLWCRDFAGTSAVARTEPGGRPVGFVTAYLRPDLPRTLLVWQVAVDSARRGQGLAARMLDALTARVVAEHGVTGIETTITPGNTASERLFTSYARRRGATVERDVLFEAGQFPDGPHDPEVLYRIGPLSP
>NZ_CP023747.1|WP_043439212.1|1977531_1978803_+|diaminobutyrate--2-oxoglutarate-transaminase
MTITQPDLSVFETLESEVRSYCRGWPTVFDRARGSRMYDEDGHEYLDFFAGAGSLNYGHNNPVLKRALIDYLERDGVTHGLDMSTTAKRSFLRAFQDLVLRPRELPYKVMFPGPTGTNAVESALKLARKVKGREAVVSFTNAFHGMSLGSLAVTGNAFKRAGAGIPLVHGTPMPFDHYLDGRVPDFLWFERLLEDQGSGLNQPAAVIVETVQGEGGINVARPEWLRGLADLCARRDMLLIVDDIQMGCGRTGAFFSFEEAGIVPDIVTVSKSISGYGLPMSLCLFKPELDIWEPGEHNGTFRGNNPAFVTATAALNAYWTDGSAMEKQTRARGEQVERELAAITEESPDGIKEYRGRGLVWGLEFHDKGRAERIARRAFDLGLLVETSGPEGEVVKLLPALTVTADELDEGLRTLARAVRETA
>NZ_CP023747.1|WP_043439214.1|1978874_1979270_+|ectoine-synthase
MIVRSFKDIEGTDRHIKAASGTWESKRIVLAREKVGFSLHETILYAGTETSMWYANHIEAVVCTAGEAELTDQETGRTYTITPGTMYLLDGHERHTLRVSEDFHCICVFNPPVTGREDHDENGVYPLLEEA
>NZ_CP023747.1|WP_043439215.1|1979274_1980165_+|ectoine-hydroxylase
MTTPVTDLYPSRGATEVSVPRQDPVVWGAPGTPGPIPVADLQAYERDGFLAMDELIGPDEVARYRRELERLVADPGIRADERAIVEPKSREIRSVFEVHRISEVFAELVRDERVVGRARQILGSDVYVHQSRINVKPGFGASGFYWHSDFETWHAEDGLPHMRTVSVSIALTDNHDTNGGLMIMPGSHRTFLGCAGATPEDNYRRSLRMQEAGTPSDEALTALADRYGIRLFTGRAGSATWFDCNCMHGSGDNITPFPRSNVFIVFNSVENAALEPFAAPVRRPEFIGARDFTPVR
>NZ_CP023747.1|WP_043439218.1|1980226_1981276_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
METFDALVRAEFAPKNTYLNTASTGLLPARTVEAMRTAVESAAAGQPTDMFADVEAARASFARLAAVPVDRVAAGASVAVYTGLIAASLPAGAEVLTAEGDFSSVVNPFHMRGDLRVRAVPLERVAESVGPGTALVAVSAAQSADGRVADLAAVRAAAREHGARMYVDASQAMGWLPLDSGAYDYVAAVAFKWLLCPRGVAFLVAPEDFGGLTPLFAGWVAGEEPWDSCYGPVAELAHSARRFDESPALFSYTGARHSLELLEELGVQHVRAHDLALADRFRAGLRELGVAPLPAPDSPIVSVPGLGARRDGLSRSGVEVSDRAGSLRAAFHLYNTPADVDRLLDVLAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_6

2586318-2586417

Orphan

Consensus_repeat	Method
CCCCGAAAGGGGCGCGGGGAACTGCGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023747_6

>merge|NZ_CP023747|6|2586318-2586417|CRISPRCasFinder
CCCCGAAAGGGGCGCGGGGAACTGCGCGACCAGCCACAACGAGCCCGCACCCGCCGAACCACCCGCACCGGCACCCCGAAAGGGGCGCGGGGAACTGCGC

>NZ_CP023747|6|7|2586318-2586417|CRISPRCasFinder
CCCCGAAAGGGGCGCGGGGAACTGCGC	GACCAGCCACAACGAGCCCGCACCCGCCGAACCACCCGCACCGGCA
CCCCGAAAGGGGCGCGGGGAACTGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043440090.1\|2582518_2583265_-\|DNA-repair-protein-RecO	unknown	unknown	gnl\|CDD\|234622
NZ_CP023747.1\|WP_043440085.1\|2580579_2580996_+\|transcriptional-repressor	unknown	unknown	gnl\|CDD\|133478
NZ_CP023747.1\|WP_043440101.1\|2592276_2593260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440092.1\|2583556_2583805_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440097.1\|2586484_2587150_-\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP023747.1\|WP_043440083.1\|2579618_2580515_+\|metal-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224033
NZ_CP023747.1\|WP_107070526.1\|2588478_2589402_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213235
NZ_CP023747.1\|WP_043440099.1\|2590265_2591267_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440102.1\|2593256_2594174_-\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|223531
NZ_CP023747.1\|WP_043440093.1\|2583921_2584755_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP023747.1\|WP_043440098.1\|2589398_2590229_+\|ABC-transporter-permease	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440100.1\|2591306_2592275_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440087.1\|2581039_2581579_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379553
NZ_CP023747.1\|WP_043448432.1\|2587146_2588355_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP023747.1\|WP_043440103.1\|2594177_2596019_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440096.1\|2585051_2586173_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|223727
NZ_CP023747.1\|WP_043440089.1\|2581648_2582485_-\|isoprenyl-transferase	unknown	unknown	gnl\|CDD\|237826
NZ_CP023747.1\|WP_043440091.1\|2583338_2583557_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_052454087.1\|2596090_2596891_-\|methyltransferase	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440094.1\|2584736_2585009_+\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043440090.1\|2582518_2583265_-\|DNA-repair-protein-RecO	gnl\|CDD\|234622	PRK00085, recO, DNA repair protein RecO; Reviewed.	4.32573e-87
NZ_CP023747.1\|WP_043440085.1\|2580579_2580996_+\|transcriptional-repressor	gnl\|CDD\|133478	cd07153, Fur_like, Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism. A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+. For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions. For example, PerR, a metal-dependent sensor of hydrogen peroxide. PerR regulates DNA-binding activity through metal-based protein oxidation, and co-ordinates Mn2+ or Fe2+ at its regulatory site. Fur family proteins contain an N-terminal winged-helix DNA-binding domain followed by a dimerization domain; this CD spans both those domains.	4.6239e-42
NZ_CP023747.1\|WP_043440097.1\|2586484_2587150_-\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	4.41112e-69
NZ_CP023747.1\|WP_043440083.1\|2579618_2580515_+\|metal-ABC-transporter-permease	gnl\|CDD\|224033	COG1108, ZnuB, ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism].	1.46164e-59
NZ_CP023747.1\|WP_043448432.1\|2587146_2588355_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	5.11627e-47
NZ_CP023747.1\|WP_043440093.1\|2583921_2584755_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	1.23777e-09
NZ_CP023747.1\|WP_043440102.1\|2593256_2594174_-\|DNA-binding-protein	gnl\|CDD\|223531	COG0455, flhG, Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility].	3.41723e-10
NZ_CP023747.1\|WP_043440087.1\|2581039_2581579_-\|hypothetical-protein	gnl\|CDD\|379553	pfam14317, YcxB, YcxB-like protein. The YcxB-like protein family includes the B. subtilis YcxB protein, which is a functionally uncharacterized transmembrane protein. This family of proteins is found in bacteria, and is approximately 60 amino acids in length.	0.000956503
NZ_CP023747.1\|WP_107070526.1\|2588478_2589402_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213235	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter. The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance. Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis. The synthesis of bacitracin is non-ribosomally catalyzed by a multi-enzyme complex BcrABC. Bacitracin has potent antibiotic activity against gram-positive bacteria. The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin. The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC. B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.	5.83421e-89
NZ_CP023747.1\|WP_043440096.1\|2585051_2586173_-\|FAD-dependent-monooxygenase	gnl\|CDD\|223727	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion].	7.6237e-31
NZ_CP023747.1\|WP_043440089.1\|2581648_2582485_-\|isoprenyl-transferase	gnl\|CDD\|237826	PRK14829, PRK14829, undecaprenyl pyrophosphate synthase; Provisional.	3.84972e-132
NZ_CP023747.1\|WP_043440094.1\|2584736_2585009_+\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	2.23319e-20

>NZ_CP023747.1|WP_043440096.1|2585051_2586173_-|FAD-dependent-monooxygenase
MTTPVTIIGAGLGGLILARVLHIHGIPVTVHEAEASPMARAQGGLLDIHDDSGQPALEAARLTDEFRGIVLEGHQAVRILDCNGTVLVDKADDGTGGRPEVLRGELRRILLDSLPGGTVRWGHKVSGARTLGDGHHEVTFGDGTTLVTSLLVGADGAWSRVRPLLSDATPEYAGRSFVETYLYDADTRHPAAAKAVGAGFFGAFDPAVRGRWIGAHRETEGTLHAYVALSESQDWFAGIDFTDRAAATARIAQEFDGWAPELTALITDSDTAPALRLLHALPVGHRWDRVPGVTLVGDAAHLSAPDGNGANLALQDGAELGEALAAHPDDIEAALSEYERALFPRSAASSAEAAEDLAFQELVDLFNQGEQTR
>NZ_CP023747.1|WP_043440094.1|2584736_2585009_+|DUF397-domain-containing-protein
MRGYDLSNARWRKSSHSDGNGGSCVEVAYDFPGAARWRKSTYSNGEGGDCVEVADGVPGVVPVRDSKMPDGAVVVFGSVAWTEFIGAVGL
>NZ_CP023747.1|WP_043440093.1|2583921_2584755_+|helix-turn-helix-transcriptional-regulator
MANGSRQAAWEFFGAELKRRREDQGLTQVELGTRVFVSGGYIGQFEQAIRKPQLDVAQRIDEVLGTSGFFERTWRKLIDDTRYADYFAAVVELERTATKICEFAPTLVPGLLQTAEYTRAVTLATSPFAADEYIDEKVSARMERAQILSNATRPEYWTILHENVVRIPVGGYEVMADQLEHVLTLAGERKMLVTVIPHSAGAYAAMAGMITLMEFDDAPPTAYTEAVYSGNLLDDPALVKRMRATYDLLRVAALSPKASLSLIESAAEDFRRCEGTT
>NZ_CP023747.1|WP_043440092.1|2583556_2583805_-|hypothetical-protein
MAAGPVSCGGRHSARCVEEAEETVKELRAALAEAGVILPSLRLDPVSLAREAPCPLVELGGCSVDVATRLTAALRAQRPAGA
>NZ_CP023747.1|WP_043440091.1|2583338_2583557_-|hypothetical-protein
MQKPPIGSHAVDVRSGRVGVVMGHEGPYVQLRPYGGGREWDVEPEAVRPATPSERLSAATAYANARSRGEVL
>NZ_CP023747.1|WP_043440090.1|2582518_2583265_-|DNA-repair-protein-RecO
MSLFRDDGIVLRTQKLGEADRIITLLTRGHGRVRAVARGVRRTKSKFGARLEPFSHVDVQFFARGSELVGRGLPLCTQSETIAAYGGTIVTDYARYTAGTAMLETAERFTDHEGEPAVQQYLLLVGGLRTLARGEHAPHLVLDAFLLRSLAVNGYAPSFGDCAKCGMPGPSRFFSVASGGAVCGDCRVPGSVVPSPRALELLGALLTGDWETADACEPRYVREGSGLVSAYLHWHLERGLRSLRYVEQ
>NZ_CP023747.1|WP_043440089.1|2581648_2582485_-|isoprenyl-transferase
MAVRGFLGRQRRDYQTPEPHLSGARPPKLPGELVPTHVAIVMDGNGRWAKERGLPRTEGHKVGAERVLDVLQGGIEIGVENISLYAFSTENWKRSPEEVRFLMNFNRDFIRKSRDQLDALGVRVRWVGRMPRLWKSVAQELQIAQEQTKDNDRITLYFCMNYGGRAEIADAAQALAEDVKAGKLDPSKVSEKTLAKYLYYPDMPDVDMFLRPSGEQRTSNYLLWQSAYAEMVFQDVLWPDFDRRDLWRACLEFASRDRRFGGAIPNEELLAMEGKQEE
>NZ_CP023747.1|WP_043440087.1|2581039_2581579_-|hypothetical-protein
MTEQTVEQRATEVVLEYEYRQDELTDAVRLMLRKRGRAGLIHRPVFLVCVGLLGAAVFASGVLQDDPVFFVFGGMFVVWPVLMARVPGITARQLLRANQHHGVMRVTVGEQGMRTVSAHADIRLGWANYGSYAETEQCFVLRSPDRIGACAAVLVKRGASTPEDVDRLRTLLDGSLPRV
>NZ_CP023747.1|WP_043440085.1|2580579_2580996_+|transcriptional-repressor
MTTAGPPVRGRSTRQRAAVAAALDEVDEFRSAQELHDMLKHKGDSVGLTTVYRTLQSLADAGEVDVLRTSDGESVYRRCSTGEHHHHLVCRVCGKAVEVEGPAVEKWAEAVAAEHGYVGVAHTVEIFGTCAECAAAGN
>NZ_CP023747.1|WP_043440083.1|2579618_2580515_+|metal-ABC-transporter-permease
MDFLNYAFMQRALLAAVLVGITAPAVGIYLVQRRQALMGDGIGHVAMTGVGLGFLLSTSPVWMATAVSVLGAVLMELIRWYGRTRGDIALAMLFYGGMAGGVMFINLAPGGSNANLMSYLFGSLSTVSESDVMAICLLAAFVVLVTLGLRRPLFAVSHDEEFARVTGLPVRALNLLTAITAAATVTVAMRVVGLLLVSALMVVPVAAAQQLSRSFAATFAIAVAIGVTVTLTGTITSYYRDVPPGATIVLLTIAVFIVLTGLATPLARRRARALAAAQEAGDPPEYAIPATRAATDEG
>NZ_CP023747.1|WP_043440097.1|2586484_2587150_-|response-regulator-transcription-factor
MTVRVILADDQELIRTALRMVMADIEDVEVVGEASTGAEAVSLTEELGPDVVVMDIRMPEMDGIEATRRITAGSTDARIVVLTTFDDDDYVYGALYAGASGFLVKDMALDDIIGAVRVVAAGDALIAPGVTRRLIRDFTARPEPVRAHRELSGITDREREVLTLVASGLSNTEIAAELYISVATAKTYLTRLLTKLDARDRVQLVIMAYEAGLVSVPRGAS
>NZ_CP023747.1|WP_043448432.1|2587146_2588355_-|sensor-histidine-kinase
MHATTPLPLLKRVPPGAWTVVAWCAGLVFTFIARTRLPGESEPGQYPSHLLHRWDGVTFVVLATATALNGGRLLARRPLAACVCLLLAAVLGTVPLSVGEIPMAQFLAAGVALYFVATSCPRRTARIALALALGTLVTFVAVRLFCWGVAGTSSELAVALIAVILWLLGRSAHQVRAHAERLSAQAAAQAVTTERLRIAREMHDTVAHSIGIIALQAGAATRVATTQPEAAREAMRAVETTGRETLAGLRRMLVALRAADAGHQDDPGTAAGPVSGLDDVDGLAATTTAAGVRVEVRRRGRPRPLPPDIDLSAFRIIQESVTNVVRHSGTHACRVTVDYGEDDIRLEVTDDGRGRGTSTDTGFGLAGMRERVALLHGEFHAAPRPEGGFRVAARLPVPVGVR
>NZ_CP023747.1|WP_107070526.1|2588478_2589402_+|ATP-binding-cassette-domain-containing-protein
MDPVIEVNRLTRRYGDTTAVHDLSFTVRPGRVTGFLGPNGAGKTTTLRMLLGLVEPTSGTATVSGRSFRRHPRGLHHAGALLDAGDVHGGRSARAHLAALARSNRIAARRVDEVLAEVGLTDAAARRRVGGYSLGMKQRLGIAAALLGDPPVLLFDEPLNGLDPEGVLWVRGLFRRLAAEGRTVFVSSHLMSEMEHTADELIVIGRGELIAAESLAEFSARGTRPTVTVRTPDAEALAAALSAEGATVAPQDGETLEVTGLGSDRIGEIAHEHHFLLRELSPQAASLEAAFMELTADSVEYLAGEPR
>NZ_CP023747.1|WP_043440098.1|2589398_2590229_+|ABC-transporter-permease
MTTLALPAARFTDLLAAEWIKLRSLRSTSWALGSSAFAVIAFNANAARADYANYPGYGRVIQENFLSWALRDAFTQGAAMILVLAAASIGAATVVGEYATGLIRTTFTAVPDRRALMAAKVAVVTAVMTVYGAVVASASFAATQAILDGRGQGVPIGHPGALRVVMASALLAPVCALVGMGLGALIRHSATTMVVHVFVLLFLPSFITERYHWTACVRNALPFSAWLRLVDIDYGHQPFTLVSRWPTTVTGGWIVFGAWALVAAVVTVVAVDRRDV
>NZ_CP023747.1|WP_043440099.1|2590265_2591267_-|hypothetical-protein
MNGTTTGEVRAAPQREEQRVSKVFRKTLVTAVVAAGTFLLTNALTPDQGELWQWTVSITLGSATLLVQYLVDFGERLETVEEYQKRRLREMKDRLTAHHAEMREAIDESFAKINDATELFSQVDRSVLRSDGVTRLARKYTQVGEHGSEIVKTFAQEEIGRLASLMESLSNGSAECPGENHEWLIDLTTCARRTVYATSTDVDRDFWFSEPAKRYLAAQGEAIKKRGVQVRRLFLVDEPEHVTEGLRTVCARQRTFGIDARIAVQSRLEPSVQVTPLNDFIIFDGELCYETEPDVRVVPVKTTLKMTPEHVRERVNRFNVLWEATEEGTETAD
>NZ_CP023747.1|WP_043440100.1|2591306_2592275_-|hypothetical-protein
MRAPGESARPVVVCGETRTGLLPSFQALDGRAAAQLLRLRADEHVRVSERPNLYALSPEVLTGVDCRLPTANGARVRGVGTVATRAALTEGRVLQTTARFGAPAAGPDLRRPWGHYLVRPGLVEPLGKLPERAVAEGVLRGNGRGELDLGMIAEGLFAQLMRHPLLDHKAPFKSRRTRLRWVARRAPQGEGPSLARFTLAEDGLRTMELRLPDGTPAAAAAGLCEDLALHDWLLTTVVHMLDSSRLGASDGPSAVLALRPAVDHLLHLWMPGAHVDRTLGQLWDVLEREPGFTRQWGTLVQRIRDQLAVQAIPLLHRALSAP
>NZ_CP023747.1|WP_043440101.1|2592276_2593260_-|hypothetical-protein
MTESVFQETTAQPRTQSVPLSHLSLELGHLYMEDFEAGPERLREHFAEVRIWVEAARAAAARRTGGRRPRISTCFLVDDYFTRFSTPAELVPVVLEEAAQAGLVIDYLARESGCAVADKIEIAESVAHRLVESPPPGSHGSRPPVSQTGWLANGQRTPTSRSAMDEVTGWQPPQETAARNHSVFMDVELWSEKDGQRLWSCPFLAAVWQLARLGLLRHLGEPVLTPRPWNGGDFPYDWDRLPPLLQLSPAAAPFCAYRTCTLMANRFLAVEDAVRLILDQVDVDSGALRQVAERSAREGAAVPAAVAQRAGYVFYEEPAHVSSAEET
>NZ_CP023747.1|WP_043440102.1|2593256_2594174_-|DNA-binding-protein
MLVFAASDKGGTGRSVTSANLAYHRALAGDDVCYLDFDFGSPTAAAVFDVPDARRAAEEQGLHTYLTGETAEPARVDVWADTEHPVLRNRPPGAGRLVLMPGDLSGGEFATTEDNLRRCVDLLLRLNSEFDVIVVDLSAGRSYAVDMALEATSQREMRGVEFRWLVFHRWTRQHVSAAANLVFGRRGILAGGVSRGHDEGALRNAIRFVRAAVPDPESSLWSQVSATQSAWMRACDSDLKQLASSSGIGYSLVLGSVPLEPVLQWREQLITDEDVLDSQIANRETWEALSELAGRLTDDKYWEPA
>NZ_CP023747.1|WP_043440103.1|2594177_2596019_-|hypothetical-protein
MQIKPRQHLLDIWQAVARHSFDGGEWSWGRWGGESSVADAERLLCLLYPATEIPAFRLDDPDTTAEDVQKVLKNAGGRLETPANLVTAAAQFMRTHTSDDKRPSFAGGYYFVSSDPDRGLTEEQRSLGVVDAYSMSITLCLATLGFLKVYESKTRRSEVQETIQELRAATSKRLTAAMVSLLRAFTVNVFDTESSQGRTLCELLGQGRLSQRHVLGNFQRRFRALRAAIAESLVLGVDVEEGLKDENRFFECGWGWSIIRDAPTVETAEEVGPQPEGVASPVPYLYFTVVALDGIQDLFSDRTLTLGLLNAEQQRLAQALRLRWEITQQFWSGIARFDTDRWPLEDIPWRTTGQKLESEYFSLSVGAILVHDLMRRKATDDDLTRTVSVMERLAERGRITSRMTRDDPMVRLHNPGVTLPLQGSESLGPRMQWIMKDFSAQLLKRTIQLCTLSRNLASHDRLLRLAEDIFGQLWRRRIREGEGIGLWDNVHAAYPDSPVSDSPVSWSITERVTEVMVQVQQMYQQQPIRSPDLTELARALLSESTHLLGNEQMEPTPASEGNRGMQLRGIEVKLRRARRLVDDQPGTACALTLDVLGQLDALVRAREAAVQGV
>NZ_CP023747.1|WP_052454087.1|2596090_2596891_-|methyltransferase
MTPRSPSDTQLNADVTWSAFDPIAYVDHNYRDLQAEDAEILHIVRDHFGDHFRDRSETEATGPVSGIDVGAGANLYPALAMLPWCDDITLFERSSANVRYLRSQTASYDANWDQFWRLLCKNPAYAAHDMDPRARFRDTVRVEPGDLFDLVRHRGRWSVGTMFFVAESMTTSHAEFARGVECFLGALAPGAPFAAAFMEHSKGYHAGEHFFPACDVGEPEVHESLKPFAGEFTTVRLKSSAAVREGYSGMIVAYGRRRSEADIPTG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_7

2951882-2952115

Unclear

Consensus_repeat	Method
GGCGGCACCACGGACTCGGGCGGC	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP023747_7

>merge|NZ_CP023747|7|2951882-2952115|CRISPRCasFinder
GGCGGCGCCACCGGGACGGACGGCACCACGGGCACGACCGGGGAACCTGGCAACGGCGGCCCCCAGGAAGACGGCGGCGCCACCACCGGCGGCACCACGGACTCGGGCGGCACCACCGGGGCCGGGGGCACGAACGGCACCGGAGGCAACACCGGGACGGGCGGCGCCACGGACTCGGGCGGCCTCACCGGGGGCGGCGGCACCGGAACCGGCGGCGCCACGGGTGGCGGCGGA

>NZ_CP023747|7|8|2951882-2952115|CRISPRCasFinder
GGCGGCGCCACCGGGACGGACGGC	ACCACGGGCACGACCGGGGAACCTGGCAAC
GGCGGCCCCCAGGAAGACGGCGGC	GCCACCACCGGCGGCACCACGGACTCG
GGCGGCACCACCGGGGCCGGGGGC	ACGAACGGCACCGGAGGCAACACCGGGACG
GGCGGCGCCACGGACTCGGGCGGC	CTCACCGGGGGCGGCGGCACCGGAACC
GGCGGCGCCACGGGTGGCGGCGGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043440567.1\|2954891_2955590_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|238038
NZ_CP023747.1\|WP_043448526.1\|2944178_2945516_-\|DUF445-domain-containing-protein	unknown	unknown	gnl\|CDD\|377281
NZ_CP023747.1\|WP_043440539.1\|2942288_2942591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440552.1\|2952235_2952556_-\|multidrug-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|171110
NZ_CP023747.1\|WP_043440570.1\|2955733_2956336_-\|RdgB/HAM1-family-non-canonical-purine-NTP-pyrophosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP023747.1\|WP_043440575.1\|2958610_2959342_-\|ribonuclease-PH	unknown	unknown	gnl\|CDD\|178914
NZ_CP023747.1\|WP_079162121.1\|2945836_2946730_-\|DUF1707-and-DUF2154-domain-containing-protein	unknown	unknown	gnl\|CDD\|377959
NZ_CP023747.1\|WP_043440557.1\|2953115_2953454_-\|DUF3618-domain-containing-protein	unknown	unknown	gnl\|CDD\|378834
NZ_CP023747.1\|WP_043440560.1\|2953624_2954092_+\|thioredoxin-dependent-thiol-peroxidase	unknown	unknown	gnl\|CDD\|224146
NZ_CP023747.1\|WP_043440549.1\|2948694_2949495_-\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|226953
NZ_CP023747.1\|WP_043440529.1\|2939918_2940392_-\|carboxymuconolactone-decarboxylase-family-protein	unknown	unknown	gnl\|CDD\|225039
NZ_CP023747.1\|WP_043440534.1\|2940881_2941247_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043440554.1\|2952730_2953072_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|197951
NZ_CP023747.1\|WP_043440573.1\|2957971_2958478_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|171499
NZ_CP023747.1\|WP_043440547.1\|2947826_2948702_-\|ABC-2-family-transporter-protein	unknown	unknown	gnl\|CDD\|253605
NZ_CP023747.1\|WP_043440564.1\|2954232_2954895_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|238038
NZ_CP023747.1\|WP_043448533.1\|2956480_2957872_+\|SMI1/KNR4-family-protein	unknown	unknown	gnl\|CDD\|378155
NZ_CP023747.1\|WP_043440537.1\|2941351_2942032_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043448529.1\|2946764_2947724_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213234
NZ_CP023747.1\|WP_043440542.1\|2942613_2944116_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043440567.1\|2954891_2955590_+\|HNH-endonuclease	gnl\|CDD\|238038	cd00085, HNHc, HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.	8.41131e-05
NZ_CP023747.1\|WP_043448526.1\|2944178_2945516_-\|DUF445-domain-containing-protein	gnl\|CDD\|377281	pfam04286, DUF445, Protein of unknown function (DUF445). Predicted to be a membrane protein.	1.25281e-133
NZ_CP023747.1\|WP_043440552.1\|2952235_2952556_-\|multidrug-efflux-SMR-transporter	gnl\|CDD\|171110	PRK11431, PRK11431, quaternary ammonium compound efflux SMR transporter SugE.	4.15322e-28
NZ_CP023747.1\|WP_043440570.1\|2955733_2956336_-\|RdgB/HAM1-family-non-canonical-purine-NTP-pyrophosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	1.74314e-103
NZ_CP023747.1\|WP_043440575.1\|2958610_2959342_-\|ribonuclease-PH	gnl\|CDD\|178914	PRK00173, rph, ribonuclease PH; Reviewed.	2.96474e-173
NZ_CP023747.1\|WP_079162121.1\|2945836_2946730_-\|DUF1707-and-DUF2154-domain-containing-protein	gnl\|CDD\|377959	pfam08044, DUF1707, Domain of unknown function (DUF1707). This domain is found in a variety of Actinomycetales proteins. All of the proteins containing this domain are hypothetical and probably membrane bound or associated. Currently, it is unclear to the function of this domain.	8.35844e-22
NZ_CP023747.1\|WP_043440557.1\|2953115_2953454_-\|DUF3618-domain-containing-protein	gnl\|CDD\|378834	pfam12277, DUF3618, Protein of unknown function (DUF3618). This domain family is found in bacteria, and is approximately 50 amino acids in length.	6.92599e-11
NZ_CP023747.1\|WP_043440560.1\|2953624_2954092_+\|thioredoxin-dependent-thiol-peroxidase	gnl\|CDD\|224146	COG1225, Bcp, Peroxiredoxin [Posttranslational modification, protein turnover, chaperones].	3.55798e-72
NZ_CP023747.1\|WP_043440549.1\|2948694_2949495_-\|ABC-2-family-transporter-protein	gnl\|CDD\|226953	COG4587, COG4587, ABC-type uncharacterized transport system, permease component [General function prediction only].	1.86822e-30
NZ_CP023747.1\|WP_043440529.1\|2939918_2940392_-\|carboxymuconolactone-decarboxylase-family-protein	gnl\|CDD\|225039	COG2128, COG2128, Uncharacterized conserved protein [Function unknown].	2.26284e-23
NZ_CP023747.1\|WP_043440554.1\|2952730_2953072_-\|co-chaperone-GroES	gnl\|CDD\|197951	smart00883, Cpn10, Chaperonin 10 Kd subunit. The chaperonins are 'helper' molecules required for correct folding and subsequent assembly of some proteins. These are required for normal cell growth, and are stress-induced, acting to stabilise or protect disassembled polypeptides under heat-shock conditions. Type I chaperonins present in eubacteria, mitochondria and chloroplasts require the concerted action of 2 proteins, chaperonin 60 (cpn60) and chaperonin 10 (cpn10). The 10 kDa chaperonin (cpn10 - or groES in bacteria) exists as a ring-shaped oligomer of between six to eight identical subunits, while the 60 kDa chaperonin (cpn60 - or groEL in bacteria) forms a structure comprising 2 stacked rings, each ring containing 7 identical subunits. These ring structures assemble by self-stimulation in the presence of Mg2+-ATP. The central cavity of the cylindrical cpn60 tetradecamer provides as isolated environment for protein folding whilst cpn-10 binds to cpn-60 and synchronizes the release of the folded protein in an Mg2+-ATP dependent manner. The binding of cpn10 to cpn60 inhibits the weak ATPase activity of cpn60.	7.10284e-27
NZ_CP023747.1\|WP_043440573.1\|2957971_2958478_-\|hypothetical-protein	gnl\|CDD\|171499	PRK12438, PRK12438, hypothetical protein; Provisional.	0.00408987
NZ_CP023747.1\|WP_043440564.1\|2954232_2954895_+\|HNH-endonuclease	gnl\|CDD\|238038	cd00085, HNHc, HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.	4.44795e-05
NZ_CP023747.1\|WP_043448533.1\|2956480_2957872_+\|SMI1/KNR4-family-protein	gnl\|CDD\|378155	pfam09346, SMI1_KNR4, SMI1 / KNR4 family (SUKH-1). Proteins in this family are involved in the regulation of 1,3-beta-glucan synthase activity and cell-wall formation. Genome contextual information showed that SMI1 are primary immunity proteins in bacterial toxin systems.	1.40607e-11
NZ_CP023747.1\|WP_043440547.1\|2947826_2948702_-\|ABC-2-family-transporter-protein	gnl\|CDD\|253605	pfam06182, ABC2_membrane_6, ABC-2 family transporter protein. This family acts as the transmembrane domain (TMD) of ABC transporters. The family includes proteins responsible for the transport of herbicides.	7.33079e-63
NZ_CP023747.1\|WP_043448529.1\|2946764_2947724_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213234	cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA. NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake. NatB possess six putative membrane spanning regions at its C-terminus. In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the proton-motive force across the membrane. The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunorubicin- and doxorubicin-efflux system. Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single integral membrane protein.	2.94104e-127
NZ_CP023747.1\|WP_043440542.1\|2942613_2944116_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.87828e-33

>NZ_CP023747.1|WP_043440549.1|2948694_2949495_-|ABC-2-family-transporter-protein
MGTGRLYAAVAAGGFRRYATYRMATAAGVFTNTVFGLILAYTYLALWDQRPHLGGYDQAQAVTFVWVSQGLLMTVAVLGGGFEDELIERIRTGDIAVDLYRPADLQLWWLASDLGRALFHLLGRGLLPLVFGALLFPLALPVSPLTWVAFLIAVLLGTLVSFAIRFVVALCAFWLLDGAGVSQLAVLTAIFCSGMLLPLNVFPGALGEVVRLLPWSALLQAPVDILLGTADPLPTYAFQALWAVLLLALGRLVQSAATRRVVVQGG
>NZ_CP023747.1|WP_043440547.1|2947826_2948702_-|ABC-2-family-transporter-protein
MAETFRAGAGEGDRGWAREGEGGRVREGLRAYRLITAMWIRSTMAYRASFVMNTLGNFAGTALDFVAIMLMFSQVDALGGYRLPEVAFLYGLSATAFGIADLALGSMDRLGRRVRDGTLDTLLVRPAPVLAQVAADRFGLRRLGRILQGLLILGYAVAALDLSWTPLKVLMVPMALLSGAAIFCAVFVAGAAFQFVALDASEVQNSFTYGGQTLLQYPPTVFARELVRGVTFVLPLAFVNWLPALYVLGRPYPLDLPLWVAFAPPLVGAGCCALAGLAWRAGLRSYRSTGS
>NZ_CP023747.1|WP_043448529.1|2946764_2947724_-|ABC-transporter-ATP-binding-protein
MRLERVEKVFDVRRRTGFLRSERRQVRAVDSISFSVARGEMVGYIGPNGAGKSTTIKMLTGILTPSGGRLRVAGIDPSRERTRLARRIGVVFGQRTTLWWDLPLIDSYRLMHRMYRVPDARFRENLDRCVELLELGALLDVPVRQLSLGQRMRGDIAAALLHDPEVLYLDEPTIGLDVVSKAKVREFLRDLNAERGTTVLLTTHDLQDIEQLCSRVMVIDQGRLMYDGPLTGLHAVGDSERTLVVDLERELPPIRTPDARVVRVEGPRQWLAFPASRSAAPLVAQIAAEYPVVDLSVREPDIEAVIAKMYAGQLERTLS
>NZ_CP023747.1|WP_079162121.1|2945836_2946730_-|DUF1707-and-DUF2154-domain-containing-protein
MSDAVSSGGSDDRRPMPQSPSTPTPELRASDADRDRVAEALREAVAEGRLDMEEFEERLEATYRARTYGELEPITRDLPSPGVTAPPISLRKEPEESGGWGERIVGGGGSSSWAVAVMSGFQRKGRWTAPKRFTCFAFWGGGEIDLREADFADREVEINCVAIMGGMNVIVPPGVEVVVRGIGIMGGFDHRQEGVPGDPGAPRVVITGLAFWGGVGVERKLTRADRQRLKEERRQDKLDRRTARKELHASFREDIEGAHREMFEAHRDLMRDRHEELRQRRQERRDARRERRRDGEY
>NZ_CP023747.1|WP_043448526.1|2944178_2945516_-|DUF445-domain-containing-protein
MERTEPDDTAAEGPPSRSGIAPSRAMTSFSPADEEKRRGVRRMKSTATGLLLLVALVYVLATWARNAGAGTWAGYVAAAAEAGMVGALADWFAVTALFRHPLGLPIPHTAIIPNKKDQLGVSLGEFVGENFLSGEVVRQRLRAVGITARLGAWLAEPEHADRVTAELATALRGALTVLRDSDVQAVVGEAITRRAGAQEIAPGLGKMLERVVADGGHKRIVDLVCVRAHDWLVLHDDQVMGAVQGGAPGWTPRFVDKKVGERVYKELLRFVTEMRDEPTHPARGALDRFLSDFASDLQSDTDTRARVERLKGEVLGRGEVQDLIASAWTAVRSMLVAAASDERSELRLRVRSSLLSLGARMATEPSTQAKVDTWAEGAAVHVVTTYRKEITSLITDTVAGWDAVHTTRKIEAHIGRDLQFIRINGTVVGSLAGLLIYTVSRALGA
>NZ_CP023747.1|WP_043440542.1|2942613_2944116_-|MFS-transporter
MAHTEPRPGTITTAIPARLDRLPWSRWHWRIVIGLGTVWILDGLEVTVVGNIAGRLSEPGSGLPISSGEVTGVAAAVYVAGACSGALFWGRLTDRYGRKKLFMITLAVYLGATALTAVSFQTWWFFLFRFFTGFGIGGEYAAINSAIDELIPAYYRGRVDLIINGSFWLGAVGGSLLSILALNTAVLPKDVGWRLTFALGVVLGLVILLVRRTVPESPRWLLIHGRHQEAERVVSDIEHRIVAEKGAPLPRPAGELTIHQRPSIGFGEIARTVFTAYRRRAVLGFSLFIGQAFLYNAITFGFGAILTRFFHVPTGNTGYYFGVIAAGNFCGPLLLGKLFDTVGRRVMISSTYLVSGLLLFGTAWLFGRGSLTAVTLTACWCAVLFVASAGASSAYLTVSEVFPMETRAMAIAFFYALGTAAGGISGPLLFADLTNTGHVRDTVLAFGIGAALMCAAGLVAALIAVPAERRSLEDVARPLTAAEQASGTVRADERRGRAPE
>NZ_CP023747.1|WP_043440539.1|2942288_2942591_+|hypothetical-protein
MAKVPTALVAASGLVGGYGVARWTGKRQLGGAVLAVAGAAAAQQWRKQAGGTAAGVLTAAYVAAFAGSHPLAKKVGAWPAVFGVTGAVALASWAVADRRG
>NZ_CP023747.1|WP_043440537.1|2941351_2942032_-|hypothetical-protein
MTRSGPDTGKSAGRRGGGVRQAALLAVTVLVATACTASSQDREAKAAASPKPTEVSVSQWICENGRFHWGEIRTTGKLVAVSQLVRVEKGEQAASVKFQAVPVREVTAGIDSSAKVSEELVFASLEQHMNLGGKRLAQNGESVPMADFGTDDMTGKNGDYLSVIGVQVVEASFVQGCAGNAKAPVYGTVTTWYEKTAGMIKCGRNPGTYPGFREAHDLVCGEEPRT
>NZ_CP023747.1|WP_043440534.1|2940881_2941247_+|hypothetical-protein
MLGIQTDALDTAGGVFMTVLALGCTWLGGLAVLRPHRPPQPIGGPVWVARAWGLGYVVLGISMAAKMTAMLVGKEPAWPMTVIHWAAGPLLLFSVTAAVVSQWRARRRAGRVVSGRHGRHK
>NZ_CP023747.1|WP_043440529.1|2939918_2940392_-|carboxymuconolactone-decarboxylase-family-protein
MEARLDIFANPVAGKFLKYLNSAGKAVTDSTLPAAIQELVKIRASQINGCAFCLDMHTKDAAHAGETSLRLNLVAAWREAKVFTEAERAALELAEQGTRIADASGGVTDAAWANAAKHYDEEQLAALVTLIALINTYNRLNVITQQPAGDYQPGMFG
>NZ_CP023747.1|WP_043440552.1|2952235_2952556_-|multidrug-efflux-SMR-transporter
MAWVLLVVAGLLEVGWSVGMKYTDGFTRLWPSLATGAGIVASMLLLSYAARSLPIGTAYGVWVGIGAAGAAVLGMVVLGEPVTAARTFFVSLLVVAVVGLKATSGH
>NZ_CP023747.1|WP_043440554.1|2952730_2953072_-|co-chaperone-GroES
MSEKTHHDKLPIRMLHDRVLVRQDAAEGERRSGGGILIPATAAVGRRLAWAEVVAVGQNVRTVEPGDRVLYDPEDRAEVEVRGTAYVLMRERDLHAVAADRFEGSEDSTGLYL
>NZ_CP023747.1|WP_043440557.1|2953115_2953454_-|DUF3618-domain-containing-protein
MTDTSSTPDTRTPAQIEADIKRRRETLAETLDEIGVRVHPKTIVGDARAKVVSQVDHTLGRAYVGANRVVSQVKGQLVTEDGAPRLERLLPVAMVVVGVVGLLAYGARRRKD
>NZ_CP023747.1|WP_043440560.1|2953624_2954092_+|thioredoxin-dependent-thiol-peroxidase
MSERLQPGDTAPAFTLPDADGKEVSLADHRGRKVIVYFYPAALTPGCTKQACDFTDNLELLAGAGYDVIGISPDKPEKLAKFREKESLKVTLLSDPDKQILEAYGAFGEKTMYGRTVVGVIRSTVVVDEEGKVERALYNVRATGHVAKIIKDLSL
>NZ_CP023747.1|WP_043440564.1|2954232_2954895_+|HNH-endonuclease
MGVGAFDKERLQAAAATARTLTEALESLGVDPKSSTRRYVLERMKKLGVDVSHFEREGIKWSRDTLQAAVSASTNMYEVLRRLGLDAVGGHHTHISRRIKAYGIDTSHFTPVVRTERMRHNQRRRTPHEILVEDTSAEARRVPSSRLKRAMRELGITQRCFLCGIEPVWLGEPLPLEVDHIDGNWRNNRVENLRLLCPNCHSTTDTYRGRAKARPKGSRV
>NZ_CP023747.1|WP_043440567.1|2954891_2955590_+|HNH-endonuclease
MTSGVPYTRERLAEAAAQCSDMDEVIAFLGTRPYANLRRYLYQRFEHFGIDVSHFPRKGRHGSQGRPDEGQLRNAVARSASIAGVLRILERPDNARQRALFSRLTTHYGIDTSHFLGQGHRRGKPGPNPRKRPEDVLVQHNGTHRTATKRLRRALREAGVPERCARCGTGPEWLGGPMTLEIDHINGDWHDDRRENLRLLCPNCHAITATWCRGGRRTVHVMTASPSALSAQ
>NZ_CP023747.1|WP_043440570.1|2955733_2956336_-|RdgB/HAM1-family-non-canonical-purine-NTP-pyrophosphatase
MSRLILATRNPGKITELRAILAEAGLPHDLVGADAYPDIPDVKETGVTFAENALLKAHALARATGLPAVADDSGLCVDVLNGAPGIFSARWAGRHGDDRANLELLLAQIADIDDAHRGAHFACAAALALPDGTERVVEGRLLGTLRHAPAGTNGFGYDPILQPEGDTRTCAELTPDEKNKISHRGQAFRALVPVVRELLA
>NZ_CP023747.1|WP_043448533.1|2956480_2957872_+|SMI1/KNR4-family-protein
MSSVHDFATWEPVLRLLLADDTERRAARSARVAGRISRSGWSLALPGRMSSTEQIAVQDIQRALARGRVEEIAFRAEVQPDGSTTLGLVWPSPVVEAAVGYPDLGVLVLADGSLPEPWRRLPDPVPGAMPAPSADLGLLDRTLRERLPDAIGATEGEIAAAEARLGVTLSDELKVVYRVTRAQWEDWGDDYIAADRVTTAVGCELSALDDLYGVDAAARHSHWGLSATKAVSTPPDAAVQGLAGSPGWIVFGGNGGDQLAVDLTPGPGGHLGQVILVDHEQSLGAELMADSLTDFVLGRVREERRDRRGDQLPVVARVGSGSLETIQAAAHPALEVLSIGVWDGTPFSLAPVTGLPRLRTLTAFPGTLADPLEVAGLAGLEFLELGVQEWRVLLDAGAVPRTLSAAAIKVRDQDHLPVVAIANEILALWDRPQIVQTLLEGDLGPAAQPMGHARRGVAGPAGS
>NZ_CP023747.1|WP_043440573.1|2957971_2958478_-|hypothetical-protein
MAARRRRSAVTAALAAVAVFAAVGASAGCGAAGRAIDCVGTADAIADGVTDLQQTVERTANEPAPTATPPDPSGPSDPSGSPASPAPPVPSEPPASRDSHDTLHSLDSLEEKLEGFGGETDDVNVGKAVDALRESVGAVREAVEGGESSPDLGPVTDAAGELTKACTA
>NZ_CP023747.1|WP_043440575.1|2958610_2959342_-|ribonuclease-PH
MSRIDGRTPDQLRPITIQRGWSKHAEGSVLVSFGDTRVLCTASVTEGVPRWRKGSGEGWVTSEYAMLPRATNTRGDRESVKGRIGGRTHEISRLIGRSLRAVVDYKALGENTIVLDCDVLQADGGTRTAAITGAYVALADAVAWAQGKKLVKAGRKPLTGTVAAVSVGIVDGVPLLDLCYEEDVRAETDMNVVCTGDGRFVEVQGTAEAEPFDRKELNALLDLAVAGCDQLAEIQRAALEATA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_8

3671080-3671368

Orphan

Consensus_repeat	Method
ACGGTCACNGTCNCGNCGG	CRT

5 spacers

The CRISPR arrays of NZ_CP023747_8

>merge|NZ_CP023747|8|3671080-3671368|CRT
ACGGTCACCGTCACGACGGAAGCCGCCCCGGTCGTCACGACGCTCGAACGAACGACCACCACGGTCACCGTCACGACGGTCGAAACCACGCTCACCGTCACGACGGTCGCGGTCGAAGGGGCGACGGTCACGGTCACCGTCACGACGGAAGCCACCGCGGTCGTCACGACGCTCGAACGAACGACCACCACGGTCACCGTCACGACGGTCGAAACCACGCTCACCGTCACGACGGTCACGGTCCCGGCCGAAGCCACCACGGTCGTCCCGGCGGTCACGGTCGAAGGGG

>NZ_CP023747|8|3|3671080-3671368|CRT
ACGGTCACCGTCACGACGG	AAGCCGCCCCGGTCGTCACGACGCTCGAACGAACGACCACC
ACGGTCACCGTCACGACGG	TCGAAACCACGCTCACCGTCACGACGGTCGCGGTCGAAGGGGCGACGGTC
ACGGTCACCGTCACGACGG	AAGCCACCGCGGTCGTCACGACGCTCGAACGAACGACCACC
ACGGTCACCGTCACGACGG	TCGAAACCACGCTCACCGTCACG
ACGGTCACGGTCCCGGCCG	AAGCCACCACGGTCGTCCCG
GCGGTCACGGTCGAAGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043441707.1\|3669770_3670088_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043441724.1\|3684720_3685830_+\|Glu/Leu/Phe/Val-dehydrogenase	unknown	unknown	gnl\|CDD\|223411
NZ_CP023747.1\|WP_052454147.1\|3662762_3664856_-\|two-component-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP023747.1\|WP_043441701.1\|3666706_3667312_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP023747.1\|WP_043441698.1\|3665616_3666570_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP023747.1\|WP_079162177.1\|3668847_3669531_+\|DUF998-domain-containing-protein	unknown	unknown	gnl\|CDD\|225906
NZ_CP023747.1\|WP_043441703.1\|3667595_3668522_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043441718.1\|3682100_3682292_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_079162180.1\|3674047_3674452_-\|metallopeptidase-family-protein	unknown	unknown	gnl\|CDD\|240572
NZ_CP023747.1\|WP_079162176.1\|3659834_3661184_-\|serine/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272
NZ_CP023747.1\|WP_003949541.1\|3682814_3683021_-\|developmental-transcriptional-regulator-BldC	unknown	unknown	gnl\|CDD\|133390
NZ_CP023747.1\|WP_043441713.1\|3676795_3676981_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043441727.1\|3686101_3686350_+\|DUF3073-domain-containing-protein	unknown	unknown	gnl\|CDD\|378620
NZ_CP023747.1\|WP_043441695.1\|3661557_3662706_-\|dihydrofolate-reductase-family-protein	unknown	unknown	gnl\|CDD\|224896
NZ_CP023747.1\|WP_043448763.1\|3664852_3665611_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223912
NZ_CP023747.1\|WP_052454149.1\|3677071_3677398_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043441690.1\|3658393_3659434_-\|M23-family-metallopeptidase	unknown	unknown	gnl\|CDD\|366703
NZ_CP023747.1\|WP_043441721.1\|3683620_3684463_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043441715.1\|3677564_3681542_+\|ATP-dependent-RNA-helicase-HrpA	unknown	unknown	gnl\|CDD\|182986
NZ_CP023747.1\|WP_043441711.1\|3674482_3676099_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|365906

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_079162177.1\|3668847_3669531_+\|DUF998-domain-containing-protein	gnl\|CDD\|225906	COG3371, COG3371, Predicted membrane protein [Function unknown].	4.88908e-08
NZ_CP023747.1\|WP_052454147.1\|3662762_3664856_-\|two-component-sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	1.737e-30
NZ_CP023747.1\|WP_043448763.1\|3664852_3665611_-\|ABC-transporter-permease	gnl\|CDD\|223912	COG0842, COG0842, ABC-type multidrug transport system, permease component [Defense mechanisms].	6.94247e-13
NZ_CP023747.1\|WP_043441698.1\|3665616_3666570_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	3.18812e-91
NZ_CP023747.1\|WP_043441711.1\|3674482_3676099_+\|metallophosphoesterase	gnl\|CDD\|365906	pfam00149, Metallophos, Calcineurin-like phosphoesterase. This family includes a diverse range of phosphoesterases, including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this superfamily centre around the metal chelating residues.	1.85993e-14
NZ_CP023747.1\|WP_043441715.1\|3677564_3681542_+\|ATP-dependent-RNA-helicase-HrpA	gnl\|CDD\|182986	PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional.	0
NZ_CP023747.1\|WP_003949541.1\|3682814_3683021_-\|developmental-transcriptional-regulator-BldC	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	3.77068e-14
NZ_CP023747.1\|WP_079162180.1\|3674047_3674452_-\|metallopeptidase-family-protein	gnl\|CDD\|240572	cd12952, MMP_ACEL2062, Minimal MMP-like domain found in Acidothermus cellulolyticus hypothetical protein ACEL2062 and similar protein. The subfamily includes an uncharacterized protein from Acidothermus cellulolyticus (ACEL2062) and its homologs from bacteria. Although its biological role remains unclear, ACEL2062 contains a minimal metalloprotease (MMP)-like domain consisting of 3-stranded mixed 2-beta sheets and a HExxHxxGxxD/S (x could be any amino acid) motif. It may belong to a superfamily of bacterial zinc metallo-peptidases, which is characterized by a conserved HExxHxxGxxD motif.	5.33453e-49
NZ_CP023747.1\|WP_079162176.1\|3659834_3661184_-\|serine/threonine-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	2.25161e-37
NZ_CP023747.1\|WP_043441724.1\|3684720_3685830_+\|Glu/Leu/Phe/Val-dehydrogenase	gnl\|CDD\|223411	COG0334, GdhA, Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism].	3.1096e-88
NZ_CP023747.1\|WP_043441695.1\|3661557_3662706_-\|dihydrofolate-reductase-family-protein	gnl\|CDD\|224896	COG1985, RibD, Pyrimidine reductase, riboflavin biosynthesis [Coenzyme metabolism].	4.52094e-42
NZ_CP023747.1\|WP_043441701.1\|3666706_3667312_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	2.00533e-56
NZ_CP023747.1\|WP_043441690.1\|3658393_3659434_-\|M23-family-metallopeptidase	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	4.23578e-36
NZ_CP023747.1\|WP_043441727.1\|3686101_3686350_+\|DUF3073-domain-containing-protein	gnl\|CDD\|378620	pfam11273, DUF3073, Protein of unknown function (DUF3073). This family of proteins with unknown function appears to be restricted to Actinobacteria.	5.40346e-20

>NZ_CP023747.1|WP_043441707.1|3669770_3670088_-|hypothetical-protein
MRDRVDQIRREAEHAGIPGRDVRTRYGVGRSSRSDEVAVAVGKTRPTTVWGVSAADAVAAAVALAMPTGDPYAVKATEQACARMTSRMDRMRARIPAIGAEFTVP
>NZ_CP023747.1|WP_079162177.1|3668847_3669531_+|DUF998-domain-containing-protein
MKTRIGYAAWVAGVVQFFAVHGIVESAWARPYSWARNNISDLGNAHCAMQSDPEPRYICSPEHGLMNASFIALGTLLVVGVAFTGALWRRGATAVVTRCLLACAGMGFALAGLAPADVYENQHVLGALLIMAMGNIGLLLAGVGLADTAPGPLRWATGLLGVIAITAFGLFLSHRYLGLGMGGMERVAAFPLLVWALSAGLRGLLQQAPRMQDAPPGRPTAQATRRG
>NZ_CP023747.1|WP_043441703.1|3667595_3668522_-|hypothetical-protein
MQRSDVTRDDGTWVGLSLDVQDRHQPGLCVFSAGPRLLVSRLSRPVLLAVVDEQLEGVDFWRTDEYRSFVPPLRADVGRALAGSPERWAHRFAQYLIDSPDSPLHEGRWLLSRESPLRRWRHADTSHAEHWSSMLVDGHPDGYIDWFFHSHSWEVLPLRPMPDADDSRVKAYRKQAREGTLPPVLLWWVSGLDCHLILDGHARLAAAIAESVDPPLLQLHRTVPRDDLAARINEAVGFYENELARFAELRAVHGPTVPDGAATAGPQLVRLLHDLNTAEQPTWAWPLPGGEGQWRRIAREVTAGQDWP
>NZ_CP023747.1|WP_043441701.1|3666706_3667312_+|response-regulator-transcription-factor
MIRVLLADDEHLIRGALAALLSFEEDLTIVAEAATGPEAVAMALHQAPDVAVLDLQMPGKDGIEVARELSRALPDCRSLIVTSHGLPGHLKRALSHGVRGFVAKTTSAEQLATIIRTVHLGGRHIDPDLASDAISAGDSPLTPRETDVLALAADGAPIEEIADRAALAPGTVRNYLSAATTKLGAENRHAAAHLARRRGWI
>NZ_CP023747.1|WP_043441698.1|3665616_3666570_-|ABC-transporter-ATP-binding-protein
MDSEDLVIEARGLRRRYGAQRGAGFEAVRGIDLSVARGELFALLGTNGAGKTSTVELLEGLAAPAEGRVRVLGRDPYRERHRVRPRIGVMLQEGGFPGELTVRETLRMWAGCVSGARPPAEALELVGLGGRAGVRVKHLSGGERRRLDLASALLGRPEVLFLDEPTTGMDPEGRQETWRLVRSLQRDGTTVVLTTHYLDEAEQLADRIAIMHQGRIIIGGTPAEVTAARPSRIRFVLSGEGAADRLPPSVTSTATVTVTGDRVEVRTPRLQQTLTELLLWARRQEIELTGLDARSASLEEAFLEIARDRTEREGAAA
>NZ_CP023747.1|WP_043448763.1|3664852_3665611_-|ABC-transporter-permease
MTVARMRALGRAELTLLLRAKSALFTGAAAPVLLTVGLWSAVGEMDLAGTGLSPGTIMLPGAVGFMLLFTVYSNLVGVYVARREELVLKRLRTGEATDPEILVGSALPAAVLTVLQVLVLVVAGPTLLRVPMPSRPDLLAAGVLLGLVMTAAMAAVSSATTRSVEAAQVTPLPVMLVSLMGSGMFIPLDVMPDRVAEVCRLLPLSPVMELVRGGWAGGQEAAVTLRSLALAAVWTGLMLLAARRWFRWERRG
>NZ_CP023747.1|WP_052454147.1|3662762_3664856_-|two-component-sensor-histidine-kinase
MSRYEGGLDPWSRALGWWGDKGASARVELYTRWTFHCVALIQLLAVAGPVALSDGPGAPRAVLATLLALHSGLTALACSRALGSLLDHREPPMRLVAAHMALSGLVVVVAVTLARAGTDPAQRSMAVAVALGPVIFGPMAPALVARPGRVAQLVLSFSVALVLLMSVLSLPWQQTVVLGMASLGGGLLMAFSSRFSVWLLAVVLELESARVTQARLAVAEERLRIGRDLHDVMGRNLTVIALKGELAVQLARRGSPAAVAQMVEVQRIARDSHREIREVVRGYRVADLHAELIGAGEVLRAAGIDCGIKDGCVDVLPEATAAQLGWVIREGTTNVLRHADADRCTIRLRQVAAAGGRVWELVMENNGARPGQGAGQDGSGPAGSAVREGSGLAGLRERLAGQGGVLRAERQPRGVFRLTVRIPVTPTETAGASAAPATPVEASVTPVASPPAPVEAPATSPAVEARPAPVAAARATVTEGTTGTTGSGASSRPSGAGLLRVLGGSLASWVARRPLREAGNGKHLLAHSSDTRQMITVLAVLEIVAAFLVSLMIPPVLRPYHAVFEVLLVLTALGAVAATARHPHLVSDAQVVLRTGLLGELVLPRGAVRSASRVLRTVPGRGLRPVAGDARAVACSVGGTVDVCLRLDPPVAVDLGESGVVAAGTVYTSVDSPEAFLRALRMSDVPRPAPHAVDERP
>NZ_CP023747.1|WP_043441695.1|3661557_3662706_-|dihydrofolate-reductase-family-protein
MAHPYVLLSAAVSLDGFLDDTGPERLLLSGPGDFDRVDEVRAGCDAILVGAGTLRTDNPRLLVNSAERRANRVAAGLPEYPLKVTVSASGNLDPDARFWHTGGAKTVYTTDRGAERLRGRLPGEVAVVALGPEVEWRAVLAHLGDVEGVRRLMVEGGGQVHTQLLRQGLADELQLAVAPLFVGEAEAPRMFGPGAYPPGRMRLLETRPVGDVVLMRYVPVAPGTGRLASAADRRWLAEACELAALCPPSRTAFSVGAVIVAADGTELARAYSREGGDPVVHAEEAALAKLDPADPRLAAATVYSSLEPCARRASRPAPCARLILEAGVRRVVTAWREPDTFVTAADGSGVLASEGVEVVVLPEYEERAKAPNAHLSPPPGRS
>NZ_CP023747.1|WP_079162176.1|3659834_3661184_-|serine/threonine-protein-phosphatase
MSGPGSAPVRKGPERSEGLHRGSYDSSHDGTGAQGLYGDGRPGGRGRSPGRVRHPEPDRDRPGDRLPGGHVPGSEAGTADGASPPGGRTPSRRFSLAHGFVRALPMLLIVAGVCYDLLTPPANTAGPLFTAAALVAAPLYSLRGTVLTGAAAVGSVVGIHFAIGRLQQTEEITEAVTVFTAAVLSVLINVLVRRNVARLASAREIAGAAQRAVLPEPAARIDGLDIAARYEAAQADAFIGGDLYAVQECAQGVRLLVGDVRGKGMGAVAAVAVVVGAFREAVEHESRPEAVTRRLERALMRERTLRGGLEEAEGFVTAVIAEIARCGVVRIVNRGHPAPLLLLPDGTLRTLETREPALPLGLGELGDGPGRAEEWDFPPGAMLLLYTDGLSEARDEHGEFYDPAVRLAGRVFAGPGALLATVTAEVAQHTGGRAVDDMALLAVRRRAVP
>NZ_CP023747.1|WP_043441690.1|3658393_3659434_-|M23-family-metallopeptidase
MASNRPAQSSSLTTDGTQPFAFTPRADDGPWEEWNPTEESVRPVRGKHRVAKQRGGGLARSSTVLGVGVMAAVGAGGMATAQSGKPPVSISMPDIASLTHSAKTFIVEDTGAEEPQGSATALSTVGLTTADAEAGSQDAGEALRARIMQQAESQQDRVALEAAKAAEDAAAKKASEAAAKAQDDAKAKAAAEKKKAEEEAAQKAEEKRLAELAKQYALPTSSYTLTSRFGDAGALWSSGYHTGLDFAAPTGTLIKAVHSGTITEAGWAGAYGYRTILTLDDGTELWFCHQSSISVSVGQQVSTGDVIGRVGATGNVTGPHLHLELHTPGGDTIDPMAWLRSKGLTP
>NZ_CP023747.1|WP_079162180.1|3674047_3674452_-|metallopeptidase-family-protein
MRAGRRCPDSGAVSDNGPVLEMTREEFEELVAEALDRIPPELTRLMDNVAVFVEDEPPADDPELLGLYEGTPLTDRGEWYAGVLPDRITIYRGPTLRMCASREDVVAETEVTVVHEIAHHFGIDDDRLHALGYG
>NZ_CP023747.1|WP_043441711.1|3674482_3676099_+|metallophosphoesterase
MARVPVAAPHHIRRASATLARRYRALRPRPAAELVPTPRSWLRTLGMAAVVLLGAWLGLLAVGDVRVPVGPMDTTMALRPSLTGGTKINVSPLGDLRLNSHEAPVRLDVTVDQLDPVRAQALVDHPERISGLQQEIAHDVAHGTLDLAVRSCVAVVLGATGLALAVYRRPRRALAAGGLALALLAVSGGTAYATWNPKSVLEPKFSGLLSSAPSLVGNARNIVTEFDVYQKELARLVTNVTKLYDVTSTLPAYEPDPTTIRVLHVSDIHLNPASWKIIASLVEQYRIDVIVDSGDTMDHGTAAENGFLDPIADLGAPYVWVRGNHDSRTTQRYLERMKNVHVLDDGRAVTIAGLRFAGTGDPQFTPDRSVAPGGDRAEELAGARLAAALRDQKAAGTPVDIAIAHEPVAARETDGEVPLVLAGHVHHEATEIMKYGTRLRIEGSTGGSGLRAVERPDPDPIETSVLYLDRDTRRLQAWDEIRLGGLGRTTAEVARHLVEDNRPGTGATPGATPSAATPSTRPGADPSGSRGTPVPTTP
>NZ_CP023747.1|WP_043441713.1|3676795_3676981_+|hypothetical-protein
MGDEVEWFELTRRGYDRVQVDEYFARLAGGTDPGDPPQFDIVRRGYDRDQVDSRIAQLRAR
>NZ_CP023747.1|WP_052454149.1|3677071_3677398_+|hypothetical-protein
MSQDRTGAVQGAQLEKDRARYGLLAVIVSNLVISGVAIFGVWRLDGDKSVMIGVLTAAFTAMSGLTTAYLGIKAVSNTAQSMAQRPVHPEQTKQPQPAPSLPQQPGDH
>NZ_CP023747.1|WP_043441715.1|3677564_3681542_+|ATP-dependent-RNA-helicase-HrpA
MSTHPAPTLGTLAPRLSELSLRDTQRLGRRLEGARKIRNPEARAAVLAEIEAEVAKAEERIAGRAARVPAVSYPEQLPVSQKKDEIAAAIRDHQVVIVAGETGSGKTTQIPKICLELGRGVRGMIGHTQPRRIAARTVAERVAEELDSPLGEAVGWKVRFTDQVSPDSTFVKLMTDGILLAEIQTDRELRAYDTIIIDEAHERSLNIDFLLGYLAQLLPRRPDLKVVITSATIDPERFSRHFGDAPIVEVSGRTYPVEVRYRPLLEEDSEDADRDQITAITDAVEELMGEGKGDILVFLSGEREIRDTADALIKKQYRFTEILPLYARLSHAEQHRVFQPHTGRRIVLATNVAETSLTVPGIKYVIDPGFARISRYSHRTKVQRLPIEPVSQASANQRKGRCGRTSDGICIRLYSEEDFTARPEFTDAEILRTNLASVILQMTAAGLGEIEKFPFIDPPDHRNIRDGVQLLEELGALDPAQKDPRKRLTDTGRKLAQLPVDPRLARMVLEADRNGCAREVMVVAAALSIQDPRERPADKQAQADQQHARFKDETSDFLAYLNLWRYLREQQKERGSSSFRRMCKQEYLNFLRIREWQDIYTQLRTVAKQMGIHLDEQDAPADRIHISLLAGLLSHIGLKDVKESKDSGPATRRDGGRNEYLGARNAKFAIFPGSSLFKKPPRLVMSAELVETSRLWARVNARIEPEWVEPLAGHLLKRTYSEPHWEKDQAAVMAYEKVTLYGVPIVAQRKVNYGRIDPEASRELFIRNALVEGDWRTHHKFFADNRKLLTEVEELEHRARRRDILVDDETLFDFYDQRVPDHVVSGAHFDSWWKHKRHEQPDFLDFEREMLINEKAGRVTKDDYPDSWRQGRLKFKVTYQFEPGADADGVTVHIPLQVLNQVTAEGFDWQIPGLREELVTELIRSLPKPIRRNYVPAPNYAKAFLDTAVPLQEPLTVTMARELRRMVGVPFEADDFDLSKVPDHLTITFRIVDERRRKLAEDKDLEALKLRLKPKARQALSKAAAATAERQGGESLERTGLTDWTIGSLSRVFETRRAGHPVKAYPALVNDGDTVSVRLFDTEEEQAQAMWQGTRRLILRNIPVNPAKFASEKLTNAQKLALSANPHGSVQALFDDCARAAADKLIGDFGGPAWDEESYRKLYDRVRAEIVDTTVRTVGQVQQVLAAWGACERRLKAVRSPALLPNLTDVRTQLDALVRPGFVTEVEIRRLPDLMRYLIAADRRLQQMPTNVQRDTTRMAKVHEMRDEYAWLLEQLPQGRPVPSAVLDIRWMIEELRVSYFAHALGTAYPVSDKRIVKAIDAAVP
>NZ_CP023747.1|WP_043441718.1|3682100_3682292_+|hypothetical-protein
MAAYARHETRALLRAHLSAASGYRHLTPRCPVCLQLLRLAMEPAQRGEDTPESVPRDDDPSGA
>NZ_CP023747.1|WP_003949541.1|3682814_3683021_-|developmental-transcriptional-regulator-BldC
MTARTPDAEPLLTPAEVATMFRVDPKTVTRWAKAGKLTSIRTLGGHRRYREAEVRALLAGIPQQRSEA
>NZ_CP023747.1|WP_043441721.1|3683620_3684463_-|hypothetical-protein
MPKVSSVIVPYACYLRVYEPLAAFQEPERRHWERYARRPDRPSYQDELRRSLADLVPTPPVPVPVHESSDAFVTEIDGALCVCPWRTRLRGWQALEGLSHELPAPVLDAVLPPVVRRQASQDYERWLARNPDARPWIRTATWQVPLNWFVLVSDEERRYDTGSAGVPPMLRYRTPMVQARRRTARALRTLKEAIDEGPLIEGLVDVGRWLEEFHPRSLVELDYGGLVHVLSAAELDEDHSAADVAEGIEALRLGDADAAGEAYGRLAGRWRAVRDRRSAN
>NZ_CP023747.1|WP_043441724.1|3684720_3685830_+|Glu/Leu/Phe/Val-dehydrogenase
MTDVTDGVLHTLFQSDQGGHEQVVLCQDRATGLKAVIAIHSTALGPALGGTRFYPYATEEAAVADALNLARGMSYKNAMAGLEHGGGKAVIIGDPEQIKTEELLLAYGRFVASLGGRYVTACDVGTYVADMDVVSRECRWTTGRSPENGGAGDSSVLTSYGVFQGMRASAQHLWGDPTLRGRKVGVAGVGKVGHYLVEHLLEDGAEVVITDVRADAVRRITEAHPEVAVAEDTDALIRTEGLDIYAPCALGGALNDDTVPVLTAKVVCGAANNQLAHAGVEKDLADRKILYAPDYVVNAGGVIQVADELHGFDFDRCKAKASKIFDTTLAIFARAKEDGIPPAAAADRIAEQRMAEARSGQVLGKTAQV
>NZ_CP023747.1|WP_043441727.1|3686101_3686350_+|DUF3073-domain-containing-protein
MGRGRAKAKQTKVARQLKYNSGGTDLSRLAEELGASTSNASPNGERFEDDEHDDDLYARYADLYGDDDDDEDEGSPRQRRGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_9

5208376-5208454

Orphan

Consensus_repeat	Method
GCGGCCGAGAAGTCCGACGGTGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023747_9

>merge|NZ_CP023747|9|5208376-5208454|CRISPRCasFinder
GCGGCCGAGAAGTCCGACGGTGCCGACACGTCCGACGGCGCCGAGAAGTCCGATCGTGCCGACACGTCCGACGGCGCCG

>NZ_CP023747|9|9|5208376-5208454|CRISPRCasFinder
GCGGCCGAGAAGTCCGACGGTGCCG	ACACGTCCGACGGCGCCGAGAAGTCCGAT
CGTGCCGACACGTCCGACGGCGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043444038.1\|5218387_5219167_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|225176
NZ_CP023747.1\|WP_043444026.1\|5202218_5203217_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP023747.1\|WP_043444036.1\|5216772_5217456_-\|CGNR-zinc-finger-domain-containing-protein	unknown	unknown	gnl\|CDD\|378696
NZ_CP023747.1\|WP_043444037.1\|5217570_5218314_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|277347
NZ_CP023747.1\|WP_150478293.1\|5196864_5197242_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP023747.1\|WP_043444034.1\|5213039_5213738_-\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|376556
NZ_CP023747.1\|WP_043449360.1\|5205098_5206106_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP023747.1\|WP_043444031.1\|5209307_5210534_-\|esterase	unknown	unknown	gnl\|CDD\|366286
NZ_CP023747.1\|WP_043444024.1\|5199678_5200470_+\|enhanced-serine-sensitivity-protein-SseB	unknown	unknown	gnl\|CDD\|379654
NZ_CP023747.1\|WP_043444023.1\|5197352_5198471_-\|glycine-cleavage-system-aminomethyltransferase-GcvT	unknown	unknown	gnl\|CDD\|234742
NZ_CP023747.1\|WP_043444030.1\|5208742_5209399_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP023747.1\|WP_043444027.1\|5203251_5205027_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173871
NZ_CP023747.1\|WP_043444033.1\|5211796_5212960_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
NZ_CP023747.1\|WP_043444025.1\|5200741_5201533_+\|enhanced-serine-sensitivity-protein-SseB	unknown	unknown	gnl\|CDD\|379654
NZ_CP023747.1\|WP_043444035.1\|5213798_5214923_+\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_CP023747.1\|WP_150478292.1\|5195585_5196848_-\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
NZ_CP023747.1\|WP_107070438.1\|5198936_5199674_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379324
NZ_CP023747.1\|WP_052454252.1\|5215390_5216656_+\|flavohemoprotein	unknown	unknown	gnl\|CDD\|99784
NZ_CP023747.1\|WP_043444032.1\|5210754_5211615_+\|thioesterase-family-protein	unknown	unknown	gnl\|CDD\|379298
NZ_CP023747.1\|WP_043444028.1\|5206102_5207197_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|223521

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043444038.1\|5218387_5219167_-\|alpha/beta-hydrolase	gnl\|CDD\|225176	COG2267, PldB, Lysophospholipase [Lipid metabolism].	3.11777e-11
NZ_CP023747.1\|WP_043444026.1\|5202218_5203217_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.81826e-89
NZ_CP023747.1\|WP_043444036.1\|5216772_5217456_-\|CGNR-zinc-finger-domain-containing-protein	gnl\|CDD\|378696	pfam11706, zf-CGNR, CGNR zinc finger. This family consists of a C-terminal zinc finger domain. It seems likely to be DNA-binding given the conservation of many positively charged residues. The domain is named after a highly conserved motif found in many members of the family.	5.1095e-09
NZ_CP023747.1\|WP_043444037.1\|5217570_5218314_+\|metallophosphoesterase	gnl\|CDD\|277347	cd07402, MPP_GpdQ, Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination.	9.15801e-60
NZ_CP023747.1\|WP_150478293.1\|5196864_5197242_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	2.83661e-62
NZ_CP023747.1\|WP_043444034.1\|5213039_5213738_-\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|376556	pfam01510, Amidase_2, N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.	5.50739e-37
NZ_CP023747.1\|WP_043449360.1\|5205098_5206106_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.40076e-99
NZ_CP023747.1\|WP_043444031.1\|5209307_5210534_-\|esterase	gnl\|CDD\|366286	pfam00756, Esterase, Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.	2.37106e-08
NZ_CP023747.1\|WP_043444024.1\|5199678_5200470_+\|enhanced-serine-sensitivity-protein-SseB	gnl\|CDD\|379654	pfam14581, SseB_C, SseB protein C-terminal domain. This family consists of several SseB proteins which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon. This presumed domain is found at the C-terminus of SseB proteins.	1.88287e-33
NZ_CP023747.1\|WP_043444023.1\|5197352_5198471_-\|glycine-cleavage-system-aminomethyltransferase-GcvT	gnl\|CDD\|234742	PRK00389, gcvT, glycine cleavage system aminomethyltransferase GcvT.	0
NZ_CP023747.1\|WP_043444030.1\|5208742_5209399_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	4.89031e-53
NZ_CP023747.1\|WP_043444027.1\|5203251_5205027_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|173871	cd08506, PBP2_clavulanate_OppA2, The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP023747.1\|WP_043444033.1\|5211796_5212960_+\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	4.36431e-168
NZ_CP023747.1\|WP_043444025.1\|5200741_5201533_+\|enhanced-serine-sensitivity-protein-SseB	gnl\|CDD\|379654	pfam14581, SseB_C, SseB protein C-terminal domain. This family consists of several SseB proteins which appear to be found exclusively in Enterobacteria. SseB is known to enhance serine-sensitivity in Escherichia coli and is part of the Salmonella pathogenicity island 2 (SPI-2) translocon. This presumed domain is found at the C-terminus of SseB proteins.	3.74757e-20
NZ_CP023747.1\|WP_043444035.1\|5213798_5214923_+\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_CP023747.1\|WP_150478292.1\|5195585_5196848_-\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
NZ_CP023747.1\|WP_107070438.1\|5198936_5199674_+\|AAA-family-ATPase	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	4.93385e-07
NZ_CP023747.1\|WP_052454252.1\|5215390_5216656_+\|flavohemoprotein	gnl\|CDD\|99784	cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.	1.26614e-66
NZ_CP023747.1\|WP_043444032.1\|5210754_5211615_+\|thioesterase-family-protein	gnl\|CDD\|379298	pfam13622, 4HBT_3, Thioesterase-like superfamily. This family contains a wide variety of enzymes, principally thioesterases. These enzymes are part of the Hotdog fold superfamily.	9.02415e-47
NZ_CP023747.1\|WP_043444028.1\|5206102_5207197_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|223521	COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	9.48468e-176

>NZ_CP023747.1|WP_043444028.1|5206102_5207197_+|ABC-transporter-ATP-binding-protein
MTELSKTGAAVGEPATTAPAPTAFLEVRDLKVHFPTDDGLVKSVDGLSFKLEKGKTLSVVGESGSGKSVTSLAIMGLHRLGARGKNVQMSGEIWLDGKELVSAHPDEVRKLRGREMAMIFQDPLSAMHPYYKIGDQIVEAYRVHHKVSRKTARTRAVEMLDRVGIPEPHKRIDGYPHEFSGGMRQRAMIAMALVNNPELLIADEPTTALDVTVQAQILDLIRDLQKEFGSAVVIITHDLGVVAEIADDVLVMYGGRCVERGPVDEIFERPQHPYTWGLLGSMPRIDRETSERLIPVKGQPPSLINVPSGCAFNPRCPYADIPKGNVTRTVRPELELVDTGHWSACHLSAEDRTRIWTEEIAPKL
>NZ_CP023747.1|WP_043449360.1|5205098_5206106_+|ABC-transporter-permease
MISYILRRTFAAVILLLVVSAVTFAIFFLLPRLAGQTADQLAQQYIGKSPSKADIIAVKQNLGLDQPLYVQYWHFIKGIVAGATYDLGPTAVHCDAPCFGYSFKTHEQVWPQLTSRMPVTLSLASGAAVLWLLSGVTVGVISALKPRSIFDRTFMGVALAGVSLPMFFTGNLAILLFVFKWPIFGRTYIPLTENPAQWANTLFPAWCSLALLYSAIYARLTRSGMLETMNEDFIRTARAKGLGESKVVVRHGLRAALTPIITVFGMDIGLLLGGAVITETVFSLEGVGAYAVQGITDNDLPKILGVTLLAASFVVIANLLVDLLYAAADPRVRLS
>NZ_CP023747.1|WP_043444027.1|5203251_5205027_+|ABC-transporter-substrate-binding-protein
MEGNPPIMRRSALAAVAAIGSVSLLVAGCSKADDNKNNGGKGNTSAGADAATKGVVNASDKKGGTLTYEMSDVPDSFDPGNTYYAYMYNLSRLWARPLMTFKPGPGTEGNTLVPDLAEGKGTPSDGGKTWTYKIRAGLKYQDGTPITTKDVKYAVERSNFARDVLSLGPNYFQQLLAGGDKYKGPYKDKSGKGLSSIETPDDTTIVFHLKQAFQEFDYLVAAPETAPVPQAKDKGVDYVKNIMSSGSYKFESYAEGKQAVLVRNENWDAKTDPLRKQLPDKIVVKMKVNPETIDKDVLAGDAIELVGTGVQASTQAQLLSDPKKKADTDNTFGGRLVYMAINTKVAPFDKVECRKAVQYAIDKASVQTAEGGPVRGEIASTVVPPDITGYEKADAYATPDSKGDVAKAKEQLKACGKTSITTNISARSDRQQEVDAATAIINSLEKVGIKATLKQYPSGKYFTDYAGVPKVTQKQNIGLMMMQWGADWPSGYGFLQQILNGAAISQSGNTNLSQYNSKEVNSLLSKAIATQDDSERNSLYAQIDKKTMDDAVIVPLTYFKVLLARPQNATNLVSSAAWSGQYDYLNIGTTK
>NZ_CP023747.1|WP_043444026.1|5202218_5203217_+|ABC-transporter-permease
MTAPIETTGAAAETQPEAALAGAEKGRIEGRSLGQIAWSRFKKDKVAVTGGAIVVVLVLLAILSRPIQAVFGLDPNAFHQDLIDPNTSLPNGAWGGMSADHPLGVDPKFGRDIATRILEGSWVSLVVAFGATILSNVIGAIMGVVAGYYGGRVDTIISRLMDTFLAFPLLLFAIAISATLQGGAFGLTGLPLHLSVLIFIIGFFNWPYLGRIVRGQTLALREREFVDASRGMGARGPYILFRELMPNLVGPIIVYSTLLIPTNILFEASLSFLGVGIQPPQASWGGMLREAVTFYEVDPQYMIVPGLAIFVTVLAFNLLGDGLRDALDPRSR
>NZ_CP023747.1|WP_043444025.1|5200741_5201533_+|enhanced-serine-sensitivity-protein-SseB
MSASGTAAAGQVEHMLRQVTPGRYDAYEALLRVLSTPSSGQVWMLLWHGQAGSPDAQYGNMEVDGHGYAPCVTSAQELSASGWNRSYEVVDGLDVARTLYPEHYGLWLNPHAPGGGVGIPWLDLRRIATGLERQPAGPLRLSEPAVPVPQFYALLTQNAHRTPAVRSLRRAWVQPALGAPYLAIGLDVYDTSPAAVDSVRAMMQQSIVAVPEGLPVSTVAMSDAYDPVAIWLGVNSRPFYDREAHVAPAPAGGYGYPPVRGAY
>NZ_CP023747.1|WP_043444024.1|5199678_5200470_+|enhanced-serine-sensitivity-protein-SseB
MDFQADLPAGIPPQAHPHPHGGWPGNELEEVLSASLGVPSSGARIVEVLARSFLWVPLPNGGGPHSESLDLPTMELAGQAYVPVFSSEEQFRQVVGTHMSFTIAPAVEFARGLPPQVGLALNPDGVVGAPLPPEVVAELCRGGNTPLGGPVTGGRVRLFEPDWQDDPVDLLAAASAEFEATGLVLTARRCLAAIETADPVMFIGVELSSWEADTRTIPLEALGRALGTVPTATPVNMVFMDVAQDPVGDWLRERVRPFYQRGH
>NZ_CP023747.1|WP_107070438.1|5198936_5199674_+|AAA-family-ATPase
MTVNRTTVYATAPDVTAPARPGTGTRRERGPAGPGGIRDLRGSAGRGPHRLTFGAGDLVVVAGLPGGGKSTLMRRAVRGLRVDSQDTRERWDGHLARFLPYALYRPLVRLTHYTALRRALRAGTGAVVHDCGTQSWVRNWLAREARRRGGTLHLLLLDVTPDTALAGQRARGRGVSRRAFLRHRRATRRLLRSVEEGRPPHGCGSVVVLDRDAADVLRGIDFADRATSPGHPLAFSATTAVLSRR
>NZ_CP023747.1|WP_043444023.1|5197352_5198471_-|glycine-cleavage-system-aminomethyltransferase-GcvT
MSSSPLRRTALDALHRSLGATMTDFAGWDMPLRYGSERDEHLAVRTKAGLFDLSHMGEITVTGPEANRLLDHALVGNISSVGVGRARYTMICREDGGILDDLIVYRLGEREYLVVANASNAQVVLDALVERATGFDAEVRDDRDAYALIAIQGPESAGVLGSLTDADLDGLKYYAGLSATVAGVPVLLARTGYTGEDGFELFAAPEHAEGLWRALTEAGAPVGLVPCGLSCRDTLRLEAGMPLYGHELGTSLTPFDAGLGRVVKFEKEGDFVGRAALVEAAERAEKNPPRVLVGLVAEGRRVPRAGYPVVFGGEVIGEVTSGAPSPTLGRPIAMAYVDAPHSVPGTPGVGVDIRGKHEPYEVVALPFYKRQK
>NZ_CP023747.1|WP_150478293.1|5196864_5197242_-|glycine-cleavage-system-protein-GcvH
MSNPQQLRYSKEHEWLSDAEDGVSTVGITEHASNALGDVVFVQLPEVGDTVTAGETCGELESTKSVSDLYSPVTGEITEVNEAVVDDPSLVNTAPFEGGWLFKVRVTQEQDDLLSADEYAAHIAG
>NZ_CP023747.1|WP_150478292.1|5195585_5196848_-|serine-hydroxymethyltransferase
MSLLNTPLHELDPDVAAAVDAELHRQQSTLEMIASENFAPAAVMEAQGSVLTNKYAEGYPGRRYYGGCEHVDVVEQIAIDRVKELFGAEHANVQPHSGAQANAAAMFALLKPGDTIMGLDLAHGGHLTHGMKINFSGKLYDVVAYHVGADGVVDMDEVERLAKESRPKLIVAGWSAYPRQLDFAAFRRIADEVGAYLMVDMAHFAGLVAAGLHPSPVPHAHVVTTTTHKTLGGPRGGVILSTAELAKKINSAVFPGQQGGPLEHVVAAKAVAFKVAASEDFKDRQRRTLEGARILAERLVADDVKAVGVDVLSGGTDVHLVLVDLRNSELDGQQAEDRLHEVGITVNRNAIPNDPRPPMVTSGLRIGTPALATRGFTAEDFAEVADVIAEALKPAYDAESLKARVKALADKHPLYPGLGK
>NZ_CP023747.1|WP_043444030.1|5208742_5209399_+|trimeric-intracellular-cation-channel-family-protein
MLQQLFSPSVQHTLDVVGIFVFAISGALLAVRKNFDVFGIAVLAEVTALGGGLFRDLVIGAVPPAAFTDLGYFLTPLFAALLVFFLHPQVERIQVAVNVFDAAGLGLFCVAGTTKAYEHGLGLTASATLGLATAVGGGVLRDILANEVPSLLRWDRDLYAVPAIVGATMAALCIRYGVLTPVTTALAVVTAFVLRLLAMRFHWRAPRAWNRRSTVVEE
>NZ_CP023747.1|WP_043444031.1|5209307_5210534_-|esterase
MSLTGTPFLITSITLLTVALILPLFLWSRIRGPVALRHGARVFMLLFAQATAVVLVFVLVNNANSLYDNWADLLGTGNHVQQAADLGKDGTGGIRITSLPKVRQTFGQADGPDMHAAGGVRVTQLKGRVSGVDAEVYVWLPPQYQEPAYRHRKFPVVELLSGYPGSAKAWFGSLKVHEQLLPLMRDGQVAPFILVAPRTNLIARVDTGCANVPGAVNADTWLSIDVPKMVTDNFRAESAPNGWAAAGYSAGAHCATKLAVAHPDRYRAAISLSGYNDPIGERVSLAAQSIALRRQNNPYVLLKSCRTAPRVALYLSGQLGDGYQAAAALQRIARPPTTVHTVLIPRSAGGHTMALWRPQIRPAFTWLTRQMSGRRTLGSTPPRPWTGDSRHAALASETASPADAVRRR
>NZ_CP023747.1|WP_043444032.1|5210754_5211615_+|thioesterase-family-protein
MAEAVTAQAARGAIGDSEFDRDTAVVRREPGVHDIDLSAGWTIAGAVNGGYLLAVLGRALADTLPHSDPFTVSAHYLTASRPGPAVIRTDVVRTGRTLSTGQASLFQYDDEGHEVERIRVLASYGDLDALPDDIRTSAEPPAIPPLDRCFDAQDGPAPVSGSSAIVERLMLRLDPATLGWALGSPSGKGEMRAWFGLADGRDTDPLALLLAVDALPPTAFELGLSGWVPTVELTVHVRSRPAPGPLRVSITTRNLAGGYLEEDAEVWDSADRLVAQSRQLARVRLS
>NZ_CP023747.1|WP_043444033.1|5211796_5212960_+|cysteine-desulfurase
MAYLDHAATTPMLPEAAEALTAQLGVTGNASSLHASGRRARRTVEEARETLADALGARPSEVVFTSGGTEADNLAVKGLYWSRRAADPARTRVLASPVEHHAVLDAVDWLGEHEGATVEYLPVDSYGRVRPEALREAVARNPDDVALATVMWANNEIGTVMPVRELADVAAEFDIPLHADAVQAFGQLPVDFEASGLAAMTVSGHKIGGPYGIGALLLGRRYSPVPVLHGGGQERHVRSGTLDVPAVASFAVAGRLAAEHRERFAREIGALRDELIAVVREAVPDAILGGDPVDRLPANAHFTFPGCEGDSLLLLLDAQGIECSTGSACTAGVAQPSHVLLATGADPDLARGTLRFSLGHTSTVADVEAVAKTIGPAVERARTAGLT
>NZ_CP023747.1|WP_043444034.1|5213039_5213738_-|N-acetylmuramoyl-L-alanine-amidase
MGDRRTAKDGDRRLGRRALFVGGTAAVLGTAVLGTAALAREELGRLWWRLPGIEKPRVAGAVDFPGARWVAASPANLRRADRPDDYRIDRVIIHVTQGGYRSAVNVFQDPGHGAAAHYIVSADGHVTQMVRELDVAFHAGNREYNERSVGIEHEGFVEDASSFTDAMYEASARLTAAICGRYGIPVDRGHIIGHVEVPGTDHTDPGPHWDWARYLRLVRAARTAPVKPQRSA
>NZ_CP023747.1|WP_043444035.1|5213798_5214923_+|tRNA-2-thiouridine(34)-synthase-MnmA
MTDTPQRPLRVLAAMSGGVDSAVAAARAAEAGHDVTGVHLALSANPQSFRTGARGCCTIEDSRDARRAADVIGIPFYVWDLAERFREDVVEDFIAEYEAGRTPNPCLRCNEKIKFAALLDKALALGFDAVCTGHYATIVTLDDGTRELHRASDMAKDQSYVLGVLDEKQLAHAMFPLGDTLTTKDEIRAEAERRGLAVAKKPDSHDICFIADGDTQGFLARRLGKAEGDIVDESGAVLGTHEGAYGYTVGQRKGLRIGTPAPDGKPRYVLDISPVTNTVTVGPAASLDVRALTAVKPRWCGTAPTGPGTYTAQLRAHGGETEVTAELTDGELHVTFTDPVRGVAPGQAIVLYEGTRVVGSATIASTTRTTTSVA
>NZ_CP023747.1|WP_052454252.1|5215390_5216656_+|flavohemoprotein
MRLRDRMLAPSRGAGTKRSSEYAYDGAADQETIVRNLAAVTPFGDLIDHLYEAMFEQHPYLRRLFPDSMEFQKTHLERAFWFLIEHLHEPEEITAFCARLGRDHRKLGVRPVHYQVFESALSDALRTCSGGRLDPEAEHAWLRMVRFAASGMVAGSEHALAEPVAWQATVTAHQLRRPDLAVLRVRTSEPYPYRPGQYAAVESPLLPRTWRPYSFACVPAPDGELEFHVRRTGPGGVSDALTLRTRVGDTLRLGPAQGTTTLDDDPARDVLVVAGGTGWATARALLEELALRRAPGRSAHLLLGVRTADDLYDAPALARLESRCPWLRVVPVIAEGPGAAPDASLADAVARHGDWTQHIAYVSGPAAMVTAAAWRLSGLGLPADRIRHDPVAGTVPLPSHTPRSHPNGPAAGLHPAEGAPV
>NZ_CP023747.1|WP_043444036.1|5216772_5217456_-|CGNR-zinc-finger-domain-containing-protein
MTTSRYLALELANTVRHDGNGGVADELSSVDGLTSWVAAQEELKAAEEFTATGTGAALTAAGAVASGSHAAGSATGPVADERVRTQVLAVRAALRALLARAVAPAPPSRADADQLPPADQALSRLNAAAARCPVVPLLDWPTDAAPVARLLPAASASPVDLPAVLARAAIAFLGGPDLPRLRACTAPRCVRYFLKEHGRQEFCKASCGNRARAARHYRRHHAPPTAN
>NZ_CP023747.1|WP_043444037.1|5217570_5218314_+|metallophosphoesterase
MVLLAQISDLHLDGTERARERAARVMDHLRALPTPVDALLVTGDIADHGASAEYAEAVRLLAAPFPVLTCPGNHDARGPMRAGLLGEVAADGPVNRLHRIGGTAILMCDSSVPGKDEGLLDRDTLSWLADSLDGLPAGTPALIAFHHPPVTLHHPLPDRYTLQNGQDFATLLTGHPEVVAVITGHAHTAAVSSFAGRPLLVGPAVTWTLRLPWEGDDPADRRQPPGIAFHVLDEHHRLTTHFRTVLP
>NZ_CP023747.1|WP_043444038.1|5218387_5219167_-|alpha/beta-hydrolase
MDKQTLSKDGTPLAYRRTGQGPAVVLVSGAMSTGATLAPLAARLSERFSVIVHDRRGRGGSGDTPPGAVAREVEDLAALIDAAGGEASLYGISSGGALVLEAAASGLPVRRVAVYEPPFADYGGGAGERAEYRRNLTEALGQGRRGDAVELFLRLTGLAPEMIANARRSPMWAAMEAIAPTLAYDDAVMGDGLVPRDRLASVTVPVLALAGGASPEWLRRAAEAVAGAASRGTYRVLEGQNHMVEPGALAPVLAEFFAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_10

5360976-5361112

Orphan

Consensus_repeat	Method
GAGGCTCCGGCCGCCGAGACCGCCGAGGC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP023747_10

>merge|NZ_CP023747|10|5360976-5361112|CRISPRCasFinder
GAGGCTCCGGCCGCCGAGACCGCCGAGGCTCCGGCCACTGAGGCTCCGGCTGCCGAGGCTCCGGCCGCCGAGACCGTCGAGGCCCCGGCTGCCGAGACGGCCGAGGCTCCGGCTCCGGCCGCCGAGGGCGAGCAGGC

>NZ_CP023747|10|10|5360976-5361112|CRISPRCasFinder
GAGGCTCCGGCCGCCGAGACCGCCGAGGC	TCCGGCCACTGAGGCTCCGGCTGCC
GAGGCTCCGGCCGCCGAGACCGTCGAGGC	CCCGGCTGCCGAGACGGCCGAGGCT
CCGGCTCCGGCCGCCGAGGGCGAGCAGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043444238.1\|5358728_5359286_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP023747.1\|WP_162484965.1\|5351770_5352469_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP023747.1\|WP_043444256.1\|5369594_5370629_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP023747.1\|WP_043444246.1\|5362323_5363082_+\|UMP-kinase	unknown	unknown	gnl\|CDD\|234735
NZ_CP023747.1\|WP_043444258.1\|5370729_5371422_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP023747.1\|WP_079162286.1\|5354313_5354706_+\|YraN-family-protein	unknown	unknown	gnl\|CDD\|237119
NZ_CP023747.1\|WP_043444234.1\|5356327_5357488_+\|DNA-protecting-protein-DprA	unknown	unknown	gnl\|CDD\|223829
NZ_CP023747.1\|WP_043444231.1\|5354705_5356331_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|223679
NZ_CP023747.1\|WP_079162287.1\|5359302_5359920_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	unknown	unknown	gnl\|CDD\|366703
NZ_CP023747.1\|WP_043444254.1\|5367990_5369592_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224099
NZ_CP023747.1\|WP_043449384.1\|5353329_5353857_+\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240041
NZ_CP023747.1\|WP_063839079.1\|5357754_5358597_+\|RNA-polymerase-sigma-factor-WhiG	unknown	unknown	gnl\|CDD\|235770
NZ_CP023747.1\|WP_043444250.1\|5365539_5366646_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	unknown	unknown	gnl\|CDD\|184689
NZ_CP023747.1\|WP_014675285.1\|5363245_5363803_+\|ribosome-recycling-factor	unknown	unknown	gnl\|CDD\|178850
NZ_CP023747.1\|WP_043444248.1\|5363802_5364897_+\|phosphatidate-cytidylyltransferase	unknown	unknown	gnl\|CDD\|366491
NZ_CP023747.1\|WP_043444244.1\|5361302_5362139_+\|elongation-factor-Ts	unknown	unknown	gnl\|CDD\|236491
NZ_CP023747.1\|WP_043444226.1\|5352584_5353328_+\|signal-peptidase-I	unknown	unknown	gnl\|CDD\|274044
NZ_CP023747.1\|WP_167748017.1\|5364966_5365143_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444228.1\|5353913_5354222_+\|DUF2469-domain-containing-protein	unknown	unknown	gnl\|CDD\|313765
NZ_CP023747.1\|WP_107070570.1\|5366860_5367946_+\|thiamine-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270263

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043444238.1\|5358728_5359286_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.26582e-08
NZ_CP023747.1\|WP_162484965.1\|5351770_5352469_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	5.04864e-47
NZ_CP023747.1\|WP_043444256.1\|5369594_5370629_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	3.62005e-122
NZ_CP023747.1\|WP_043444246.1\|5362323_5363082_+\|UMP-kinase	gnl\|CDD\|234735	PRK00358, pyrH, uridylate kinase; Provisional.	9.98941e-138
NZ_CP023747.1\|WP_043444258.1\|5370729_5371422_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	9.42897e-06
NZ_CP023747.1\|WP_079162286.1\|5354313_5354706_+\|YraN-family-protein	gnl\|CDD\|237119	PRK12497, PRK12497, YraN family protein.	5.23025e-42
NZ_CP023747.1\|WP_043444234.1\|5356327_5357488_+\|DNA-protecting-protein-DprA	gnl\|CDD\|223829	COG0758, Smf, Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [DNA replication, recombination, and repair / Intracellular trafficking and secretion].	5.3599e-80
NZ_CP023747.1\|WP_043444231.1\|5354705_5356331_+\|ATP-binding-protein	gnl\|CDD\|223679	COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones].	7.52679e-171
NZ_CP023747.1\|WP_079162287.1\|5359302_5359920_-\|peptidoglycan-DD-metalloendopeptidase-family-protein	gnl\|CDD\|366703	pfam01551, Peptidase_M23, Peptidase family M23. Members of this family are zinc metallopeptidases with a range of specificities. The peptidase family M23 is included in this family, these are Gly-Gly endopeptidases. Peptidase family M23 are also endopeptidases. This family also includes some bacterial lipoproteins for which no proteolytic activity has been demonstrated. This family also includes leukocyte cell-derived chemotaxin 2 (LECT2) proteins. LECT2 is a liver-specific protein which is thought to be linked to hepatocyte growth although the exact function of this protein is unknown.	1.43073e-17
NZ_CP023747.1\|WP_043444254.1\|5367990_5369592_+\|iron-ABC-transporter-permease	gnl\|CDD\|224099	COG1178, ThiP, ABC-type Fe3+ transport system, permease component [Inorganic ion transport and metabolism].	1.48324e-89
NZ_CP023747.1\|WP_043449384.1\|5353329_5353857_+\|NUDIX-domain-containing-protein	gnl\|CDD\|240041	cd04685, Nudix_Hydrolase_26, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily requires a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	1.20285e-56
NZ_CP023747.1\|WP_063839079.1\|5357754_5358597_+\|RNA-polymerase-sigma-factor-WhiG	gnl\|CDD\|235770	PRK06288, PRK06288, RNA polymerase sigma factor WhiG; Reviewed.	1.14484e-168
NZ_CP023747.1\|WP_043444250.1\|5365539_5366646_+\|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN	gnl\|CDD\|184689	PRK14459, PRK14459, ribosomal RNA large subunit methyltransferase N; Provisional.	0
NZ_CP023747.1\|WP_014675285.1\|5363245_5363803_+\|ribosome-recycling-factor	gnl\|CDD\|178850	PRK00083, frr, ribosome recycling factor; Reviewed.	2.65506e-104
NZ_CP023747.1\|WP_043444248.1\|5363802_5364897_+\|phosphatidate-cytidylyltransferase	gnl\|CDD\|366491	pfam01148, CTP_transf_1, Cytidylyltransferase family. The members of this family are integral membrane protein cytidylyltransferases. The family includes phosphatidate cytidylyltransferase EC:2.7.7.41 as well as Sec59 from yeast. Sec59 is a dolichol kinase EC:2.7.1.108.	8.50992e-77
NZ_CP023747.1\|WP_043444244.1\|5361302_5362139_+\|elongation-factor-Ts	gnl\|CDD\|236491	PRK09377, tsf, elongation factor Ts; Provisional.	7.54374e-122
NZ_CP023747.1\|WP_043444226.1\|5352584_5353328_+\|signal-peptidase-I	gnl\|CDD\|274044	TIGR02227, Inactive_signal_peptidase_IA., signal peptidase I, bacterial type. This model represents signal peptidase I from most bacteria. Eukaryotic sequences are likely organellar. Several bacteria have multiple paralogs, but these represent isozymes of signal peptidase I. Virtually all known bacteria may be presumed to A related model finds a simlar protein in many archaea and a few bacteria, as well as a microsomal (endoplasmic reticulum) protein in eukaryotes. [Protein fate, Protein and peptide secretion and trafficking].	1.91217e-42
NZ_CP023747.1\|WP_043444228.1\|5353913_5354222_+\|DUF2469-domain-containing-protein	gnl\|CDD\|313765	pfam10611, DUF2469, Protein of unknown function (DUF2469). Member proteins often found in Actinomycetes clustered with signal peptidase and/or RNAse-HII.	2.51694e-62
NZ_CP023747.1\|WP_107070570.1\|5366860_5367946_+\|thiamine-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270263	cd13545, PBP2_TbpA, Substrate binding domain of thiamin transporter, a member of the type 2 periplasmic binding fold superfamily. Thiamin-binding protein TbpA is the periplasmic component of ABC-type transporter in E. coli, while the transmembrane permease and ATPase are ThiP and ThiQ, respectively. Thiamin (vitamin B1) is an essential confactor in all living systems that most prokaryotes, plants, and fungi can synthesized thiamin. However, in vertebrates, thiamine cannot be synthesized and must therefore be obtained through dietary absorption. In addition to thiamin biosynthesis, most organisms can import thiamin using specific transporters. After binding thiamine with high affinity, TbpA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The thiamine-binding proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.6501e-114

>NZ_CP023747.1|WP_079162287.1|5359302_5359920_-|peptidoglycan-DD-metalloendopeptidase-family-protein
MRAKLWAKRRWRAWPVVPLMLTAGVPAPVARAGPPSGLRADAAQAAEPVPGSEAPVPAVARSWPVGVRPEVVRGWDPPAHPYGPGHRGVDLAAAEGDPVRSVAAGRVAFAGRVAGRGVVSVDLAGTGEPPLRTTYEPVRASVHTGDEVGPGTVLGVLEPPTGHCAGPCLHWGLRRGKAYLNPLSLLRTGPSRLLPVDGVPLPPLP
>NZ_CP023747.1|WP_043444238.1|5358728_5359286_+|TetR/AcrR-family-transcriptional-regulator
MAEHRSMQRAALLDAARSLLSEGGTEALTFPALAERTGLARSSVYEYFRSRAAVVEELCAVDFPVWAAEVEAAMAVAEGPEAKIEAYVRQQLALVGDRRHRAVVAISASELDSGAREKIRAAHGGLVAMTVEALREMGHREPRLAAMLLQGVVDAAVRRIELGAAEDPPAITEAAVAMALRGVCG
>NZ_CP023747.1|WP_063839079.1|5357754_5358597_+|RNA-polymerase-sigma-factor-WhiG
MPQHTSGSDRAALPPAARDGGSVRPPAPSTLDELWRSYKETGDERLREQLILHYSPLVKYVAGRVSVGLPANVEQADFVSSGVFGLIDAIEKFDLDREIKFETYAITRIRGAMIDELRALDWIPRSVRQKARSVERAYATLEARLRRTPSEGEVAAEMGIGVEDLHAVFSQLSLANVVALEELLHVGGEGGDRLSLMDTLEDTAADNPVEVAEDRELRRFLARAINTLPDREKTVVTLYYYEGLTLAEIGNVLGVTESRVSQIHTKSVLQLRAKLAGFGR
>NZ_CP023747.1|WP_043444234.1|5356327_5357488_+|DNA-protecting-protein-DprA
MSGGAGPDDDRLARIFLGRVVEPGDETAGRWLREHGAEEVARRLREDGPPLPGVTGKRWTGLRARAVRAAPERDLALAREAGLRFVCPGTPEWPAQLDDLGDARPLGLWVRGRPSLRMWALRSVAVVGARACTEYGAHMAAGLGAGLAERGWVVVSGGAYGVDGAAHRGALAAGGATVAVLACGVDRPYPRGHTELITRIARQGLVAGELPPGDHPTPSRFLLRNRVIAALTRGTVVVEAAYRSGALVTARAAQRLGRHTMGVPGPVTSGLSAGVHELLRGEAVLVSDAAEVVELVGAMGELAPDRRGPVLPRDLLDPAAARVLAALPARGTAPADVLARGAGTTQDDVVARLYELRSLGFVERHGDGWKLTRQAVIASRPDRAGC
>NZ_CP023747.1|WP_043444231.1|5354705_5356331_+|ATP-binding-protein
MGFARTCSVALVGVEGVVVEVQADLEPGVAAFTLVGLPDKSLTESRDRVRAAVVNSGGAWPQKKLTVGLSPASVPKAGSGFDLAVASAVLGASERIDPRVLADIVMIGELGLDGRVRPVRGILPAVLAAADAGYEQVVVPECAAAEAALVPGVSVLGVRSLRQLIAVLTDEPVPEEEQDAPGRPDPLLAGLRAPGTGETTGMHGLGAAQHEPGHDLADVVGQRAARTAVEVAAAGGHHLLLEGPPGAGKTMLAERLPAVLPRLGRQESLEVTAVHSVAGLLPVGKPLIDVPPYCAPHHSATMQALVGGGPGIARPGAVSLSHRGILFLDEAPEFSGRALDALRQPLESGHVVIARSAGVVRFPARFLMVLAANPCPCGRFSRRDALCECPPSAIRRYQARLSGPLLDRVDLRVEVDPLTRAELTGRGARGESTETVADRVREARARTAARLAGTPWRVNGEVPGRELRHRWYAASGATEEAERQLERGVLTARGLDRVLRVAWTVADLAGHDRPDATDVALALQLRTGIPQGVPAVVGAPV
>NZ_CP023747.1|WP_079162286.1|5354313_5354706_+|YraN-family-protein
MTVGAGGGADMNARSALGRYGEELAARRLTAAGMTVLERNWRCGRSGEIDIVARDGDVLVVCEVKTRRGGRFEHPMAAVTPVKAERLRGLAERWIQAHGGAPPGGARIDVVGVLLPERGAAVVEHVRGVL
>NZ_CP023747.1|WP_043444228.1|5353913_5354222_+|DUF2469-domain-containing-protein
MSAEDLEKYETEMELKLYREYRDVVGLFKFVIETERRFYLTNDYEMQVHSVQGEVFFEVSMADAWVWDMYRPARFVKQVRVLTFKDVNIEELNKSDLELPGG
>NZ_CP023747.1|WP_043449384.1|5353329_5353857_+|NUDIX-domain-containing-protein
MSAPEGGGGVESTYTGGLRRVARVVLLDPQDRILLLHGHEPDDPADDWWFTPGGGLEGDETREQAALRELAEETGITEVELGPVLWRRRCSFPFAGRRWDQDEWYFLARTAQTTAVASALTELERRSVVGARWWTCGELAEAHETVYPKRLAGLLRTLLDEGPPAGPEILDTEIV
>NZ_CP023747.1|WP_043444226.1|5352584_5353328_+|signal-peptidase-I
MSRTGRTAAGRGRLGSTLSGLAVALGCVLFLGGFLWAAIVYKPYTVPTDSMSPTIAAGDRILAQRIDASDVRRGDVIVFRQQSWGDLPMVKRVVAVGGDTVACCTDGRLTVDGKQIHESYLPAGQAAESKTIPALTVPEGRLFLLGDERSGSLDSTAHLTEAFSGTVPLGAVDSRVDAVVWPMNGFLDRPAGFGTLGPISSPGPLRPMLGLIVAGAVLVLGGAAYGPIARRAGRTRGVSRTEPAGVR
>NZ_CP023747.1|WP_162484965.1|5351770_5352469_+|signal-peptidase-I
MLALLIKTFLVQAFSIPSDSMQNTLQQGDRVLVDKLTPWFGSEPSRGEVVVFHDPDNWLAGEPTTTPNALQTALSWIGLMPSVEEKDLIKRVVGVAGDTIECKGTGPLKVNGKSLNEPYVYPGNTPCSVDDQGGQFRVTVPPGKIWVMGDHRQNSLDSRYHQQDEHQGFVPVGNVVGRAIVIAWPPTRWDTLPIPDTFDQGLSVTAPGALGLIGATPLVLWRRRRVTTRQGA
>NZ_CP023747.1|WP_043444244.1|5361302_5362139_+|elongation-factor-Ts
MANYTAADVKKLRELTGAGMMDCKKALDEADGNVDKAVEALRIKGQKGVAKREGRSAENGAVVSIIADDNSSGVLVELKCETDFVAKGEKFQSVAQAIAEHVAKTSPADLEALLASEIEAGKTVQAFVDEANANLGEKIVLDRFAQFSDGFVAAYMHRTMPDLPPQIGVLVEFDKPNAEVAKGIAQHIAAFAPKYLAKEDVPAEVVESERRVAEETTRAEGKPEAAIAKIVEGRLGGFFKDATLLGQPYALDNKKSVQKVLDEAGVTLKRFTRIKVGI
>NZ_CP023747.1|WP_043444246.1|5362323_5363082_+|UMP-kinase
MTTKAEKSDDGKVHGRFLLKLSGEAFSGGTGLGVDPDVVHAIAREIAAVVRDGAQIAVVIGGGNFFRGAELQQRGMDRARSDYMGMLGTVMNCLALQDFLEKEGIDSRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGMPYFSTDTTAAQRALEIDAEALLMGKNGVDGVYDSDPKTNPEAVRFDSLSYGEVITRDLKVADMTAITLCRDNKLPILVFELLAEGNIARAVKGEKIGTLVGDQGSRN
>NZ_CP023747.1|WP_014675285.1|5363245_5363803_+|ribosome-recycling-factor
MIEETLLEAEEKMEKAVVVAKEDFAAIRTGRAHPAMFNKIVADYYGAPTPINQLASFSVPEPRMAVVTPFDKSALRNIEQAIRDSDLGVNPSNDGNIIRVVFPELTEERRREYIKVAKGKGEDAKVSIRSVRRKAKDAIDKLIKDGEVGEDEGRRAEKELDDTTAKYVAQVDELLKHKEAELLEV
>NZ_CP023747.1|WP_043444248.1|5363802_5364897_+|phosphatidate-cytidylyltransferase
MNDSSWRAPSQTGYRGPTDRAPFQGAGAAGPAYDAQDAPQTRPMPIVPDVPAQGGDQDDDPGAARPGGPFFRDETQNPEPMPHASQPAPAPQKKTAGRDLGAAIGVGIGLGVVIVASLFIVKAVFVGVIAVAVVVGLWELTKRLQERKDIKAPLVPLAVGGAAMIVAGYVRGAEGAWVAMALTALAVLVWRMTEPPEGYLKDVTAGLFAAFYVPFLATFVALMLTAQDGPQRVLTFLVLTVVSDTGAYAVGWRFGRHKLAPRISPGKTREGLIGAVLFAMAAGALCMQYLIDGGSWWQGILLGLAVAASATLGDLGESMIKRDLGIKDMGTLLPGHGGIMDRLDSLLPTAPVVWLLLVLFVGSG
>NZ_CP023747.1|WP_167748017.1|5364966_5365143_-|hypothetical-protein
MRTGASDYDAGLYSHTPSQAEGERDEPAERSAVEQHPDVPRTEPSQAEGERADDIGTG
>NZ_CP023747.1|WP_043444250.1|5365539_5366646_+|23S-rRNA-(adenine(2503)-C(2))-methyltransferase-RlmN
MPKPGELTFVAPRGAKKPPRHLADLTPAERKEAVAEIGEKPFRAKQLSQHYFARYAHDPEQWTDIPAGSRARLQEALLPELMTVVRHLSTDQDTTRKTLWRLFDGTLVESVLMRYPDRVTMCISSQAGCGMNCPFCATGQAGLDRNLSTAEIVHQIVDGMRALRDGEIPGGPARLSNIVFMGMGEPLANYGRVVGAIRALTDPAPDGVGLSQRGITVSTVGLVPAIHRFADEGFKCRLAVSLHAPDDELRDTLVPVNTRWKVREVLDAGFGYVERSGRRLSIEYALIRDINDQAWRGDLLGRLLKGKPVHVNLIPLNPTPGSKWTASRPEDEKAFVEAIAAHGVPVTVRDTRGQEIDGACGQLAATER
>NZ_CP023747.1|WP_107070570.1|5366860_5367946_+|thiamine-ABC-transporter-substrate-binding-protein
MTGRQFAAVAVGLGMVTLSACGSSGSSGSTGGSGGSKTVTLVSHDSWAVSKSVLADFEKQSGYTVKVLKDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYRPKDYDTVASRYRADETEHRVTPIDTGDICVNYDKKYFADHKLTPPAGFDDLIKPAYKNLLVTENAATSSPGLGFLLGTAAKYGDGGWQDYWKKLKANGVKVVDGWEQAYDQEFSGSAGGRKAGGDRPLVVSYASSPPAEVIYADPRPKTAPTGVAQGTCFRQIEYAGLLSNARNTEGGKALLDFLLTEKFQQDMPLNMFVYPVRESAEVPADFAEYGPQAKDPETMAPDRIAADRDQWVKSWTSLVLK
>NZ_CP023747.1|WP_043444254.1|5367990_5369592_+|iron-ABC-transporter-permease
MALPVAFFAVFFAYPVTAIVRRGLRDGGSWQWGRITEVLTDPGIGHVLWFTTWQALASTALTLLVALPGAQVFARYDFPGKQLLRAVVTVPFVLPTVVVGTAFLALVGRGGLLDDLWGVRLDTTVWAILLAHVFFNYAVVVRTVGGLWAQLDPRQEEAARMLGASRFAAWRRVTLPALGPAVAAAALMVFLFTFTSFGVVQILGGPTFSTLEVEIYRQTSQIFDLTTAAVLTLVQFLAVGAILLVHAWTVRRRESALRLVDPSLTARRPRGAAQWALLGSVLLTVAVLLVLPPAVLVQRSLDAPGFGYYTALTHDDSGVFLVAPVTAIGTSLRYAVAATLIAVLIGGLAAAALARRDAGRLVRGFDALLMLPLGVSAVTVGFGFLITLDRPPLDLRGSWILVPLAQALVGVPFVVRTLLPVLRAVDERLREAAAVLGASPWRVWREVDLPIVRRALLIAAGFAFAVSLGEFGATVFIARPDNPTLPVAVARLLGRPGDLNYGQAMALSTILMVVCAVALLVLERLRTDRTGEF
>NZ_CP023747.1|WP_043444256.1|5369594_5370629_+|ABC-transporter-ATP-binding-protein
MLRLEGASVRFAGRAALDGIDLAVAEHEIVCVLGPSGSGKSTLLRGVAGLQPLDGGRLFLDGRDLAGVPAHRRGVGLMFQDHQLFPQRDVGRNVAFGLRMRGAARAEQEARVQELLELVGLPGAARRAVATLSGGEQQRVALARALAPRPRLLMLDEPLGQLDRSLRERLVVELRELFGRLGTTVLAVTHDQGEAFALADRVVVMREGRIAQAGTPLEVWQRPADAFVARFLGFDNVVTATVSGGTADTPWGRLPVPEGARQGQVSLLVRPAGVRLVDPAEGLRCTVTARTFRGTHVAVRLGLGEAPALEAACPLRSAPEPGDEVGVVFDPAEVVVLEGGADAP
>NZ_CP023747.1|WP_043444258.1|5370729_5371422_-|LPXTG-cell-wall-anchor-domain-containing-protein
MRILGVASATAALALGTAGTALACNIKDFSAVASCDDNGKGVITVTDKDGSRQKATVSVFLSTDGSETKVDEKEVTGTREGATVTFSEDWAPGATYRIHVKAGKNLVDQDIKPNLTAPSKACASSEPAPEPSETTPSAPEETAPATVEPTASAPESSEAAEPSAEASESDSAAPAAGGENFPSPAAGTSNLAETGSSSSTPLIAGIAAVLVVVGGGAVFFGMRRRGASKA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_11

5452792-5452947

Orphan

Consensus_repeat	Method
GCTGGGGGAACCCGTAACCGG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP023747_11

>merge|NZ_CP023747|11|5452792-5452947|PILER-CR
GCTGGGGGAAGCCGTAACCGGCGGGCCCGGTGGGGGAGTCGGGGGCCGGGGGCGCCGGGACCGGCGGCGGGGGGAACCCGTAACCGGCCGACGGGTGCGGCGCGCCCGGGACCTGCGGGGGCATGGGGACACCGGCCTGGGGGAACCCGTAGCCGG

>NZ_CP023747|11|4|5452792-5452947|PILER-CR
GCTGGGGGAAGCCGTAACCGG	CGGGCCCGGTGGGGGAGTCGGGGGCCGGGGGCGCCGGGACCGGCG
GCGGGGGGAACCCGTAACCGG	CCGACGGGTGCGGCGCGCCCGGGACCTGCGGGGGCATGGGGACACCGG
CCTGGGGGAACCCGTAGCCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043444378.1\|5462316_5462628_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444380.1\|5463030_5463384_+\|DUF4333-domain-containing-protein	unknown	unknown	gnl\|CDD\|379513
NZ_CP023747.1\|WP_150478302.1\|5444710_5447764_+\|translation-initiation-factor-IF-2	unknown	unknown	gnl\|CDD\|235401
NZ_CP023747.1\|WP_079162294.1\|5455317_5456481_-\|type-VII-secretion-protein-EccE	unknown	unknown	gnl\|CDD\|274857
NZ_CP023747.1\|WP_043444376.1\|5459747_5460452_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444365.1\|5449977_5450928_+\|bifunctional-riboflavin-kinase/FAD-synthetase	unknown	unknown	gnl\|CDD\|235536
NZ_CP023747.1\|WP_043444382.1\|5463604_5464042_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_167748036.1\|5454475_5455312_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444348.1\|5441249_5441756_-\|ferritin-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|373114
NZ_CP023747.1\|WP_043449410.1\|5460494_5460845_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043449408.1\|5441752_5442340_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444359.1\|5448014_5448308_+\|DUF503-domain-containing-protein	unknown	unknown	gnl\|CDD\|377364
NZ_CP023747.1\|WP_043444352.1\|5443126_5444122_+\|transcription-termination/antitermination-protein-NusA	unknown	unknown	gnl\|CDD\|237061
NZ_CP023747.1\|WP_043444363.1\|5448794_5449700_+\|tRNA-pseudouridine(55)-synthase-TruB	unknown	unknown	gnl\|CDD\|235113
NZ_CP023747.1\|WP_043444371.1\|5456897_5458427_+\|type-VII-secretion-protein-EccB	unknown	unknown	gnl\|CDD\|368288
NZ_CP023747.1\|WP_043444373.1\|5458441_5459662_+\|type-VII-secretion-associated-serine-protease-mycosin	unknown	unknown	gnl\|CDD\|274856
NZ_CP023747.1\|WP_079162293.1\|5444250_5444532_+\|YlxR-family-protein	unknown	unknown	gnl\|CDD\|377288
NZ_CP023747.1\|WP_052454261.1\|5461058_5462297_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444361.1\|5448345_5448798_+\|30S-ribosome-binding-factor-RbfA	unknown	unknown	gnl\|CDD\|234787
NZ_CP023747.1\|WP_043444350.1\|5442614_5443124_+\|ribosome-maturation-factor-RimP	unknown	unknown	gnl\|CDD\|234627

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043444380.1\|5463030_5463384_+\|DUF4333-domain-containing-protein	gnl\|CDD\|379513	pfam14230, DUF4333, Domain of unknown function (DUF4333). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 140 and 255 amino acids in length. There are two completely conserved C residues that may be functionally important.	3.0597e-13
NZ_CP023747.1\|WP_150478302.1\|5444710_5447764_+\|translation-initiation-factor-IF-2	gnl\|CDD\|235401	PRK05306, infB, translation initiation factor IF-2; Validated.	0
NZ_CP023747.1\|WP_079162294.1\|5455317_5456481_-\|type-VII-secretion-protein-EccE	gnl\|CDD\|274857	TIGR03923, T7SS_EccE, type VII secretion protein EccE. This model represents the transmembrane protein EccB of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccE1, EccE2, etc. This model represents a conserved core region, and many members have 200 or more additional C-terminal residues. [Protein fate, Protein and peptide secretion and trafficking].	6.75718e-52
NZ_CP023747.1\|WP_043444365.1\|5449977_5450928_+\|bifunctional-riboflavin-kinase/FAD-synthetase	gnl\|CDD\|235536	PRK05627, PRK05627, bifunctional riboflavin kinase/FAD synthetase.	2.42536e-148
NZ_CP023747.1\|WP_043444348.1\|5441249_5441756_-\|ferritin-like-domain-containing-protein	gnl\|CDD\|373114	pfam14530, DUF4439, Domain of unknown function (DUF4439). This domain has a ferritin-like fold.	4.33582e-29
NZ_CP023747.1\|WP_043444359.1\|5448014_5448308_+\|DUF503-domain-containing-protein	gnl\|CDD\|377364	pfam04456, DUF503, Protein of unknown function (DUF503). Family of hypothetical bacterial proteins.	3.80732e-35
NZ_CP023747.1\|WP_043444352.1\|5443126_5444122_+\|transcription-termination/antitermination-protein-NusA	gnl\|CDD\|237061	PRK12327, nusA, transcription elongation factor NusA; Provisional.	0
NZ_CP023747.1\|WP_043444363.1\|5448794_5449700_+\|tRNA-pseudouridine(55)-synthase-TruB	gnl\|CDD\|235113	PRK03287, truB, tRNA pseudouridine synthase B; Provisional.	9.2092e-162
NZ_CP023747.1\|WP_043444371.1\|5456897_5458427_+\|type-VII-secretion-protein-EccB	gnl\|CDD\|368288	pfam05108, T7SS_ESX1_EccB, Type VII secretion system ESX-1, transport TM domain B. EccB is a family of largely Gram-positive bacterial transmembrane componenets of the type VII secretion system characterized in Mycobacterium tuberculosis, systems ESX1-5. Translocation of virulent peptides through the membranes is thought to be mediated via a complex that includes EccB, EccC, EccD, EccE, and MycP. EccB, EccC, EccD, and EccE form a stable complex in the mycobacterial cell envelope.	1.33885e-62
NZ_CP023747.1\|WP_043444373.1\|5458441_5459662_+\|type-VII-secretion-associated-serine-protease-mycosin	gnl\|CDD\|274856	TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin. Members of this family are subtilisin-related serine proteases, found strictly in the Actinobacteria and associated with type VII secretion operons. The designation mycosin is used for members from Mycobacterium. [Protein fate, Protein and peptide secretion and trafficking, Protein fate, Protein modification and repair].	6.22865e-95
NZ_CP023747.1\|WP_079162293.1\|5444250_5444532_+\|YlxR-family-protein	gnl\|CDD\|377288	pfam04296, DUF448, Protein of unknown function (DUF448).	1.83474e-22
NZ_CP023747.1\|WP_043444361.1\|5448345_5448798_+\|30S-ribosome-binding-factor-RbfA	gnl\|CDD\|234787	PRK00521, rbfA, 30S ribosome-binding factor RbfA.	2.79272e-49
NZ_CP023747.1\|WP_043444350.1\|5442614_5443124_+\|ribosome-maturation-factor-RimP	gnl\|CDD\|234627	PRK00092, PRK00092, ribosome maturation protein RimP; Reviewed.	1.03873e-41

>NZ_CP023747.1|WP_043444365.1|5449977_5450928_+|bifunctional-riboflavin-kinase/FAD-synthetase
MQRWRGLEDIPQDWGRSVVTIGSYDGVHRGHQLIIRHAVERARELGVPSVVVTFDPHPSEVVRPGSHPPLLAAHHRRAELMAGLGVDAVLVLPFTVEFSRLSAADFVVKVLVDKLHAKAVVEGPNFRFGHKATGNVEFLAEQGKTYDFEVEVVDLFVTGEAGGGEPFSSTLTRRLIAEGDVAGAREILGRPHRVEGVVVRGAQRGRELGFPTANVETLPHTAIPADGVYAGWLHVEGEAMPAAISVGTNPQFDGTERTVEAYAIDRVGLDLYGLHVGVDFLAYVRGQARFESLEALLEQMADDVKRCRELVAADED
>NZ_CP023747.1|WP_043444363.1|5448794_5449700_+|tRNA-pseudouridine(55)-synthase-TruB
MTQQHTPPDGLVIVDKPSGFTSHDVVAKMRGIARTRRVGHAGTLDPMATGVLVLGVERATKLLGHLALTEKEYVGTVRLGQNTVTDDAEGEIISSTDASEVTRDLIDAGIAKLTGDILQVPSKVSAIKINGVRSYKRARDGEDFEIPARPVTVSSFALYDVREAVAEDGTPVLDLLVSVVCSSGTYIRALARDLGADLGVGGHLTALRRTRVGPYKLESARTLDQLQEELTVMPVAEAAVAAFPRWDLDAKRVRLLANGVRLEMPDLYAGRGPVAVFGPEGEFVALVEAQKGKARSLAVFG
>NZ_CP023747.1|WP_043444361.1|5448345_5448798_+|30S-ribosome-binding-factor-RbfA
MADNARAKRLADLIREVVAQKLQRGIKDPRLGTHITITDTRVTGDLREATVFYTVYGDEEDRKAAAAGLESAKGILRSEVGRAAGVKFTPTLAFVADALPDNARTIEDLLDKARASDEKVRETATGASYAGEADPYKKPESTDETDDSTE
>NZ_CP023747.1|WP_043444359.1|5448014_5448308_+|DUF503-domain-containing-protein
MYVGTLSFDLLLGDVRSLKEKRSVVRPIVAELQRKYAVSAAEVDHMNLHRRAVIGLAAVSGDAGHLTDVLDRCERLVAGRPEVELLSARRRFHGDDD
>NZ_CP023747.1|WP_150478302.1|5444710_5447764_+|translation-initiation-factor-IF-2
MAKVRVYELAKEFGVESKVVMAKLQELGEFVRSASSTIEAPVVRKLTDALQQGNGGGAKPAAPRKATPARPAPSPAQAARPAAPRPAAPKPPAAERPAAPAPGPRPTPGPKPAPRPAPVSPAPSTPEFTAPPSAPAAQTPRPGARPGPGGPKPGARPAAPGQGQGGGQGARSGGPRQGGQGARPGGRPAGPRPGNNPFTSGGSTGMARPPRPGAPRPGAPGAPGGPRPQAAGQGGPRPGGASGGPRPQAPGGPRPTPGSMPRPQGGPRPGGGPAGPRPNPGMMPQRPAAGPRPGPGGRGPAGAGRPGGGGGGRPGGGGGFAGRPGGGGGAGRPGGGGGFAGRPGGGGPGGGGGFGGGGGGRPGFGGRPGGPGGRGGTQGAFGRPGGPARRGRKSKRQRRQEYEAMQAPSVGGVMLPRGNGETIRMSRGASLTDFAEKINANPASLVAVMMNLGEMVTATQSVSDETLQILAGEMNYTIQIVSPEEEDRELLESFDLEFGEDEGSEEDLVVRPPVVTVMGHVDHGKTRLLDAIRKTNVVAGEAGGITQHIGAYQVATEVNGQDRAITFIDTPGHEAFTAMRARGAKSTDIAILVVAANDGVMPQTVEALNHAKAADVPIVVAVNKIDVEGADPTKVRGQLTEYGLVAEEYGGDTMFVDISAKQGLHIDSLLEAVVLTADAALDLRANPDQDAQGISIESRLDRGRGAVATVLVQRGTLRVGDTMVVGDAYGRVRAMLDDNGNNVAEAGPSTPVQVLGLTNVPGAGDNFIVVDEDRTARQIAEKRAARERNAAFAKRTRRVSLEDLDKVLKAGEVQQLNLIIKGDASGSVEALESSLLQLDVGEEVDIRVLHRGVGAVTESDVDLAMGSDAIVIGFNVRAAGRAAQMAEREGVDVRYYSVIYQAIEEIEAALKGMLKPEYEEVELGTAEIREVFKSSKLGNIAGVLIRSGEVRRNTKARLIRDGKVVAENLNIEGLRRFKDDVTEIREGFEGGINLGNFNDIKVDDVIATYEMREKPRA
>NZ_CP023747.1|WP_079162293.1|5444250_5444532_+|YlxR-family-protein
MSGRTHARVRPERTCVGCRERAAKIELLRTVVDGDLCVPDPRGTLPGRGAYVHPALACLDLAVRRRAFPRALRVPGPLDTKALRRYVEQTDGC
>NZ_CP023747.1|WP_043444352.1|5443126_5444122_+|transcription-termination/antitermination-protein-NusA
MDIDMSALRGLVREKEISFDLLVEAIEAALLIAYHRTEGSRRHARVELNRETGHVTVWAKEDPEDLEEGQEAREFDDTPSGFGRIAATTAKQVILQRLRDAEDDATLGEYAGREGDIVTGVVQQGRDPKNVLVDIGKLEAILPVQEQVPGETYEHGKRIRSYVVRVAKGVRGPSVTLSRTHPNLVKKLFALEVPEIADGSVEIAAIAREAGHRTKIAVRSTRSGLNAKGACIGPMGGRVRNVMGELSGEKIDIVDWSDDPAEMVANALSPARVSKVEVVDFAARSARVTVPDYQLSLAIGKEGQNARLAARLTGWRIDIRPDTEQPAERRD
>NZ_CP023747.1|WP_043444350.1|5442614_5443124_+|ribosome-maturation-factor-RimP
MSTTQSERLRELLEPLVKSQGLDLEEIVVESVGRKRVLRVVVDSDTGADLDQIADVSRALSAKLDESDAMGQGAYDLEVGTPGAERLLEEHRHFARAVDRLVRFQLAEDGELVARILTVDDEGLDLEVPGVKGRKATTRRLLFPEITRARVQVEFNRKDKKDMTEEEEA
>NZ_CP023747.1|WP_043449408.1|5441752_5442340_-|hypothetical-protein
MLASAAGVALLAGCSAAPDPAARSSALSSADRARARAARDSAALAERYAQVIAAHPGLADRLRPLRAEVLRHVQAFGGASGASGAASGSASASASSPASASASASVTPSASGAVPSSASGPASASGSASASASAGASSVPEDPKAALKGLATAERNLADRRAEALLDLPGESARLMASVAAAGAVHAYLLTEGGK
>NZ_CP023747.1|WP_043444348.1|5441249_5441756_-|ferritin-like-domain-containing-protein
MSTTTSTPGTATGSTRAESAELTAVRAALRAEHAAVYGYGVVGGRIERARRQEARDAYDAHRARRDELARAVRDLGGSPDAAAAGYALPFTVDDSAAAVRLAAELEERVAAVYSDLVRASTDARRSLATAALREAAVRAVRWSGESVAFPGLAERAAAVPSTSATPRT
>NZ_CP023747.1|WP_167748036.1|5454475_5455312_-|hypothetical-protein
MTTGQGPTAGPGAYGRQGSSGADGAYGSTGAPVPGRPSAAARLRDQVRHGFGLVGPRNGRHTLSADQVDTLALPIGDDGVVIGVDTEGQPAVLGVNRPTPYDVVLIGGLWTAQVLALRAAATGARVAVETGRAQHWMQMVHAMGGGQNGMSVYDVGRVPPQGASAGNPVLVVRDCGMRPPRGRVVSGPWQAVLTLLPYLSPVAPRLIRQARLVGVQRVSPDEAAEIGRTMALPRTDVETLPTLHDGLTLWCTDRDRQYVMTQPTDAETGLLGMPRRMD
>NZ_CP023747.1|WP_079162294.1|5455317_5456481_-|type-VII-secretion-protein-EccE
MQRIVLLELAAAALLVGWVVGPLALIPAAVCAVLLVLPATVRRRGRSLPEWLATARALRARRKRAAAAPPGTEPGLAPAVECEPGLRTSSHRGRERRPVGIIGDGTFVSAVVQVEADSTALRAERTRQPLPLALIRDALEVDDIRLESAQVVLHTQPSPAIHLPQQSVAVSNYASLQAQTGAPAVRITWIALKLDPELCQEAVAARGGGLEGAQKCVVRVADHLASRLTGAGFRVTLLNEEELTAAVATSACANPLVTAEAGRAEAPQRRTEETGRSWRCDNRRHTTYWIRRWPQLGDQGPSLPQFVALMTAVPALATTFSLTLARGERQEVSLAGHLRVTGHDDDELVAARRALVQAARQAGAGLTRLDREQLPGMLATLPLGGAR
>NZ_CP023747.1|WP_043444371.1|5456897_5458427_+|type-VII-secretion-protein-EccB
MASRRDQLNAYTFAKRRMLASFVQSSPDASDEGAPRPLRAVLPGTLVGVIVMAAFGAWGMFKPTAPKGWDTPGEKVIIASKSTTRYVVLKTGKKTQLHPVLNMASAKLVLNTGKGDVVTVDESILDKGDIPHGVTIGIPYAPDRLPSEGEAGAAKRWAVCERPSAGGRSIQKAAFVLASRDMDRTEGRKQKLMGGELLYVAGPDGTRYIVDASGTSYEVDKDDELLLRTLVRSGRAPQRVSQQWLATLHQGDPITFPEVAGPIAADAGVSGSLPEGANKVGMVLRAPNGDTQQYYLVETGKVAPVSDFTAQLLLNSSDLTSLGQAGKALDVSAGAFVPALTEFAAEHKWPTHAPRAVNDADAAPGSRNTVCNVLRDVDEADGATTLSTWAGTDFPATLPTGSSSAYVTPGSGQLYRQFQGKETKAGGVFLVTDTGLRYAMQSNADSATDDAGIGVSAKERRELDQEAQLAQTRLGYAGVTPAAVPMEWSAFLPTGPRLSTAAARQPQGS
>NZ_CP023747.1|WP_043444373.1|5458441_5459662_+|type-VII-secretion-associated-serine-protease-mycosin
MPYARHRGAGLLGVMVVTATTTVMGSPAALAAGDQCTFPNKKYEGRPWALQRVLLDELWTQSKGKGVRVAVIDTGVDTTNSQLTSAVDASLGTNLLPTKDDKGEKIDRGRPDGTTDTVGHGTRVAGIIAARPAKGTGFVGLAPEATIIPIKQNDAEGHGTAGTLADAIRHAVAKRADVINISQDTADAVEPTPELRQEVEAALARGIVVVASAGNDGMGGNVKPTYPASYKGVLAVAASDRNNERAAFSQSGDFVGVAAPGVDMISTVPKGGHCSDNGTSFSAPYVAGVAALIKAKHQDWTAREIVAQIEQTAERSIAGHDRLVGWGVVDPVAALTEDDHPIESPSAREGLSKAEAPTPARLDLGETADERNIRLATYAAVGAAVLVAGTAGTAVAVRDARRRRRA
>NZ_CP023747.1|WP_043444376.1|5459747_5460452_+|hypothetical-protein
MNVLMPILVILVAGGIIALVVTLAVRVRRSEARSVQERAAAVRLAQERGWSYQQTTQGVVDRLCGTAPLPVSGRNLRATHYITGEFRGRGFCCFQYATGTMGVHDGPGRNRPTYWTVFTVTAPGPGPELVVRRPQPLDGMTGRGRLVRFGVPDFDEAFRVITDDESFARNALTGAVVPFLTTDPRAVKDAPLRLHHDELLTWRRGRLSPQDLDERLDYLCDVLDRIPPQVWSAA
>NZ_CP023747.1|WP_043449410.1|5460494_5460845_-|hypothetical-protein
MRDDAATMREIADESVQRLGQAGTVQVLKKEEVGTPAIPGLTDSPGVVQDLRLSTTLRGEPLELVQSQVYLGMEDVHHPSRRAVLELVLTAKPEQLPEVLDDFKEFVRSVRPDQDS
>NZ_CP023747.1|WP_052454261.1|5461058_5462297_-|hypothetical-protein
MAAALGSTTDPKALIPGDVETLTDLAGTMTRWSEKFDKVGANLRDLRVPGWHGEAGDAFLRSLSEEKGNWYTASDHLSGAATAITSYSGVLGWAQGQAADAIARWEDEDRTGAQEVLDHARTRLESASTTLSAELGRLAGGAADSPSWLTRAKQVIEDLGIGDTRFGYDGIRQYGNNPADKHTWQWGHQGGNAGDDPDAPRKPSWAVKIAGVSGGADVWSANARGETTVGGVKLSGETGVSLLGVDGSAFAGITDGNLELKATGNAYLAKATASGSAEYGIIGFQGQGSARVGANAETKVAAGKDGLNTGAEAFAGAKAQGSASADVGGIGAGVTGEAWAGAGASATMDLGKGDDGKYHIGGELGVGLGIGAKVGFQFTVDTDEVIDTVSDAAGAIGSAAESVWNHSLGALF
>NZ_CP023747.1|WP_043444378.1|5462316_5462628_-|hypothetical-protein
MADPDLGVDSDALKKGAKDVIEALRPTEGFGLEEPAGRSSSFGEASASSAFVEFCATWQAGTQILCGRTAGHAAGVVSAKSTLAGTDGDIRDAAGSVKTDQGR
>NZ_CP023747.1|WP_043444380.1|5463030_5463384_+|DUF4333-domain-containing-protein
MAMARTSTVTWSLSAVAAGVLLVGCSGSITIGNSAPELAADKLADTVAEKLAASTGREKPDITCPEDLVGKVGNTTRCTLTAADGSTLGVSVTVSAVEGSRIDFDIKADATASPAAQ
>NZ_CP023747.1|WP_043444382.1|5463604_5464042_+|hypothetical-protein
MIPDDMVGGASPARAADLEASSEALSTFQKRVNALLADFEASAGNPTKVGAQTISASSLNSGSSSAFPEAHGLYAQYNRVHERLTSLSKLLNLQIEAIGIAVQGAQRGFGNLEEEQRRRFWQIQVEIREGQDADRRTSDVKAGDF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_12

5941373-5941479

Orphan

Consensus_repeat	Method
GTCGCGCAGCGGGTCCAGGAGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023747_12

>merge|NZ_CP023747|12|5941373-5941479|CRISPRCasFinder
GTCGCGCAGCGGGTCCAGGAGCCGTCGGACTCCAGGAAGGCCTCCAGGGTCGGGATCAGCTCGGCGCGGTGCCGTCGGTCGTAGTCGCGCAGCGGGTCCAGGAGACG

>NZ_CP023747|12|11|5941373-5941479|CRISPRCasFinder
GTCGCGCAGCGGGTCCAGGAGCCG	TCGGACTCCAGGAAGGCCTCCAGGGTCGGGATCAGCTCGGCGCGGTGCCGTCGGTCGTA
GTCGCGCAGCGGGTCCAGGAGACG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043449570.1\|5940295_5941084_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444968.1\|5951206_5954026_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|226415
NZ_CP023747.1\|WP_150478316.1\|5931642_5933520_+\|protein-phosphatase-2C-domain-containing-protein	unknown	unknown	gnl\|CDD\|379325
NZ_CP023747.1\|WP_043444964.1\|5948465_5948975_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043449575.1\|5944621_5945704_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270831
NZ_CP023747.1\|WP_043444950.1\|5933573_5935316_+\|pyruvate-dehydrogenase	unknown	unknown	gnl\|CDD\|180614
NZ_CP023747.1\|WP_158508352.1\|5950866_5951016_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043444966.1\|5949120_5950635_+\|flotillin-family-protein	unknown	unknown	gnl\|CDD\|259798
NZ_CP023747.1\|WP_043444960.1\|5947123_5947594_-\|cation:proton-antiporter-regulatory-subunit	unknown	unknown	gnl\|CDD\|223564
NZ_CP023747.1\|WP_043444949.1\|5930191_5931172_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197715
NZ_CP023747.1\|WP_043444947.1\|5927546_5928695_+\|ribosome-small-subunit-dependent-GTPase-A	unknown	unknown	gnl\|CDD\|234988
NZ_CP023747.1\|WP_079162329.1\|5943388_5944489_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|226355
NZ_CP023747.1\|WP_043444952.1\|5936942_5937977_-\|DUF2637-domain-containing-protein	unknown	unknown	gnl\|CDD\|378511
NZ_CP023747.1\|WP_043444954.1\|5939323_5940223_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP023747.1\|WP_043444958.1\|5945876_5947121_-\|cation:proton-antiporter	unknown	unknown	gnl\|CDD\|223551
NZ_CP023747.1\|WP_043444970.1\|5954250_5955087_-\|LuxR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|99777
NZ_CP023747.1\|WP_043449560.1\|5928959_5930165_+\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238868
NZ_CP023747.1\|WP_043444962.1\|5947824_5948268_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP023747.1\|WP_043449568.1\|5938286_5939129_-\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|378676
NZ_CP023747.1\|WP_052454298.1\|5936443_5936884_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043444968.1\|5951206_5954026_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|226415	COG3899, COG3899, Predicted ATPase [General function prediction only].	9.65649e-18
NZ_CP023747.1\|WP_150478316.1\|5931642_5933520_+\|protein-phosphatase-2C-domain-containing-protein	gnl\|CDD\|379325	pfam13672, PP2C_2, Protein phosphatase 2C. Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.	2.39437e-18
NZ_CP023747.1\|WP_052454298.1\|5936443_5936884_+\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	2.60023e-18
NZ_CP023747.1\|WP_043444950.1\|5933573_5935316_+\|pyruvate-dehydrogenase	gnl\|CDD\|180614	PRK06546, PRK06546, pyruvate dehydrogenase; Provisional.	0
NZ_CP023747.1\|WP_043444960.1\|5947123_5947594_-\|cation:proton-antiporter-regulatory-subunit	gnl\|CDD\|223564	COG0490, COG0490, Putative regulatory, ligand-binding protein related to C-terminal domains of K+ channels [Inorganic ion transport and metabolism].	8.169e-36
NZ_CP023747.1\|WP_043444949.1\|5930191_5931172_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	7.17525e-08
NZ_CP023747.1\|WP_043444947.1\|5927546_5928695_+\|ribosome-small-subunit-dependent-GTPase-A	gnl\|CDD\|234988	PRK01889, PRK01889, GTPase RsgA; Reviewed.	9.30914e-180
NZ_CP023747.1\|WP_079162329.1\|5943388_5944489_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|226355	COG3835, CdaR, Sugar diacid utilization regulator [Transcription / Signal transduction mechanisms].	1.76157e-14
NZ_CP023747.1\|WP_043444952.1\|5936942_5937977_-\|DUF2637-domain-containing-protein	gnl\|CDD\|378511	pfam10935, DUF2637, Protein of unknown function (DUF2637). This family of proteins has no known function.	5.20953e-15
NZ_CP023747.1\|WP_043444954.1\|5939323_5940223_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	8.98135e-33
NZ_CP023747.1\|WP_043444958.1\|5945876_5947121_-\|cation:proton-antiporter	gnl\|CDD\|223551	COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism].	5.11319e-55
NZ_CP023747.1\|WP_043444970.1\|5954250_5955087_-\|LuxR-family-transcriptional-regulator	gnl\|CDD\|99777	cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.	3.27944e-13
NZ_CP023747.1\|WP_043449560.1\|5928959_5930165_+\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238868	cd01830, XynE_like, SGNH_hydrolase subfamily, similar to the putative arylesterase/acylhydrolase from the rumen anaerobe Prevotella bryantii XynE. The P. bryantii XynE gene is located in a xylanase gene cluster. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	4.03916e-89
NZ_CP023747.1\|WP_043444966.1\|5949120_5950635_+\|flotillin-family-protein	gnl\|CDD\|259798	cd03399, SPFH_flotillin, Flotillin or reggie family; SPFH (stomatin, prohibitin, flotillin, and HflK/C) superfamily. The flotillin (reggie) like proteins are lipid raft-associated. Individual proteins of this SPFH family may cluster to form membrane microdomains which may in turn recruit multiprotein complexes. In addition, microdomains formed from flotillin proteins may be dynamic units with their own regulatory functions. Flotillins have been implicated in signal transduction, vesicle trafficking, cytoskeleton rearrangement and interact with a variety of proteins. They may play a role in the progression of prion disease, in the pathogenesis of neurodegenerative diseases such as Parkinson's and Alzheimer's disease and in cancer invasion, and metastasis.	3.16587e-45
NZ_CP023747.1\|WP_043449568.1\|5938286_5939129_-\|(2Fe-2S)-binding-protein	gnl\|CDD\|378676	pfam11575, FhuF_C, FhuF 2Fe-2S C-terminal domain. This family consists of several bacterial ferric iron reductase protein (FhuF) sequences. FhuF is involved in the reduction of ferric iron in cytoplasmic ferrioxamine B. This domain is the C-terminal domain that contains 4 conserved cysteine residues that are found to be part of a 2Fe-2S cluster.	4.0973e-06
NZ_CP023747.1\|WP_043449575.1\|5944621_5945704_+\|hypothetical-protein	gnl\|CDD\|270831	cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinases activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both expressed ubiquitously, associate with all three D cyclins (D1, D2 and D3), and phosphorylate the retinoblastoma (pRb) protein. They are also regulated by the INK4 family of inhibitors which associate with either the CDK alone or the CDK/cyclin complex. CDK4 and CDK6 show differences in subcellular localization, sensitivity to some inhibitors, timing in activation, tumor selectivity, and possibly substrate profiles. Although CDK4 and CDK6 seem to show some redundancy, they also have discrete, nonoverlapping functions. CDK6 plays an important role in cell differentiation. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	7.91038e-06

>NZ_CP023747.1|WP_043449570.1|5940295_5941084_-|hypothetical-protein
MAHTAMSGTGTTADDDPLRTAVWRLRSRACWADAAALLRGRTAQDSLLRAALLVERCLYTEQGWAEAEDALRTAEAQADSDEERGAAACERGQLAYTATLHGVRDRADEARAALGRAAALIAPDSPDRALLDFRRGLLAENLSRSPQAARAAYQRAHANAATHGDTLLLSFTWRHLAGLALRDGELGEARHGFAESLRIREELGYLVGTAPALASLADTESEPEASRLRAEAGRLFRLLGGVPTWLPRHLASAGEATDPTGQ
>NZ_CP023747.1|WP_043444954.1|5939323_5940223_+|GntR-family-transcriptional-regulator
MEQARSRHAEGSAETGAVGARTRTTQLPSVPGAEDDRRERGAAPGSVRGEHTHGEPPLPRPRVVEPRRSGERSGAGEGPLYGAAPETEPGRPVVQRSSVRRQVLDALRTALVAGELAPGEVYSAPALGERFGVSATPVREAMQQLALEGAVEVVPNRGFRVVVRDARELAELAEVRALIEVPVMLRLARTVPAERWTGLRPLAEATVRAASCGCRATYAESDRAFHRAVLSLSGNEQLVRIAEELHRRAQWPLVSSPVLPGRADLIADAAEHTALLDALVAQDLTEVRSLVGEHFTVAP
>NZ_CP023747.1|WP_043449568.1|5938286_5939129_-|(2Fe-2S)-binding-protein
MPLPASPLSAAADAYARLAEVYPGLTVLELGPDGDAPEGEDWFPAAELAAGGAALEAFLAWDEAQVVRDYGQRARPDVVASFGLHRYAWPACLLITLPWFLRRRVPRLPVEHVAFQRAQGRMAVRTGAFACLPGDPAAGLPGARVVADEEALRAEVRAAVAEHLGPVLTGFGPRMRRRGRALWGMATDEVVEGLWYIAHLLGEERRAMRELELLLPGATKPYAGAAAFRELTGPDGETLPTRDRASCCLFYTLRPEDTCTTCPRTPDADRVAKLVAAAAC
>NZ_CP023747.1|WP_043444952.1|5936942_5937977_-|DUF2637-domain-containing-protein
MTDISLNWLLPGTVLLMGVLVAVVVLMRGKQSKESTSSEDSWERSEERRRRKEAVYSTASYALLFCCAAVAAALSFHGLVGFGEQNLNLSGGWQYLVPFGLDGAAMFCSVLAVREASHGDAALGSRILVWTFAAAAAWFNWVHAPRGLDHAGAPHFFAGMSLSAAVLFDRALKQTRRAALREQGLVPRPLPQIRVVRWIRAPRETYHAWSLMLLEGVRSLDEAVEEVREDRRQKEQHKTRRREQKRVERAQLKAISRGRRALSGGNGGRKAEMPTVERATEPVPSEPALPVGELPSHTRPSLQPVRNPAADPITVDLTTEDDTMALPRLDSLERKLKDLEQQFG
>NZ_CP023747.1|WP_052454298.1|5936443_5936884_+|ATP-binding-protein
MKRRVRGDGAAPQLRRRLGRADARAVPEARRALRELLIRWGRAERSDTAELLTSELVTNALFHTDRGAVLTATVSARGLRVEVRDFTGHLPRPRPPDGGERTHGRGLILVQSLADAWGVRAHGVGKAVWFELDAKEPPGVLDAGAA
>NZ_CP023747.1|WP_043444950.1|5933573_5935316_+|pyruvate-dehydrogenase
MAKQNVADQFVDILARAGVRRLYGVVGDSLNPVVDAVRRNSAVDWVHVRHEETAAFAAGAEAQISGRLAACAGSCGPGNLHLINGLYDAHRSMAPVLALASHIPSSEIGLGYFQETHPDQLFRECSHYSELISNPRQMPRLLQTAIQHAIGRSGVSVVSLPGDIADQPAPDRPAETALVTSRPTVRPGDHEIDELVEMIDRAERVTLFCGSGTAGAHTEVMEFAEKIKAPVGHALRGKEWIQYDNPYDVGMSGLLGYGAAYEATHECDLLILLGTDFPYNAFLPDDVKIVQVDVRPENLGRRSKLDLAVWGDVRETLRCLTPRVKLKQDRRFLDRMLRKHADALEGVVKAYTRKVDKHIPIHPEYVASVVDEMADPDAVFTVDTGMCNVWAARYLSPNGRRRVIGSFSHGSMANALPMAIGAQFTDRGRQVVSMSGDGGFSMLMGDFLTLVQYDLPVKVVLFDNSSLGMVELEMMVAGLPSYGTATKNPDFAAVARACGAYGIRVEKPKQLEGALKDAFRHQGPALVDIVTDPNALSIPPKIRADMVTGFALSASKMVLDGGVGRMLQMARSNLRNVPRP
>NZ_CP023747.1|WP_150478316.1|5931642_5933520_+|protein-phosphatase-2C-domain-containing-protein
MSQQGERPTDHEDDWWGELYDGSTGDAGPASAADTLDDRFASAAGTVGRDTEVPPPAPPVPGDPSAAAVPPAAPDRSVPEAQPGTAPGERGPDRRGGRPGTESGAPGVPAGAVDPPLPAIGADEPDPPGGPVRKAAPWEFRSARPTGPVTFPATPEPPGRSARSPRGGTPTEPTAVPSPRSPADPATAPACGPPPDTPSPTGRSPADRRLPPPPPPPFDAAPRGPVPHAPPADPRSLLDTDSRTSMNTELRAPADTDVPAQATPEPSTPANADPHTPANADRRTPTEADPHSSQNADRPPAGHAGSGPAPDDRPGVLPPADADALDGLVPDTVLDGGSFGTCTLRAVSARGDAARRQGEPRRDFLLTARFGTGEQALVLVAMATGAPGVAAEVCRWIGRAVGRSHLRLGEDIRSARRGELKSGLQRLTDRCLGTLRADAVERGLAPEEYSATLRCLLLPADPSCRTRVFFGVGAGGLFRLRDGAWQNIEPRVADASGEAVVGFGSPSTGTPGDDRLTVDLGITTPPGPDTAASRSPAPSPRGGGPVESARDPFRFRASIARPGDTLLLCTGGLADPLRAEPGVAEHLRDRWSTGEPPGLAAFLADTRVRAEGCSDDRTAVAVWEA
>NZ_CP023747.1|WP_043444949.1|5930191_5931172_-|LuxR-family-transcriptional-regulator
MLAAIGLDDTHESAYRALVAVGAAEVPDLARRLALGEYDTERALRRLERHGLAAQSSARSGRWVAAPPGVALGALLTQRRHELEQAELAAALLSEEYRAAASEPAVHDLIEVVIGAAAVSQRFLQLQLGATEEVCALVTGAPVAVSGTENDAEEQAAGRGVRYRVVVERAVLDQPTGITEVTAAITRDERVRVVDTVPTKLVVADRSLAMVPLTSHTAEPAALVVHASGLLELLCGLFESVWREALPLRLGSSGITEPAPDGPDSTDLEVLSLLLAGLTDVSVAKQLDLGLRTVQRRVKRLMELTGVTTRLQLGWHAYERGWVARD
>NZ_CP023747.1|WP_043449560.1|5928959_5930165_+|SGNH/GDSL-hydrolase-family-protein
MRRRCFAVLALTLVSTAATSPGASTRQETAPRWTGTWEAAPSGTAPALPGVSIRNVVHTSVGGSAARIRVTNRLGTAPLRLDAVTVALRRKDGPAGPGAVPGSLRAVTFGGESSVTVPAGQDRVSDPVRLRVPADADLLVSVYTPIASGPATYHRTALQTSYLAEGGNRTADTEGTAYTKTVSHWYYATGVDVLRPGTAGSVVALGDAVTDGTGSTAGADRRWPDVLSRRLRALPVSRRPGVLNAGISGNRLLLDGVGPSALARLDADVLSRTGVRTVVLLEGAGDLRRAPARTDAGAFVRAYRTLVSRAHARGVRVVGATLTPFGGHSGWTPARERLRHEINGLIRGGLFDAVADFDAAVRDPARPERLRVAYDPGDHVHLNDAGMQALADAIDLAELVR
>NZ_CP023747.1|WP_043444947.1|5927546_5928695_+|ribosome-small-subunit-dependent-GTPase-A
MNLSSLSASSHPLTPYGWDEAWESEFAPYAEKGLLPGRVVRVDRGQCDVVTPVGTVRADTEFVVPRDPMKVVCTGDWVAVDPDGEPQYVRTLLPRRTAFVRSTSSKRSEGQVLATNIDHVVICVSLAVELDLGRIERFLALAMSCSSGEALLHTSPLSRESGAQSIVVLTKADLVPDATTLDHLVQDVAATAPGVQVLPVSSRHGEGLDVLVATLSGGTAVLLGQSGAGKSTLANALLGEDVMTVQAAREVDGKGRHTTTTRNLLTLPGGGVLIDTPGLRGVGLWDAETGVGQVFSEIEELAARCRFHDCAHLAEPGCAVRAAADAGELSVRRLESYRKLLRENRRIVAKTDARVRAELRREWKRKGAAGREAMEAKRGRKR
>NZ_CP023747.1|WP_079162329.1|5943388_5944489_+|helix-turn-helix-domain-containing-protein
MPLSPPTVIASKKGERGEPGNAEAFLEGFEQILEDAAATGRRLTRNEIESRRDLGARAAEAGLGWRALVRAHLAAGRTSRPAGADPDAVLAVVEQAVDAFADGYERAQRRVVRKEEAARREFIDDLLHRRGDPGHLASRCERFGLRLSRTHAVAVAEGPEKYDESDPVPGQVAGELFARFENRRILFTTKDGRMICIAGGHQDDVLNHFAKLVHTVTGASRVAVGRSRPGAVGIGHSYEEALNALDVAQRMGLDEPLLRAADMLVFPVLARDRQALVDLVQHTLGPLETARGGAQPLLDTLAVYFDSGCVAAAAARELSLSVRALTYRLARIQALTGNDPTDPTHRYTLQTAVIGARLLEWPGRPL
>NZ_CP023747.1|WP_043449575.1|5944621_5945704_+|hypothetical-protein
MRHPDPRYAERLATYGTVATHLSLLSDRRLGEAVAAADPLGSGIGGRSAELDIDGTRVFVKRVPLTDTESRPENARSTANLFGLPMFYQYGVGSAGFGAWRELAVHIMATNWVLGNEYEGFPLMYHWRVLPDSPPEGVADEFGGIDGAVVHWEGSPAVRERLEAIGRSSSSLVLFLEHVPRTLADWLHDHRTAAPEGGESSPYPWVEQALARGTDFMSSHGLVHFDAHFANVLTDGRLLYFADFGLALSSGFELSASEAEFLSDHLGYDRCHTVSHLLRHHLPDGLRGGMEHETFLRAWDAGHRPDGVPPEIAAIIDRHSRAAMIFGEFARRLRTESKRTPFPAAEIERARRTTAITAPR
>NZ_CP023747.1|WP_043444958.1|5945876_5947121_-|cation:proton-antiporter
MHSTAVFLIEFGGILLSLGLLGRLAGRMGFSPIPLYLLAGLAFGKGGLLPLDTSEEFVATGAEIGVILLLLMLGLEYTASDLVSNLKTQYPAGLVDGALNALPGAAAALLLGWGPVAAIALAGVTWISSSGVIAKVLGELGRLGNRETPVILSILVLEDLSMAVYLPILTALLAGTGIAAGSVTLGIALGVAGLVLLLAVRFGRHISRFVSHDDPEKLLLVVLGLTLLVAGIAQQLQVSAAVGAFLVGIALSGEVAEGAHNLLSPLRDLFAAVFFVFFGLHTDPTDIPPVLLPALALAAVTTVTKIVTGYWAARRAGISVRGRWRAGGTLVARGEFSIVIAGLAVTAGVEPALGPLATAYVLILVVLGPISARWTEPIARRLTGRWGAPATATPDAALTAPQAALDDQDTVGHR
>NZ_CP023747.1|WP_043444960.1|5947123_5947594_-|cation:proton-antiporter-regulatory-subunit
MSSTPLPGIGVRYDLTTREQRRLSVVAHRDGSRTLSAYRDDDPDACALSVRLTSGEADTLIDALMPSHRSPNLLSTTELGLVAERIELSATSHWNGRLLGDTRMRTETGVSIVAVLRLAEATPSPGPAFRLAGGDILIVIGTREGVEAAAVILGRE
>NZ_CP023747.1|WP_043444962.1|5947824_5948268_+|hypothetical-protein
MIEWVSLGVEARPVPQPVATPLVWAGAFGGGLALVALLNAVAGPGRPLLALIALSVLAAVLSGCARFTAAPGTAVLCWLFLNGFAIPPEGTLTWAVRRDGWWLACLLGAALIGTALARLVTAHAAYRRLTTVIGTAIPGAEDLPPER
>NZ_CP023747.1|WP_043444964.1|5948465_5948975_+|hypothetical-protein
MAWFLGLGITGVVLLTLSLVFDGVLDGAFGGALDGVLDGWLSMPVIAGFVSMTGFGGAIALGVTDIGPAAATGVGVLAGLAAAWLTYRFSRALMRDQTASTPNGGDLVGTSGKVVTAIPTGGFGEVLLQLGGQPVKFAARSTVPVARGTEVWVEASPSSTSVVVRPVER
>NZ_CP023747.1|WP_043444966.1|5949120_5950635_+|flotillin-family-protein
MSPVIIAVVGVVVLLVLIALVVITRYKVAGPSEAFIITGRRGKKATDPQTGQVFTDNSGQKVVVGGGVFVVPFVQQKFSLDLSSRHIPVAVRGAVTLRGVKVNLDGVAIVKVGGTEDAIRAAAQRFLMQQDGIVGFTQEVLSGALRAIVGRMSVEDIIRDRAAFAGQVAEEAEASLSGQGLALDAFQIQDITTEGSYLEDLGRPEAARAKQEADIAEAVARRAAEQARLKAEEEIAVAQRTFYLKQAEIKAETDEASARAAAAGPLAEAARQQDILIEQEKVAERQAALTDRQLDTQVRKPADAQRYAAEQEAEAKRVARVKQAEAERLAAIAAAQGEAERARLTGEGEKQRRSALAEAEAIEGLKQGEAERARRGAIAEAVRLEGEAEAAAIGAKGAAEAEAMEKKADAYERYGDAAVLQMVVGALPEIVAKASEPLSAVEKMTVISTDGAGRIPRAVADNVAQGIELLGSTTGVDLAELLKGMSRRTGTAPAAVNGRTEITD
>NZ_CP023747.1|WP_158508352.1|5950866_5951016_-|hypothetical-protein
MFAPDRARATVAACTAAPPHLRGTFAAARPVALPFRTAVMDGPGVLAAS
>NZ_CP023747.1|WP_043444968.1|5951206_5954026_-|LuxR-family-transcriptional-regulator
MRRDFREPVRPRPDLVIGRENLLIGREDLVAGAREQLAAGGSVLVHGPAGIGKSTVLRALAEKRGREVHTVLRCSATESESHLPFLALADLLGLVMDEVAAQLPAPQRTALESALTGRGESTLQRDGLALRLAVLSTLRALAARGPVLIVADDLQWLDPASTELLGFAARRLGGTPVQLLCAVRTHSEPQGREHHGQLDTAPPGTLTLRVDPLSRPQTAQLLSHRGYSGLPRSIVRDIHRTSGGNPLFALELGRALVESPTPPRPGEPLPVPTSLRALVLNRLEALSAQARRTLLVASAGARPTLALLRAAGRENAEAETAQAAALGLLVTEQDAPGVRFAHPLISAALYAQAGAQERRDAHAALSTAASDPIERARHLALATTGTDPRVAARLGEAAAAARDRGAPSVAAGLGLLAARRTPADVLPGPEARRLQAAEDALTAGETDLARDIAHDVLDRATDPADRVRAWMVVINSAGHAMAEVDAAFPQALVDAGDDPRLLTLVHYLLGWRAVLVEGDFGQARDEGALAAELAARAGDRRNELLALAFQAHAETLMGHPDAPTTIARAQQEPQDPRVACDHNGPGAVRFRWLIMSDQLAEARTAVSALLREARRRGTVEAEVHFLRGLAETELRAGHCGRALDLARESLRLSRDTGIGEAPSAMLASFAEAAGGEVDRALALAREAVARTERNGDAIYLSRALAALGHAQLVAGDTEGAVRSLRRVGELEEGLGVTDPARGRWHGDLAEALVRIGEPAEAQALVDAARTRARRLERSGVLAVLDRAEALVRAGRGETEAAERQLAAARDRLARLGQGLEEARTAYALAEVRAQGRGPVSYAEAARLFRRCRAMPWLRRVETVAAGEPGRPARTTATLECLAATERQVAALVMEGATNREIAARLFISVKTVEATLTRVYRKLGIRSRVDIVRLAAGQG
>NZ_CP023747.1|WP_043444970.1|5954250_5955087_-|LuxR-family-transcriptional-regulator
MAADAAEAVQVRGALVRLRRATGLPVAFGGLVENGRRQMRISELNGNATTALSSLAVVSGNGLGGKVVALSRPCAVTDYSASRQISHEYDVAVATEGLKSVLAVPVVVRRRVRGVLYGALRTAQPLGDRVLNAAVAAARDVEQSLVAREEARALLGAVREPEAPAGAAWERVRDAHGALRSLAQRVEDPVLRTELLAVCGRLAGAGAPVRSARAAHLAPREVDVLSCVAGGSTNAATAELLGLRPETVKAYLRSAMRKLGAHTRWEAVVAARRAGVLP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP023747_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP023747_13

6097775-6097896

Orphan

Consensus_repeat	Method
GCGCAGTTCCCCGCGCCCCTGACGGGGCGCGA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP023747_13

>merge|NZ_CP023747|13|6097775-6097896|CRISPRCasFinder
GCGCAGTTCCCCGCGCCCCTGACGGGGCGCGACGCGCTCGGCGGCGACGGAGCCGGCTGGTTGGTTGGTGCGGGTGCGTCGGGGCTGAGTGCGCAGTTCCTCGCGCCCCTGACGGGGCGCGA

>NZ_CP023747|13|12|6097775-6097896|CRISPRCasFinder
GCGCAGTTCCCCGCGCCCCTGACGGGGCGCGA	CGCGCTCGGCGGCGACGGAGCCGGCTGGTTGGTTGGTGCGGGTGCGTCGGGGCTGAGT
GCGCAGTTCCTCGCGCCCCTGACGGGGCGCGA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP023747.1\|WP_043445145.1\|6096245_6097331_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|376263
NZ_CP023747.1\|WP_043445135.1\|6091864_6092221_+\|gas-vesicle-protein	unknown	unknown	gnl\|CDD\|376379
NZ_CP023747.1\|WP_043445137.1\|6092217_6093027_+\|GvpL/GvpF-family-gas-vesicle-protein	unknown	unknown	gnl\|CDD\|377652
NZ_CP023747.1\|WP_043445147.1\|6097906_6098437_-\|type-1-glutamine-amidotransferase	unknown	unknown	gnl\|CDD\|153228
NZ_CP023747.1\|WP_043445143.1\|6094542_6096162_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP023747.1\|WP_043445132.1\|6090030_6090756_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237855
NZ_CP023747.1\|WP_043445156.1\|6106521_6107148_-\|VTT-domain-containing-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP023747.1\|WP_043445141.1\|6093214_6093514_+\|gas-vesicle-protein-K	unknown	unknown	gnl\|CDD\|377462
NZ_CP023747.1\|WP_043449624.1\|6093523_6094348_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|316372
NZ_CP023747.1\|WP_043449631.1\|6108092_6108503_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238206
NZ_CP023747.1\|WP_043445134.1\|6090752_6091868_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176859
NZ_CP023747.1\|WP_043449628.1\|6099137_6102512_+\|pyruvate-carboxylase	unknown	unknown	gnl\|CDD\|237263
NZ_CP023747.1\|WP_043445139.1\|6093023_6093218_+\|gas-vesicle-protein	unknown	unknown	gnl\|CDD\|376379
NZ_CP023747.1\|WP_043445150.1\|6098505_6098898_-\|DUF2795-domain-containing-protein	unknown	unknown	gnl\|CDD\|378655
NZ_CP023747.1\|WP_043445158.1\|6107147_6107921_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225130
NZ_CP023747.1\|WP_079162337.1\|6089647_6090031_+\|gas-vesicle-protein-GvpG	unknown	unknown	gnl\|CDD\|310007
NZ_CP023747.1\|WP_043445154.1\|6104138_6105386_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|99734
NZ_CP023747.1\|WP_043445151.1\|6103028_6103919_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237057
NZ_CP023747.1\|WP_043449633.1\|6108976_6111106_+\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|377198
NZ_CP023747.1\|WP_043449629.1\|6105382_6106441_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293841

Protein	Function_ID	Function_description	E-value
NZ_CP023747.1\|WP_043445145.1\|6096245_6097331_-\|hypothetical-protein	gnl\|CDD\|376263	pfam18844, baeRF_family2, Bacterial archaeo-eukaryotic release factor family 2. Bacterial family of the archaeo-eukaryotic release factor superfamily. Likely to play roles in biological conflicts or regulation under stress conditions at the ribosome. This family contains a well-conserved 'FP' motif in the catalytic loop.	4.2097e-19
NZ_CP023747.1\|WP_043445135.1\|6091864_6092221_+\|gas-vesicle-protein	gnl\|CDD\|376379	pfam00741, Gas_vesicle, Gas vesicle protein.	6.19261e-15
NZ_CP023747.1\|WP_043445137.1\|6092217_6093027_+\|GvpL/GvpF-family-gas-vesicle-protein	gnl\|CDD\|377652	pfam06386, GvpL_GvpF, Gas vesicle synthesis protein GvpL/GvpF. This family consists of several bacterial and archaeal gas vesicle synthesis protein (GvpL/GvpF) sequences. The exact function of this family is unknown.	8.01944e-66
NZ_CP023747.1\|WP_043445147.1\|6097906_6098437_-\|type-1-glutamine-amidotransferase	gnl\|CDD\|153228	cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus. This group includes proteins similar to PfpI from P. furiosus. and PH1704 from Pyrococcus horikoshii. These enzymes are ATP-independent intracellular proteases and may hydrolyze small peptides to provide a nutritional source. Only Cys of the catalytic triad typical of GATase1 domains is conserved in this group. This Cys residue is found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow. For PH1704, it is believed that this Cys together with a different His in one monomer and Glu (from an adjacent monomer) forms a different catalytic triad from the typical GATase1domain. PfpI is homooligomeric. Protease activity is only found for oligomeric forms of PH1704.	1.29504e-71
NZ_CP023747.1\|WP_043445143.1\|6094542_6096162_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	3.10336e-93
NZ_CP023747.1\|WP_043445132.1\|6090030_6090756_+\|hypothetical-protein	gnl\|CDD\|237855	PRK14900, valS, valyl-tRNA synthetase; Provisional.	1.39965e-06
NZ_CP023747.1\|WP_043445156.1\|6106521_6107148_-\|VTT-domain-containing-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.64523e-16
NZ_CP023747.1\|WP_043445141.1\|6093214_6093514_+\|gas-vesicle-protein-K	gnl\|CDD\|377462	pfam05121, GvpK, Gas vesicle protein K. These proteins are involved in the formation of gas vesicles.	4.31887e-33
NZ_CP023747.1\|WP_043449624.1\|6093523_6094348_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|316372	pfam13847, Methyltransf_31, Methyltransferase domain. This family appears to have methyltransferase activity.	1.15613e-32
NZ_CP023747.1\|WP_043449631.1\|6108092_6108503_+\|hypothetical-protein	gnl\|CDD\|238206	cd00338, Ser_Recombinase, Serine Recombinase family, catalytic domain; a DNA binding domain may be present either N- or C-terminal to the catalytic domain. These enzymes perform site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and serine recombinase. Serine recombinases demonstrate functional versatility and include resolvases, invertases, integrases, and transposases. Resolvases and invertases (i.e. Tn3, gamma-delta, Tn5044 resolvases, Gin and Hin invertases) in this family contain a C-terminal DNA binding domain and comprise a major phylogenic group. Also included are phage- and bacterial-encoded recombinases such as phiC31 integrase, SpoIVCA excisionase, and Tn4451 TnpX transposase. These integrases and transposases have larger C-terminal domains compared to resolvases/invertases and are referred to as large serine recombinases. Also belonging to this family are proteins with N-terminal DNA binding domains similar to IS607- and IS1535-transposases from Helicobacter and Mycobacterium.	0.00449572
NZ_CP023747.1\|WP_043445134.1\|6090752_6091868_+\|SRPBCC-family-protein	gnl\|CDD\|176859	cd07817, SRPBCC_8, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	9.6715e-34
NZ_CP023747.1\|WP_043449628.1\|6099137_6102512_+\|pyruvate-carboxylase	gnl\|CDD\|237263	PRK12999, PRK12999, pyruvate carboxylase; Reviewed.	0
NZ_CP023747.1\|WP_043445139.1\|6093023_6093218_+\|gas-vesicle-protein	gnl\|CDD\|376379	pfam00741, Gas_vesicle, Gas vesicle protein.	1.61869e-08
NZ_CP023747.1\|WP_043445150.1\|6098505_6098898_-\|DUF2795-domain-containing-protein	gnl\|CDD\|378655	pfam11387, DUF2795, Protein of unknown function (DUF2795). This family of proteins has no known function.	6.3844e-05
NZ_CP023747.1\|WP_043445158.1\|6107147_6107921_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225130	COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only].	2.42e-32
NZ_CP023747.1\|WP_079162337.1\|6089647_6090031_+\|gas-vesicle-protein-GvpG	gnl\|CDD\|310007	pfam05120, GvpG, Gas vesicle protein G. These proteins are involved in the formation of gas vesicles.	2.20052e-18
NZ_CP023747.1\|WP_043445154.1\|6104138_6105386_+\|aminopeptidase	gnl\|CDD\|99734	cd00609, AAT_like, Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. The major groups in this CD corresponds to Aspartate aminotransferase a, b and c, Tyrosine, Alanine, Aromatic-amino-acid, Glutamine phenylpyruvate, 1-Aminocyclopropane-1-carboxylate synthase, Histidinol-phosphate, gene products of malY and cobC, Valine-pyruvate aminotransferase and Rhizopine catabolism regulatory protein.	4.23654e-10
NZ_CP023747.1\|WP_043445151.1\|6103028_6103919_+\|hypothetical-protein	gnl\|CDD\|237057	PRK12323, PRK12323, DNA polymerase III subunit gamma/tau.	0.00506919
NZ_CP023747.1\|WP_043449633.1\|6108976_6111106_+\|alkaline-phosphatase-family-protein	gnl\|CDD\|377198	pfam04020, Phage_holin_4_2, Mycobacterial 4 TMS phage holin, superfamily IV. These proteins are predicted transmembrane proteins with probably four transmembrane spans. The 1.E.40 is represented by the mycobacterial 4 phage holin, but it also contains many cyanobacterial. proteobacterial and firmicute proteins. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as in those of the bacteriophage of these organisms. The primary function of holins appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded the enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases.	6.65116e-13
NZ_CP023747.1\|WP_043449629.1\|6105382_6106441_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293841	cd16283, RomA-like_MBL-fold, Enterobacter cloacae RomA and related proteins; MBL-fold metallo hydrolase domain. Derepression of the romA-ramA locus results in a multidrug-resistance phenotype. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	9.25213e-86

>NZ_CP023747.1|WP_043445145.1|6096245_6097331_-|hypothetical-protein
MDLAFLHPLYEHPGPWASVYVDTSRHSGSTHQDRASTARELARDLREQGADRATCHAVRAAVEELALSPEPLGRALFARAGEVVLDPPLAAAPGGSSARWAALPHTAPLLDLATEDPVCAVAYIDRAGAEFELRGAVGSREAGPPRGTADPDRPVRHFRLRVENAWDHNAAEIADALAVCQEETGAGLVVLVGERRARRSVRERLPHRLRDRVAEASPGPGGRLLDEDVERIREAHLRDRAAAELERFLAARTPDENGRTRAVEGVSAVAEAARDHRIDELLIRPGGPDTRREVWIGEDPDRVAVRPDDLGSPGEQHPWRARADDALLRAAVETGAPAVSVPSTAGGEAPAGGVGALLRGD
>NZ_CP023747.1|WP_043445143.1|6094542_6096162_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MGHLEAAHLQYDLPDGRALLGDVSFRVGDGAVVALVGPNGAGKTTLLRLLSGELQPHGGSVTVSGGLGVMRQFVGSVRDATTVRDLLVSVAPPRIREAARTVDDAEHALMTVDDEAAQLGYAQALSDWAEVRGYEAETLWDMCTTAALGVPYEKAQWREVRTLSGGEQKRLVLEALLRGTDEVLLLDEPDNYLDVPGKRWLEERLTETRKTVLLVSHDRELLARAAQRIVSLEPSPAGADAWVHGGGFATYDQARRERFARFEELRRRWDEKHAQLKKLVLNLRQAATVSHELASRYQAAQTRLRKFEEAGPPPEPPREQDIRMRLKGGRTGVRAVTCEQLELTGLMKPFDLEVFYGERVAVLGSNGSGKSHFLRLLAGGEVAHSGRWRLGARVVPGHFAQTHAHPELQGRALLDILWQEHSQDRGAAMSRLRRYELTAQCEQPFDRLSGGQQARFQILLLELQGVTALLLDEPTDNLDLESAEALQKGLEAFEGTVLAVTHDRWFARSFDRYLVFGSDGRLRETPEPVWDERRVERAR
>NZ_CP023747.1|WP_043449624.1|6093523_6094348_-|class-I-SAM-dependent-methyltransferase
MPKETAVYTHGHHESVLRSHTWRTAANSAAYLLDSIQPHMRILDIGCGPGTITADLAELVPDGRVTGVDHAPGILEQARATAGARGLTNVEFAVADVHALDYPDDTFCVVHAHQVLQHVGDPVQALREMHRVTRPGGLIAARDADYAAMTWYPASEGLEDWLDLYERVARANGGEPDAGRRLLSWALDAGIREVTAGSSTWTFATAEERAWWSGLWADRTLASAYADRAVEGGHTTSEGLRAVSRAWREWGERQNGWFAVLHGEILCRKDGKDT
>NZ_CP023747.1|WP_043445141.1|6093214_6093514_+|gas-vesicle-protein-K
MTDRTPRKPRNRLDLEPDTVERDLVKLVLTVVELLRQLMERQAVRRFDTGELTEAQEERMGRTLMLLEDRMAELRDHYGLRPEDLNLDLGPLGPLLPRE
>NZ_CP023747.1|WP_043445139.1|6093023_6093218_+|gas-vesicle-protein
MTVVEHREIALVDLLDRLLAGGVVIAGDITLRIADVDLVRIDLNALISSVDARVPSPWPEAQAP
>NZ_CP023747.1|WP_043445137.1|6092217_6093027_+|GvpL/GvpF-family-gas-vesicle-protein
MTALRYVYAVCRPLGAPLQAQLTGVAGAPARQLEHHGLIAVLSLVPEEDFAEAPLKAHLEDLDWLTDTARAHQNVIDALTGLTTPLPLRLGTVFRDDSGVRVMLEAREKEFRHAMERLEGRVEWGVKVYVEESEADEDEKGREHGEKAGPAAPAGAVSGRDYLRQRRSRTRAHEETWQRAEGFARRLHDMLSAQAEDSRLHAPQSATLSGASGRNVLNAAYLVPRSRSEEFVELVDRVEDDSPGVRVELTGPWAAYSFTGLTEGTEGAA
>NZ_CP023747.1|WP_043445135.1|6091864_6092221_+|gas-vesicle-protein
MTTPRRLPDPYGGPSSGASLADILERVLDKGVVIAGDIRINLLDIELLTVKLRLIVASVDKAKEMGIDWWESDPALSSGARRDELTRENAELRARLERLEASYGEAQIEGAHGRRESP
>NZ_CP023747.1|WP_043445134.1|6090752_6091868_+|SRPBCC-family-protein
MTDTIGSVTGRATGKAGDQLSSSARSEAVDRLKTEVRGYLAAQAERMLVGVGRKLGETTVKLNDIAEGKSPGLAGLALEGGRKLAEGKGPLRALLESGAGQAKQSLGQAFKGLMGGKKRKGRGGDKPTVIVESVDVGVPVRTAYDQWTRYEDFSTFAKGVKSASRADDTTSDWQLKVLWSSRSWKGHTVEQVPDYRIQWSTEGAKGTSKGVISFHALGENLTRVLLVMEYYPSGFFEKTGNIWRAQGRRARLDFKHFARHITLKGEVEDGWRGEISDGEVVRTHEEALAEEEQPEDEYEEETGEEEPEAEHEEGEEEEEEPDEEYEDEGTGAAGEYGEEEEPEEAEEGDDDEGDAREADREAGRPTAGSRR
>NZ_CP023747.1|WP_043445132.1|6090030_6090756_+|hypothetical-protein
MNRTALGLAIGAGYLLGRTRKMKLAFTVASLVAGKRKDLNPRALADRINQQLTENPQLKEMGDQLRQELRGAGKAASGALLDRRIEGIADRLHDRTAQLRDQLPGSLPEGPEPSGPTDRGEQERTGEEGPGRADTGDAEEDEETEAPRTETAKRTPAEAGERPRKSPDERTPGRPEAAGRTGAEKAPGKASGKKAPADRAPGKRAAVKRTAPAKKSASARAGARRAAREARGPSGEGRRSG
>NZ_CP023747.1|WP_079162337.1|6089647_6090031_+|gas-vesicle-protein-GvpG
MGLLSETVLLPFAPARGSLWVIRQLIAEAERQYYDPATVRAELALLERRLDEGEITAEEFDREEDALLDRLEIGLGRATAMGGTAEADDATAVDAEATEDATAAQDAAVTGGTAEPGGAADTGDRTT
>NZ_CP023747.1|WP_043445147.1|6097906_6098437_-|type-1-glutamine-amidotransferase
MRIAFLMAPEGVEQVELTDPWQAVTGAGHEPVLVSTRPGHIQAFHHLDKADTFPVDTVVSQVEAEDFDGLVLPGGVANPDFLRMDERAVSFVRDVVRRGRPVAAVCHGPWTLVEADVVRGRTLTSWPSLRTDIRNAGGTWVDEQVRIDQGPNKLITSRRPDDLKAFDEAILTEFAA
>NZ_CP023747.1|WP_043445150.1|6098505_6098898_-|DUF2795-domain-containing-protein
MQRGSDRLSVHRDDEMKHELKDLLRSGRPTRTEEWHDPEPTADDDPAVWAGPVTTGGAPSVAEVRHELARHLSRTMFPARPYELIHELRRGHAPDALVDPLERLPRSARYVNAQELAEAVVRTEETVRQA
>NZ_CP023747.1|WP_043449628.1|6099137_6102512_+|pyruvate-carboxylase
MFRKVLVANRGEIAIRAFRAGYELGARTVAVFPHEDRNSLHRLKADEAYEIGEPGHPVRAYLSVEEIVGAALRAGADAVYPGYGFLSENPDLARACEEAGITFVGPSADTLVLTGNKARAVEAARAAGVPVLASSAPSTDVDTLVGAAEEIGFPVFVKAVAGGGGRGMRRVEDPAALRESIEAASREAASAFGDPTVFLEKAVVEPRHVEVQILADGEGEVIHLFERDCSVQRRHQKVIELAPAPNLDPELRDRMCADAVRFAREIGYRNAGTVEFLLDRDGHHVFIEMNPRIQVEHTVTEEVTDVDLVQAQLRIAAGETLADLGLSQETVTLRGAALQCRITTEDPANGFRPDTGRISAYRSPGGSGIRLDGGTTHAGTEISAHFDSMLVKLTCRGRDFKAAIGRARRAVAEFRIRGVATNIPFLQAVLDDPDFQAGRVTTSFIEQRPHLLTARHSADRGTKLLTYLADVTVNKPHGERPHLIDPAGKLPRLLPGEPPAGSRQRLVELGPEGFARQLRRSPTIGVTDTTFRDAHQSLLATRVRTRDLLAVAPAVARTLPELLSLECWGGATYDVALRFLAEDPWERLAALREAVPNICLQMLLRGRNTVGYTPYPTEVTDAFVQEAAATGIDIFRIFDALNDVGQMRPAIDAVRETGTAVAEVALCYTADLSDPSERLYTLDYYLRLAEQIVAAGAHILAVKDMAGLLRAPAAATLVAALRREFDLPVHLHTHDTAGGQLATYLAAIQAGADAVDGAVASMAGTTSQPSLSAIVAATDHSERPTGLDLGAVGDLEPYWESVRRIYAPFEAGLAAPTGRVYHHEIPGGQLSNLRTQAVALGLGDRFEEIEAMYAAADRMLGRLVKVTPSSKVVGDLALHLVGAGVAPEDFEAAPDRYDIPDSVIGFLRGELGTPPGGWPEPFRTRALTGRGEAKPVRELTADDRAGLEKARRPTLNRLLFPGPTRDFEAHRQAYGDTSVLDSKAFFYGLLPGKEYGVDLEPGVRLLIELQAVGQADERGMRTVMSSLNGQLRPIQVRDTAVASDVPATEKADRSDPGHVAAPFAGVVSLSVAEGDEVAAGATVATIEAMKMEATITASRSGTVTRLAITPVQQVEGGDLLVEIT
>NZ_CP023747.1|WP_043445151.1|6103028_6103919_+|hypothetical-protein
MRHSARVLSAAALAGAALGAVAPSASADPTAAITPRSAIPGGTVTVSVSCDATGAAPPDFIDATSQGFEAGRARLIRVDATDDTRAQQPAVLYSGTARIPTGGSVGAVTEAAGREAVWGVDGWCPVAPGSRQKPWDASFTVARDRAGQQGEGPIQLPGNDQAGTASQPLAGPPADDPAQQPGSAQGDLPPQSAGRQGAAGPPAFGNPFPSPGRPQGDGQDQWGKQRGDDQDGRRGDRDEGSGPPVGVQHGAHAGEGGAFGESVPMQIAGGFLIALALAAAVHRLWRRGALGHGRTL
>NZ_CP023747.1|WP_043445154.1|6104138_6105386_+|aminopeptidase
MRRTDPEGHGPVRYGPLLPDHGLPLLPGLAGALTAAAERDGVDGFGRIPALLDAAGGYFGRRGLPTGPGALATAPGAPVLFVAITAALGGDVLVPRPCPAWWAPQVRALGRSAYQVATPAECGGVPDPYALLETVRRVREEGGDPRLLVLSVADDPTATVAPPEVVHETVEAGVGEGLHLVSDETWRDTVHRPYDTVLLSPAEMVPDRVTVVTDLAGPFLPSGWPAAVARFPAGADGAGLHARVLDVLTALGARIADPIAAAAAYALDEPADITRRLAADTAVHAQVAAAVHGIVVAAGALARPPQAGRHLYVDFGPLRPELGARGIGDAQELEDLLTGRLGMPAPGGHRFGDDLEALRVRLSTAPFLGRTAAERSRCLIAPEPLEPPHVQRALIHLGSVFDDLRDEAQRWEPPR
>NZ_CP023747.1|WP_043449629.1|6105382_6106441_+|MBL-fold-metallo-hydrolase
MTQQSESTTSTVSEQQAVHEPVSRPLLRPYPPLAAPRPLGELRLWPRSFMDRLTAPLPGLKAFARFAREGAVRPGTEGLKDVPLLPYEPAPLPRVGVRTVAVSWAGHASWVVRIGGLSVLTDPVWSRRILGTPARITPVGIAWGELPRLDAVVVSHNHYDHLDAPTLSRLPRHIPVFAPAGLAAWFRRRRFSCVTELDWWEGAELDGVRFDFVPAHHWSKRTLTDTCRSLWGGWVLTAPDGQRVYFAGDTGYGHWFERIGRRYPGIDLALMPIGAYDPRWWLRDVHCDPEEAVRATLDLGARRMAPMHWGTFVLSAEPVLEPLTRVRVAWEKAGLDREDLWDLPVGASRVLE
>NZ_CP023747.1|WP_043445156.1|6106521_6107148_-|VTT-domain-containing-protein
MFLGTAAGTGVPPESTQQAIGYPSLFLLVLIGALVPVVPTGALVSSAAVVAFHHTAPLSLVLVFVVAAFAAYLGDLALYWLGQRGMRSKNGSRRLEALRRRAPEDRLAQAQEKLNEHGVAVLTLSRLVPAGRIPVMLACLLARMPLREFARGDAPACLAWAATYQVIGILGGSLFREPWEGVAAAVALTLAVSTAPGVWRRIRGTATP
>NZ_CP023747.1|WP_043445158.1|6107147_6107921_-|MBL-fold-metallo-hydrolase
MPVEITWWGHATCTVEDSGTRVLTDPLFARRLAHLHRRRGALPPPEAAVAEVALVSHLHADHLHLPSLARLAPGTLLVVPRGAPERVPGLHRLDRLRITEVVPGDRVRVGDLVVRVVRARHDGRRLPVGPHRCPALGFVVEGTARTYFAGDTGLFASMAEEVGQVDVALLPVGGWGPYLGPGHLDAGRAAQALARLMPRSAVPVHYGTYWPIGMDAVRPHEFYAPGEEFVRLAARWAPEVSVHLPAQGESVRPEVAR
>NZ_CP023747.1|WP_043449631.1|6108092_6108503_+|hypothetical-protein
MGPGQVRVVAIASLTPLEELDAEPFLVDSRSQHAMCARWAVERGYVVTRELLVRGLRPDHRALWADVDAGLVDLFVAPSRRVLERALSSVEEFTAECARRGVRVETVGRAEPSYDARMKACVHRRLSMPTAGYDGR
>NZ_CP023747.1|WP_043449633.1|6108976_6111106_+|alkaline-phosphatase-family-protein
MISGVWRSIAVWAASTATMLLLAGLLPDFRLESAGGDSITRVALTAAVGAGVFGLLSSLVWPLLVRLMLLVPALVLGLLVFFLNGSLLLVALRLNPSGRGEAAPETAVVVAAVMSAVASATGGALAVRDDDAYRRRLHRLADRRRGRARDRTGPRTPAVLFLQLDGVGHEVLRSAVDRGLMPTVASWLGPRDDHGPSHRLTPWRTDWSSQTGASQLGILHGSNHDVPAFRWYEKDRREVMVSNRPSSAAELQRRAVARTGDGGLLADGGASRGNLFSGGADEVALVLSVAVRRGRENRSRAGYFAYFSDPANAVRTALSFLAEVGREIAQSTRARLARRRPRVKRGGLYPLVRAFATVVERDVVVAAVIGDMLAGRDVIYADLVAYDEVAHHSGPHSGDAEQVLRRLDRSLALLAQVAEHAPRPYRIVVLSDHGQSPGETFRTRYGLGLADLVRAGCGLGVPRRAAGALARVEQWGSTHSGTEARAAVRVALRRPVEEHAEIEEHIAVEEHSGTRRAARRRSEPVVLASGNLGLVSFPDVPHRMTKEEIDRRHPALLPALAGHPGIGFVLVRSQEHDGVVLGADGAQVPLGLLADGDGPLAGFGPGAADAIRRTHSFPHTADIMVNSWYDPVGGEVLAFEEQIGSHGGLGGAQGRPFLLSPVDLSAPDEEGAELVGAERLHRVFRRWLDECRGHPVPLPAPEDEQERAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP023747_4	4.11\|1960766\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960766-1960797	32	NZ_CP023747.1	5415646-5415677	0	1.0
NZ_CP023747_8	8.3\|3671228\|41\|NZ_CP023747\|CRT	3671228-3671268	41	NZ_CP023747.1	3671396-3671436	0	1.0
NZ_CP023747_8	8.4\|3671288\|23\|NZ_CP023747\|CRT	3671288-3671310	23	NZ_CP023747.1	3671456-3671478	0	1.0
NZ_CP023747_8	8.5\|3671330\|20\|NZ_CP023747\|CRT	3671330-3671349	20	NZ_CP023747.1	3671498-3671517	0	1.0
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NZ_CP023747.1	131353-131382	1	0.967
NZ_CP023747_8	8.5\|3671330\|20\|NZ_CP023747\|CRT	3671330-3671349	20	NZ_CP023747.1	1870799-1870818	1	0.95
NZ_CP023747_8	8.1\|3671099\|41\|NZ_CP023747\|CRT	3671099-3671139	41	NZ_CP023747.1	3671396-3671436	2	0.951
NZ_CP023747_8	8.5\|3671330\|20\|NZ_CP023747\|CRT	3671330-3671349	20	NZ_CP023747.1	3671396-3671415	2	0.9

1. spacer 4.11|1960766|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to position: 5415646-5415677, mismatch: 0, identity: 1.0

gcgcaccgcccccgtcctcaagcactggctgg	CRISPR spacer
gcgcaccgcccccgtcctcaagcactggctgg	Protospacer
********************************

2. spacer 8.3|3671228|41|NZ_CP023747|CRT matches to position: 3671396-3671436, mismatch: 0, identity: 1.0

aagccaccgcggtcgtcacgacgctcgaacgaacgaccacc	CRISPR spacer
aagccaccgcggtcgtcacgacgctcgaacgaacgaccacc	Protospacer
*****************************************

3. spacer 8.4|3671288|23|NZ_CP023747|CRT matches to position: 3671456-3671478, mismatch: 0, identity: 1.0

tcgaaaccacgctcaccgtcacg	CRISPR spacer
tcgaaaccacgctcaccgtcacg	Protospacer
***********************

4. spacer 8.5|3671330|20|NZ_CP023747|CRT matches to position: 3671498-3671517, mismatch: 0, identity: 1.0

aagccaccacggtcgtcccg	CRISPR spacer
aagccaccacggtcgtcccg	Protospacer
********************

5. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to position: 131353-131382, mismatch: 1, identity: 0.967

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgccgcgccttgctcggtccgttcgcc	Protospacer
******.***********************

6. spacer 8.5|3671330|20|NZ_CP023747|CRT matches to position: 1870799-1870818, mismatch: 1, identity: 0.95

aagccaccacggtcgtcccg	CRISPR spacer
aagccaccacggtcgtcacg	Protospacer
***************** **

7. spacer 8.1|3671099|41|NZ_CP023747|CRT matches to position: 3671396-3671436, mismatch: 2, identity: 0.951

aagccgccccggtcgtcacgacgctcgaacgaacgaccacc	CRISPR spacer
aagccaccgcggtcgtcacgacgctcgaacgaacgaccacc	Protospacer
*****.** ********************************

8. spacer 8.5|3671330|20|NZ_CP023747|CRT matches to position: 3671396-3671415, mismatch: 2, identity: 0.9

aagccaccacggtcgtcccg	CRISPR spacer
aagccaccgcggtcgtcacg	Protospacer
********.******** **

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_015314	Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence	67166-67187	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1100639-1100660	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1100645-1100666	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1100651-1100672	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP039918	Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626a, complete sequence	116308-116329	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774969-774990	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774975-774996	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774981-775002	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774987-775008	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774993-775014	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774999-775020	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	775005-775026	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	783240-783261	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	783246-783267	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2148878-2148899	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	2148884-2148905	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1100762-1100783	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1100768-1100789	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1100774-1100795	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1297380-1297401	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	CP027480	Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence	152185-152206	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1100448-1100469	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1100454-1100475	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1100394-1100415	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1100400-1100421	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	589037-589058	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	589043-589064	1	0.955
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	267042-267063	1	0.955
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	52054-52083	2	0.933
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	599859-599888	2	0.933
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1100633-1100654	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1100657-1100678	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	774963-774984	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	775011-775032	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1100756-1100777	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1100780-1100801	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1297374-1297395	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	1297386-1297407	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1100442-1100463	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1100460-1100481	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1100388-1100409	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1100406-1100427	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	589031-589052	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	589049-589070	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1387981-1388002	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP009293	Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence	289221-289242	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	597070-597091	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	597076-597097	2	0.909
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP009146	Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence	931680-931701	2	0.909
NZ_CP023747_4	4.12\|1960217\|21\|NZ_CP023747\|CRT	1960217-1960237	21	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	439150-439170	2	0.905
NZ_CP023747_4	4.12\|1960217\|21\|NZ_CP023747\|CRT	1960217-1960237	21	NZ_CP013054	Sinorhizobium americanum CCGM7 plasmid C, complete sequence	951340-951360	2	0.905
NZ_CP023747_8	8.4\|3671288\|23\|NZ_CP023747\|CRT	3671288-3671310	23	NZ_CP034153	Rhodococcus sp. NJ-530 plasmid unnamed1, complete sequence	76557-76579	2	0.913
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	CP000662	Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence	875479-875503	2	0.92
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NZ_LN831789	Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2	3420-3449	3	0.9
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NZ_CP018075	Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence	5278-5307	3	0.9
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	267048-267069	3	0.864
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	MN693899	Marine virus AFVG_250M76, complete genome	38552-38573	3	0.864
NZ_CP023747_3	3.2\|479213\|22\|NZ_CP023747\|CRISPRCasFinder	479213-479234	22	MN694557	Marine virus AFVG_250M634, complete genome	9485-9506	3	0.864
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_013449	Streptomyces sp. W9 plasmid pCQ3, complete sequence	31558-31589	3	0.906
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_019307	Streptomyces sp. W75 plasmid pCQ4, complete sequence	35405-35436	3	0.906
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	NZ_CP024272	Escherichia coli strain F8111-1SC3 plasmid unnamed3, complete sequence	40548-40572	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	NZ_CP024274	Escherichia coli strain F9792 plasmid unnamed, complete sequence	137675-137699	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	NZ_CP024227	Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed4, complete sequence	137757-137781	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	NZ_CP024248	Escherichia coli O27:H7 strain B4103-1 plasmid unnamed3, complete sequence	37388-37412	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	AP014654	Escherichia coli O169:H41 plasmid pEntYN10 DNA, complete sequence	101410-101434	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	NZ_CP024265	Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed2, complete sequence	119958-119982	3	0.88
NZ_CP023747_10	10.1\|5361005\|25\|NZ_CP023747\|CRISPRCasFinder	5361005-5361029	25	LN908840	Escherichia coli plasmid pCss_E1373	64260-64284	3	0.88
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	NC_011887	Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence	212291-212315	3	0.88
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	514760-514784	3	0.88
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	606204-606233	4	0.867
NZ_CP023747_5	5.5\|1970834\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970834-1970865	32	LN997844	Streptomyces reticuli genome assembly TUE45, plasmid : III	32910-32941	4	0.875
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	MN693271	Marine virus AFVG_25M119, complete genome	3772-3798	4	0.852
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	416972-416998	4	0.852
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP015095	Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence	47085-47111	4	0.852
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1396101-1396127	4	0.852
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	28118-28144	4	0.852
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	317619-317645	4	0.852
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	NC_008269	Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence	249819-249843	4	0.84
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	NZ_CP021355	Rhodococcus sp. S2-17 plasmid pRB98, complete sequence	55072-55096	4	0.84
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	NC_017966	Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence	290082-290106	4	0.84
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	AY576796	Actinoplanes phage phiAsp2, complete genome	14139-14163	4	0.84
NZ_CP023747_10	10.2\|5361059\|25\|NZ_CP023747\|CRISPRCasFinder	5361059-5361083	25	AP014327	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S34-C97, * SEQUENCING IN PROGRESS *	2369-2393	4	0.84
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	MT114163	Mycobacterium phage Settecandela, complete genome	93210-93239	5	0.833
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	MK937592	Mycobacterium phage Phrappuccino, complete genome	93210-93239	5	0.833
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NC_017957	Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence	44387-44413	5	0.815
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP014127	Pantoea vagans strain FDAARGOS_160 plasmid unnamed2, complete sequence	37482-37508	5	0.815
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NC_013449	Streptomyces sp. W9 plasmid pCQ3, complete sequence	48728-48754	5	0.815
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	KF147891	Pseudomonas phage PaBG, complete genome	170670-170696	5	0.815
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP044989	Deinococcus sp. AJ005 plasmid p380k, complete sequence	157289-157315	5	0.815
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NC_011368	Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence	1180700-1180726	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP031166	Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence	477916-477942	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	MH067967	Arthrobacter sp. strain ANT_H19B plasmid pA19BH1, complete sequence	7322-7348	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP020371	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence	155639-155665	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP024895	Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence	74115-74141	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP030864	Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence	291552-291578	5	0.815
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NC_023549	Clavibacter phage CN1A, complete genome	33728-33754	5	0.815
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	NZ_CP051686	Duganella sp. GN2-R2 plasmid unnamed1, complete sequence	89719-89747	5	0.828
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	KY471269	Gordonia phage DinoDaryn, complete genome	21155-21183	5	0.828
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MT553344	Gordonia phage TZGordon, complete genome	21078-21106	5	0.828
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	KY471268	Gordonia phage Huffy, complete genome	21155-21183	5	0.828
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	JQ067093	Pseudomonas phage PaMx74, partial genome	51166-51194	5	0.828
NZ_CP023747_1	1.2\|130415\|30\|NZ_CP023747\|CRISPRCasFinder	130415-130444	30	NZ_HG938356	Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence	1615166-1615195	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_AP014705	Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence	881687-881716	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	KU160673	Arthrobacter phage Wilde, complete genome	5254-5283	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	KU160669	Arthrobacter phage Tank, complete genome	5326-5355	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP015419	Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence	63303-63332	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP015422	Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence	63203-63232	6	0.8
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP041043	Paracoccus sp. AK26 plasmid pAK3, complete sequence	128973-129002	6	0.8
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	MT711977	Streptomyces phage Dagobah, complete genome	23581-23612	6	0.812
NZ_CP023747_5	5.4\|1970773\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970773-1970804	32	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	154632-154663	6	0.812
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP029357	Azospirillum sp. CFH 70021 plasmid unnamed2	385070-385101	6	0.812
NZ_CP023747_5	5.15\|1971444\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971444-1971475	32	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	1390679-1390710	6	0.812
NZ_CP023747_5	5.15\|1971444\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971444-1971475	32	NZ_CP032054	Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence	58302-58333	6	0.812
NZ_CP023747_5	5.15\|1971444\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971444-1971475	32	NZ_CP016560	Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence	649665-649696	6	0.812
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP029835	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence	938-964	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	CP054927	Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence	115805-115831	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP039644	Azospirillum sp. TSA2s plasmid p2, complete sequence	279424-279450	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP046723	Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence	355542-355568	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP016890	Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence	276751-276777	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP034470	Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence	528044-528070	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP034149	Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence	327164-327190	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	MK494099	Mycobacterium phage Typha, complete genome	74866-74892	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1253641-1253667	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP034475	Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence	278707-278733	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP031650	Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence	167139-167165	6	0.778
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP032349	Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence	41570-41596	6	0.778
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_CP025013	Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence	458989-459018	6	0.8
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP029832	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence	585244-585270	6	0.778
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	MH001450	Mycobacterium phage Jeon, complete genome	16077-16103	6	0.778
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP054028	Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence	326421-326447	6	0.778
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP042915	Rhodococcus qingshengii strain RL1 plasmid unnamed2	230728-230754	6	0.778
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	116281-116309	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MH834599	Microbacterium phage Bernstein, complete genome	22756-22784	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MH834602	Microbacterium phage Brahms, complete genome	22703-22731	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MN183281	Microbacterium phage Vitas, complete genome	22696-22724	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MH834626	Microbacterium phage Rollins, complete genome	22756-22784	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MH834604	Microbacterium phage Coltrane, complete genome	22703-22731	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MH834596	Microbacterium phage Armstrong, complete genome	22701-22729	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	NZ_CP012383	Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence	20166-20194	6	0.793
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	JQ067089	Pseudomonas phage PaMx28, partial genome	47811-47839	6	0.793
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	2289846-2289875	7	0.767
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1597804-1597833	7	0.767
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	MT188704	Mesorhizobium phage Cp1R7A-A1, complete genome	97380-97409	7	0.767
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP049906	Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence	565615-565644	7	0.767
NZ_CP023747_1	1.2\|130415\|30\|NZ_CP023747\|CRISPRCasFinder	130415-130444	30	MK494105	Mycobacterium phage Pinnie, complete genome	29391-29420	7	0.767
NZ_CP023747_1	1.3\|130354\|36\|NZ_CP023747\|PILER-CR	130354-130389	36	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	606198-606233	7	0.806
NZ_CP023747_1	1.3\|130354\|36\|NZ_CP023747\|PILER-CR	130354-130389	36	NZ_CP023976	Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence	52048-52083	7	0.806
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_008826	Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence	254084-254113	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP042268	Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence	85290-85319	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	1213132-1213161	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	566237-566266	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	714498-714527	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_017958	Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence	997875-997904	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	127145-127174	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP019037	Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence	31063-31092	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP038238	Leisingera sp. NJS201 plasmid unnamed4, complete sequence	113303-113332	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_007641	Rhodospirillum rubrum ATCC 11170 plasmid unnamed, complete sequence	39357-39386	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP012477	Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence	571480-571509	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP010865	Marinovum algicola DG 898 plasmid pMaD10, complete sequence	30558-30587	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP016452	Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence	1788701-1788730	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	MN734437	Sphingomonas phage Eidolon, complete genome	11030-11059	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP035420	Leisingera sp. NJS204 plasmid unnamed3, complete sequence	78652-78681	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP035421	Leisingera sp. NJS204 plasmid unnamed4, complete sequence	580-609	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	842297-842326	7	0.767
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP010410	Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence	325436-325465	7	0.767
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NZ_CP032696	Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence	522569-522598	7	0.767
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP015881	Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence	1589268-1589299	7	0.781
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP048642	Streptomyces aureoverticillatus strain HN6 plasmid unnamed, complete sequence	84209-84240	7	0.781
NZ_CP023747_4	4.7\|1960522\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960522-1960553	32	NC_007336	Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence	211535-211566	7	0.781
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	133253-133284	7	0.781
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	NZ_CP043441	Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence	1155846-1155877	7	0.781
NZ_CP023747_5	5.2\|1970651\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970651-1970682	32	MN304824	Catenulispora phage 69_17, complete genome	28868-28899	7	0.781
NZ_CP023747_5	5.5\|1970834\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970834-1970865	32	NZ_CP020895	Legionella longbeachae strain F1157CHC plasmid pLLO-F1157CHC, complete sequence	69482-69513	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_LR594668	Variovorax sp. SRS16 plasmid 3	365811-365842	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP030074	Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence	243880-243911	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_012520	Rhodococcus opacus B4 plasmid pROB01, complete sequence	440556-440587	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_013856	Azospirillum sp. B510 plasmid pAB510b, complete sequence	664701-664732	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	440909-440940	7	0.781
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP016455	Sphingobium sp. RAC03 plasmid pBSY17_3, complete sequence	8931-8962	7	0.781
NZ_CP023747_5	5.11\|1971200\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971200-1971231	32	NC_023283	Streptomyces sp. FR1 plasmid pFRL3, complete sequence	313650-313681	7	0.781
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP054620	Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence	144741-144772	7	0.781
NZ_CP023747_5	5.13\|1971322\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971322-1971353	32	NZ_CP017077	Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence	777362-777393	7	0.781
NZ_CP023747_5	5.14\|1971383\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971383-1971414	32	NC_014811	Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence	201557-201588	7	0.781
NZ_CP023747_7	7.2\|2951960\|27\|NZ_CP023747\|CRISPRCasFinder	2951960-2951986	27	NZ_CP028489	Yersinia massiliensis strain GTA plasmid unnamed2, complete sequence	14683-14709	7	0.741
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_CP027299	Streptomyces sp. SGAir0924 plasmid unnamed_5	352095-352124	7	0.767
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_CP015867	Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence	4361-4390	7	0.767
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_LR134459	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence	81409-81438	7	0.767
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_CP041652	Streptomyces sp. RLB1-9 plasmid pRLB1-9.2, complete sequence	36135-36164	7	0.767
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	MK524530	Mycobacterium phage Pharaoh, complete genome	41175-41204	7	0.767
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	259554-259580	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1553517-1553543	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP023286	Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pCuR, complete sequence	159349-159375	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_LR134452	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence	339230-339256	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	628041-628067	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018859	Xanthomonas citri pv. citri strain LH201 plasmid pLH201.1, complete sequence	140285-140311	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018848	Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.1, complete sequence	189386-189412	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018855	Xanthomonas citri pv. citri strain LH276 plasmid pLH276.1, complete sequence	168220-168246	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP023068	Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence	699713-699739	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018729	Xanthomonas gardneri strain JS749-3 plasmid pJS749-3.1, complete sequence	168387-168413	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018851	Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.1, complete sequence	210541-210567	7	0.741
NZ_CP023747_7	7.4\|2952065\|27\|NZ_CP023747\|CRISPRCasFinder	2952065-2952091	27	NZ_CP018726	Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence	136626-136652	7	0.741
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	NC_015727	Cupriavidus necator N-1 plasmid pBB1, complete sequence	1218643-1218671	7	0.759
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	NZ_LR134465	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence	145988-146016	7	0.759
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP007129	Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence	714269-714298	8	0.733
NZ_CP023747_1	1.2\|130415\|30\|NZ_CP023747\|CRISPRCasFinder	130415-130444	30	NC_012527	Deinococcus deserti VCD115 plasmid 1, complete sequence	89878-89907	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP013744	Streptomyces sp. CdTB01 plasmid unnamed, complete sequence	117851-117880	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP007796	Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence	669173-669202	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP019603	Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence	706039-706068	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP032325	Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence	21921-21950	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	938054-938083	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_017385	Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence	63221-63250	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_014626	Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence	114433-114462	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP054618	Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence	179453-179482	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_022061	Mycobacterium phage KayaCho, complete genome	20345-20374	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	KJ433975	Mycobacterium phage 40BC, complete genome	20335-20364	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	KJ433973	Mycobacterium phage 39HC, complete genome	20335-20364	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NC_024145	Mycobacterium phage Hosp, complete genome	18531-18560	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP012910	Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence	181765-181794	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP054841	Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence	583190-583219	8	0.733
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	547704-547733	8	0.733
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NC_015184	Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence	274508-274537	8	0.733
NZ_CP023747_2	2.1\|130878\|30\|NZ_CP023747\|CRISPRCasFinder	130878-130907	30	NZ_CP006843	Corynebacterium glyciniphilum AJ 3170 plasmid pCgly1, complete sequence	46044-46073	8	0.733
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	228953-228984	8	0.75
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	AP014327	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S34-C97, * SEQUENCING IN PROGRESS *	16093-16124	8	0.75
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP016083	Streptomyces sp. SAT1 plasmid unnamed3, complete sequence	52501-52532	8	0.75
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	772034-772065	8	0.75
NZ_CP023747_4	4.3\|1960278\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960278-1960309	32	NZ_CP030772	Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence	153902-153933	8	0.75
NZ_CP023747_4	4.3\|1960278\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960278-1960309	32	NZ_CP046321	Gordonia bronchialis strain FDAARGOS_676 plasmid unnamed1, complete sequence	769-800	8	0.75
NZ_CP023747_4	4.3\|1960278\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960278-1960309	32	NC_013442	Gordonia bronchialis DSM 43247 plasmid pGBRO01, complete sequence	77932-77963	8	0.75
NZ_CP023747_4	4.3\|1960278\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960278-1960309	32	NZ_CP015530	Rhodococcus sp. WB1 plasmid pWB1, complete sequence	10587-10618	8	0.75
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	NC_041883	Gordonia phage Attis, complete genome	39639-39670	8	0.75
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	MK801734	Gordonia phage LordFarquaad, complete genome	39620-39651	8	0.75
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	NC_031251	Gordonia phage SoilAssassin, complete genome	39638-39669	8	0.75
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP049157	Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence	1727568-1727599	8	0.75
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP049317	Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence	1907480-1907511	8	0.75
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	NZ_CP024977	Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence	30884-30915	8	0.75
NZ_CP023747_5	5.1\|1970590\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970590-1970621	32	MN096362	Arthrobacter phage Vibaki, complete genome	9874-9905	8	0.75
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021653	Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence	1539879-1539910	8	0.75
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021408	Celeribacter manganoxidans strain DY25 plasmid pDY25-D, complete sequence	54089-54120	8	0.75
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP012688	Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence	1539877-1539908	8	0.75
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	CP047139	Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence	1447318-1447349	8	0.75
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	CP047137	Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence	1392581-1392612	8	0.75
NZ_CP023747_5	5.9\|1971078\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971078-1971109	32	MN694302	Marine virus AFVG_250M762, complete genome	1513-1544	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	MN871486	UNVERIFIED: Pseudomonas phage PaSz-9_45_61k, complete genome	12911-12942	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP035513	Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence	238748-238779	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP022991	Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence	87659-87690	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	1583036-1583067	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	1583162-1583193	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1079231-1079262	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	763675-763706	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	1582690-1582721	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	1582632-1582663	8	0.75
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1070240-1070271	8	0.75
NZ_CP023747_5	5.15\|1971444\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971444-1971475	32	NZ_LR134456	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence	124334-124365	8	0.75
NZ_CP023747_5	5.15\|1971444\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971444-1971475	32	NZ_CP045407	Roseovarius sp. THAF9 plasmid pTHAF9_c, complete sequence	15419-15450	8	0.75
NZ_CP023747_5	5.16\|1971505\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1971505-1971536	32	NZ_CP027239	Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence	64584-64615	8	0.75
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	1316762-1316791	8	0.733
NZ_CP023747_7	7.3\|2952011\|30\|NZ_CP023747\|CRISPRCasFinder	2952011-2952040	30	MN586040	Gordonia phage Stormageddon, complete genome	22502-22531	8	0.733
NZ_CP023747_9	9.1\|5208401\|29\|NZ_CP023747\|CRISPRCasFinder	5208401-5208429	29	MT664984	Xanthomonas phage Xp12, complete genome	55960-55988	8	0.724
NZ_CP023747_1	1.1\|130354\|30\|NZ_CP023747\|CRISPRCasFinder	130354-130383	30	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	805963-805992	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP053565	Pseudonocardia sp. Gen01 plasmid unnamed1, complete sequence	8404-8433	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP041197	Pseudarthrobacter sp. NIBRBAC000502770 plasmid pMK-1, complete sequence	13907-13936	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP007794	Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence	346244-346273	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP021368	Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence	20199-20228	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP021364	Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence	39281-39310	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP015733	Arthrobacter sp. U41 plasmid unnamed1, complete sequence	28235-28264	9	0.7
NZ_CP023747_1	1.9\|130659\|30\|NZ_CP023747\|CRISPRCasFinder	130659-130688	30	NZ_CP013739	Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence	125880-125909	9	0.7
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP054621	Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence	512367-512398	9	0.719
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP035514	Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence	86274-86305	9	0.719
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP040824	Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence	74001-74032	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	NZ_CP024426	Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence	134075-134106	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	NZ_CP020445	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence	73849-73880	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	NZ_CP014690	Gluconobacter albidus strain TMW2.1191 plasmid pGS1191_1, complete sequence	104531-104562	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	NZ_CP044079	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence	87730-87761	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	NZ_CP031079	Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence	333618-333649	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	KM879463	Arthrobacter phage vB_ArtM-ArV1, complete genome	22796-22827	9	0.719
NZ_CP023747_4	4.4\|1960339\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960339-1960370	32	MN234234	Arthrobacter phage Lymara, complete genome	24222-24253	9	0.719
NZ_CP023747_4	4.6\|1960461\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960461-1960492	32	NZ_CP022137	Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence	25350-25381	9	0.719
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP024423	Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence	270909-270940	9	0.719
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP020441	Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence	253952-253983	9	0.719
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP044080	Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence	211053-211084	9	0.719
NZ_CP023747_4	4.8\|1960583\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960583-1960614	32	NZ_CP031082	Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence	109529-109560	9	0.719
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	KX397373	Erwinia phage vB_EamM_Stratton, complete genome	232107-232138	9	0.719
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	JX316028	Erwinia phage phiEaH2, complete genome	154313-154344	9	0.719
NZ_CP023747_5	5.1\|1970590\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970590-1970621	32	KC117378	Halovirus HSTV-1, complete genome	25028-25059	9	0.719
NZ_CP023747_5	5.4\|1970773\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970773-1970804	32	LT599585	Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid	57749-57780	9	0.719
NZ_CP023747_5	5.6\|1970895\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1970895-1970926	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2245729-2245760	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	237217-237248	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022363	Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence	546020-546051	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	2147852-2147883	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1479452-1479483	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	866608-866639	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP032341	Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence	367663-367694	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	12173-12204	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP012916	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence	680945-680976	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	1457393-1457424	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP026091	Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence	925121-925152	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_014309	Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome	1601406-1601437	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	1512737-1512768	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	1379838-1379869	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP026093	Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence	925212-925243	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	1539846-1539877	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	191992-192023	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP012940	Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence	1263330-1263361	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP012944	Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence	579579-579610	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	1442052-1442083	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_016623	Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence	513149-513180	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	5549-5580	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP040819	Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence	585324-585355	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	1378860-1378891	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	1423419-1423450	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	1423410-1423441	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NC_017575	Ralstonia solanacearum Po82 megaplasmid, complete sequence	924979-925010	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	1379830-1379861	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	1379183-1379214	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	1379821-1379852	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP026308	Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence	924934-924965	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	1535804-1535835	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP051295	Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence	1251769-1251800	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	1457545-1457576	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	1457526-1457557	9	0.719
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	1457509-1457540	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP050082	Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence	520581-520612	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP053441	Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence	285756-285787	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP032703	Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence	56662-56693	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP054023	Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence	78819-78850	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP054033	Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence	232126-232157	9	0.719
NZ_CP023747_5	5.10\|1971139\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971139-1971170	32	NZ_CP053208	Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence	417571-417602	9	0.719
NZ_CP023747_5	5.11\|1971200\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971200-1971231	32	NZ_CP034813	Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence	62231-62262	9	0.719
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP024585	Roseomonas sp. FDAARGOS_362 plasmid unnamed, complete sequence	1461-1492	9	0.719
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP029833	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence	228736-228767	9	0.719
NZ_CP023747_5	5.14\|1971383\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971383-1971414	32	NZ_CP014597	Yangia sp. CCB-MM3 plasmid unnamed1, complete sequence	60073-60104	9	0.719
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP042809	Acetobacter oryzoeni strain B6 plasmid unnamed1, complete sequence	199202-199233	10	0.688
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP021511	Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-2, complete sequence	80078-80109	10	0.688
NZ_CP023747_4	4.1\|1960156\|32\|NZ_CP023747\|CRISPRCasFinder,CRT	1960156-1960187	32	NZ_CP021512	Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-3, complete sequence	6938-6969	10	0.688
NZ_CP023747_4	4.3\|1960278\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960278-1960309	32	NZ_CP038638	Cupriavidus oxalaticus strain X32 plasmid unnamed3, complete sequence	9475-9506	10	0.688
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	LR606152	Rhizobium sp. Q54 genome assembly, plasmid: 9	18675-18706	10	0.688
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	NZ_CP016905	Ralstonia solanacearum strain KACC 10709 plasmid unnamed1	2112789-2112820	10	0.688
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	NZ_CP048425	Rhizobium daejeonense strain KACC 13094 plasmid unnamed2, complete sequence	64574-64605	10	0.688
NZ_CP023747_4	4.5\|1960400\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960400-1960431	32	NZ_CP022791	Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence	1041645-1041676	10	0.688
NZ_CP023747_4	4.7\|1960522\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960522-1960553	32	NZ_CP022543	Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence	3170-3201	10	0.688
NZ_CP023747_4	4.7\|1960522\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960522-1960553	32	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	236360-236391	10	0.688
NZ_CP023747_4	4.7\|1960522\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960522-1960553	32	NZ_CP038637	Cupriavidus oxalaticus strain X32 plasmid unnamed2, complete sequence	91964-91995	10	0.688
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	NC_031107	Erwinia phage vB_EamM_Asesino, complete genome	234420-234451	10	0.688
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	KX397371	Erwinia phage vB_EamM_Parshik, complete genome	228783-228814	10	0.688
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	MT710307	Salmonella phage pSal-SNUABM-04, complete genome	227359-227390	10	0.688
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	KX397368	Erwinia phage vB_EamM_Huxley, complete genome	228496-228527	10	0.688
NZ_CP023747_4	4.10\|1960705\|32\|NZ_CP023747\|CRISPRCasFinder,CRT,PILER-CR	1960705-1960736	32	KX397370	Erwinia phage vB_EamM_Machina, complete genome	229389-229420	10	0.688
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021525	Acetobacter ascendens strain SRCM101447 plasmid pAP1447-1	9902-9933	10	0.688
NZ_CP023747_5	5.8\|1971017\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971017-1971048	32	NZ_CP021525	Acetobacter ascendens strain SRCM101447 plasmid pAP1447-1	155429-155460	10	0.688
NZ_CP023747_5	5.11\|1971200\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971200-1971231	32	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1008114-1008145	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP017076	Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence	294975-295006	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP032323	Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence	338026-338057	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP007795	Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence	749079-749110	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP032342	Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence	659379-659410	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP025552	Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence	250969-251000	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP033321	Azospirillum brasilense strain Cd plasmid p3, complete sequence	512094-512125	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP033315	Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence	568767-568798	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NZ_CP032347	Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence	718304-718335	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	KU160673	Arthrobacter phage Wilde, complete genome	31502-31533	10	0.688
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	KU160669	Arthrobacter phage Tank, complete genome	31660-31691	10	0.688
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022775	Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence	74859-74890	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NC_014310	Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence	72892-72923	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022762	Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence	102542-102573	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP021767	Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence	76019-76050	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP023017	Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence	74888-74919	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP014703	Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence	102542-102573	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022760	Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence	75458-75489	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022789	Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence	75458-75489	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022771	Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence	102552-102583	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022777	Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence	102571-102602	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022799	Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence	102542-102573	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP021765	Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence	110795-110826	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022764	Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence	74871-74902	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022797	Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence	74871-74902	11	0.656
NZ_CP023747_4	4.2\|1960217\|32\|NZ_CP023747\|CRISPRCasFinder,PILER-CR	1960217-1960248	32	NZ_CP022758	Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence	74869-74900	11	0.656
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	51601-51632	11	0.656
NZ_CP023747_5	5.12\|1971261\|32\|NZ_CP023747\|PILER-CR,CRISPRCasFinder,CRT	1971261-1971292	32	NC_003903	Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence	304392-304423	11	0.656

1. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_015314 (Pseudonocardia dioxanivorans CB1190 plasmid pPSED01, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
aaccccatgcccatgcccatgc	Protospacer
* ********************

2. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

3. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

4. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

5. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP039918 (Agrobacterium tumefaciens strain CFBP6626 plasmid pAtCFBP6626a, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

6. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

7. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

8. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

9. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

10. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

11. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

12. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

13. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

14. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

15. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

16. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

17. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

18. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

19. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

20. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

21. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to CP027480 (Pseudomonas koreensis strain P19E3 plasmid p3, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

22. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

23. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

24. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

25. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

26. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

27. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

28. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.955

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgc	Protospacer
** *******************

29. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 2, identity: 0.933

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
accgcagcggcatccacatccagcccgaca	Protospacer
* ********************* ******

30. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgctgcgccttgctcggtcctttcccc	Protospacer
*********************** *** **

31. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

32. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

33. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

34. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

35. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

36. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

37. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

38. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

39. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

40. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

41. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

42. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

43. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

44. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

45. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatgt	Protospacer
** ******************.

46. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP009293 (Novosphingobium pentaromativorans US6-1 plasmid pLA4, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
ctacccatgcccatgcccatgc	Protospacer
 * *******************

47. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
gtgcccatgcccatgcccatgc	Protospacer
.* *******************

48. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
atgcccatgcccatgcccatga	Protospacer
** ******************

49. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP009146 (Sinorhizobium meliloti strain RMO17 plasmid pSymB, complete sequence) position: , mismatch: 2, identity: 0.909

atccccatgcccatgcccatgc	CRISPR spacer
aggcccatgcccatgcccatgc	Protospacer
*  *******************

50. spacer 4.12|1960217|21|NZ_CP023747|CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 2, identity: 0.905

agctcctgcacgcggacgggc	CRISPR spacer
gcctcctgcacgcggacgggc	Protospacer
. *******************

51. spacer 4.12|1960217|21|NZ_CP023747|CRT matches to NZ_CP013054 (Sinorhizobium americanum CCGM7 plasmid C, complete sequence) position: , mismatch: 2, identity: 0.905

agctcctgcacgcggacgggc	CRISPR spacer
ggctcctgcacgcggacgggg	Protospacer
.*******************

52. spacer 8.4|3671288|23|NZ_CP023747|CRT matches to NZ_CP034153 (Rhodococcus sp. NJ-530 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.913

tcgaaaccacgctcaccgtcacg	CRISPR spacer
tcgaaatcacgctcaccgacacg	Protospacer
******.*********** ****

53. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to CP000662 (Rhodobacter sphaeroides ATCC 17025 plasmid pRSPA01, complete sequence) position: , mismatch: 2, identity: 0.92

cccggctgccgagacggccgaggct	CRISPR spacer
cccggcggccgagacggcggaggct	Protospacer
****** *********** ******

54. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to NZ_LN831789 (Streptomyces leeuwenhoekii strain type strain (C34 = DSM 42122 = NRRL B-24963) plasmid pSLE2) position: , mismatch: 3, identity: 0.9

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgctgcgccttgctcggccccttcgtc	Protospacer
********************.** ****.*

55. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018075 (Streptomyces venezuelae strain NRRL B-65442 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgctgcgccttgctcgggcccttcgtc	Protospacer
******************** ** ****.*

56. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.864

atccccatgcccatgcccatgc	CRISPR spacer
ccgcccatgcccatgcccatgc	Protospacer
 . *******************

57. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to MN693899 (Marine virus AFVG_250M76, complete genome) position: , mismatch: 3, identity: 0.864

atccccatgcccatgcccatgc	CRISPR spacer
tcccccatgcccatgcccatga	Protospacer
 .*******************

58. spacer 3.2|479213|22|NZ_CP023747|CRISPRCasFinder matches to MN694557 (Marine virus AFVG_250M634, complete genome) position: , mismatch: 3, identity: 0.864

atccccatgcccatgcccatgc	CRISPR spacer
taccccatgcccatgcccatga	Protospacer
  *******************

59. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_013449 (Streptomyces sp. W9 plasmid pCQ3, complete sequence) position: , mismatch: 3, identity: 0.906

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
cgttcatcgccgccgcccggcaggcgcaggaa	Protospacer
********.******************** *.

60. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_019307 (Streptomyces sp. W75 plasmid pCQ4, complete sequence) position: , mismatch: 3, identity: 0.906

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
cgttcatcgccgccgcccggcaggcgcaggaa	Protospacer
********.******************** *.

61. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024272 (Escherichia coli strain F8111-1SC3 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

62. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024274 (Escherichia coli strain F9792 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

63. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024227 (Escherichia coli O169:H41 strain 2014EL-1345-2 plasmid unnamed4, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

64. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024248 (Escherichia coli O27:H7 strain B4103-1 plasmid unnamed3, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

65. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to AP014654 (Escherichia coli O169:H41 plasmid pEntYN10 DNA, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

66. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024265 (Escherichia coli O169:H41 strain F6326-C1 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

67. spacer 10.1|5361005|25|NZ_CP023747|CRISPRCasFinder matches to LN908840 (Escherichia coli plasmid pCss_E1373) position: , mismatch: 3, identity: 0.88

tccggccactgaggctccggctgcc	CRISPR spacer
tccggcggctgaggctccggctgcg	Protospacer
****** .****************

68. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to NC_011887 (Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete sequence) position: , mismatch: 3, identity: 0.88

cccggctgccgagacggccgaggct	CRISPR spacer
tccggccgccgagacggccgaggca	Protospacer
.*****.*****************

69. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 3, identity: 0.88

cccggctgccgagacggccgaggct	CRISPR spacer
cccggctgccgaaccggccgaggtt	Protospacer
************. *********.*

70. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 4, identity: 0.867

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
actcctgcggcatccacatccaggccgaca	Protospacer
* . * ************************

71. spacer 5.5|1970834|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to LN997844 (Streptomyces reticuli genome assembly TUE45, plasmid : III) position: , mismatch: 4, identity: 0.875

taatcg--gagcagaacatgccctacatcaccgt	CRISPR spacer
--gtcggagagcagtacatgccctacatcaccgt	Protospacer
  .***  ****** *******************

72. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to MN693271 (Marine virus AFVG_25M119, complete genome) position: , mismatch: 4, identity: 0.852

gccaccaccggcggcaccacggactcg	CRISPR spacer
gccaccacctgcggcaccacggcattg	Protospacer
********* ************  *.*

73. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.852

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
cgcaccgggggcggcgggaccggtacg	Protospacer
* *************** ***** **

74. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP015095 (Pelagibaca abyssi strain JLT2014 plasmid pPABY4, complete sequence) position: , mismatch: 4, identity: 0.852

ctcaccgggggcggcggcaccggaacc----	CRISPR spacer
ctcaccgggggcggcggcac----acccctg	Protospacer
********************    ***

75. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 4, identity: 0.852

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
cgcaccgggggcggcgggaccggtacg	Protospacer
* *************** ***** **

76. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 4, identity: 0.852

ctcaccgggggcggcggcaccggaacc--	CRISPR spacer
gtcaccggggccggcggcaccg--accgg	Protospacer
 ********* ***********  ***

77. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 4, identity: 0.852

ctcaccgggggcggcggcaccggaacc--	CRISPR spacer
gtcaccggggccggcggcaccg--accgg	Protospacer
 ********* ***********  ***

78. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to NC_008269 (Rhodococcus jostii RHA1 plasmid pRHL1, complete sequence) position: , mismatch: 4, identity: 0.84

cccggctgccgagacggccgaggct	CRISPR spacer
ccgggctgccgagacggccggggag	Protospacer
** *****************.**

79. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to NZ_CP021355 (Rhodococcus sp. S2-17 plasmid pRB98, complete sequence) position: , mismatch: 4, identity: 0.84

cccggctgccgagacggccgaggct	CRISPR spacer
ccgggctgccgagacggccggggag	Protospacer
** *****************.**

80. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to NC_017966 (Tistrella mobilis KA081020-065 plasmid pTM2, complete sequence) position: , mismatch: 4, identity: 0.84

cccggctgccgagacggccgaggct	CRISPR spacer
gccggcggccgagacggcggaggcg	Protospacer
 ***** *********** *****

81. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to AY576796 (Actinoplanes phage phiAsp2, complete genome) position: , mismatch: 4, identity: 0.84

cccggctgccgagacggccgaggct	CRISPR spacer
cccggcggccgagaccgccgaggtg	Protospacer
****** ******** *******.

82. spacer 10.2|5361059|25|NZ_CP023747|CRISPRCasFinder matches to AP014327 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S34-C97, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.84

cccggctgccgagacggccgaggct	CRISPR spacer
gacggctgctgagacggctgaggct	Protospacer
  *******.********.******

83. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to MT114163 (Mycobacterium phage Settecandela, complete genome) position: , mismatch: 5, identity: 0.833

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
aaggccaagggcatcgcccggcgcctggcc	Protospacer
* ** *  ************ *********

84. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to MK937592 (Mycobacterium phage Phrappuccino, complete genome) position: , mismatch: 5, identity: 0.833

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
aaggccaagggcatcgcccggcgcctggcc	Protospacer
* ** *  ************ *********

85. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NC_017957 (Tistrella mobilis KA081020-065 plasmid pTM1, complete sequence) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccacggactcg	CRISPR spacer
gccaccaccggcggcacctcggcgtaa	Protospacer
****************** ***  * .

86. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP014127 (Pantoea vagans strain FDAARGOS_160 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccacggactcg	CRISPR spacer
gccaccaccggcggcgcaacggaaacc	Protospacer
***************.* *****  *

87. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NC_013449 (Streptomyces sp. W9 plasmid pCQ3, complete sequence) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccacggactcg	CRISPR spacer
gacaccaccggcgccaccacggaagct	Protospacer
* *********** *********  *

88. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to KF147891 (Pseudomonas phage PaBG, complete genome) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccacggactcg	CRISPR spacer
accaccaccggcggcaccatcgacgag	Protospacer
.******************. ***  *

89. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP044989 (Deinococcus sp. AJ005 plasmid p380k, complete sequence) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccac---ggactcg	CRISPR spacer
gccaccaccggcggcagcacgatgggc---	Protospacer
**************** ***   **.*

90. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NC_011368 (Rhizobium leguminosarum bv. trifolii WSM2304 plasmid pRLG201, complete sequence) position: , mismatch: 5, identity: 0.815

gccaccaccggcggcaccacggactcg	CRISPR spacer
gccaccaccggcggcacgacgtccttc	Protospacer
***************** ***  **.

91. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP031166 (Euzebya sp. DY32-46 plasmid pEDY32-46I, complete sequence) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ctcaccggcggcggcggcaccgacatg	Protospacer
******** *************. *.

92. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to MH067967 (Arthrobacter sp. strain ANT_H19B plasmid pA19BH1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
cgtgccgggggcggcggcaccggagac	Protospacer
* ..********************. *

93. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP020371 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs417, complete sequence) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
cgcaccgggggcggcggcagcggcggc	Protospacer
* ***************** *** . *

94. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP024895 (Amycolatopsis sp. AA4 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ctcaccgggctcggcggcaccggcaag	Protospacer
*********  ************ *

95. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP030864 (Streptomyces globosus strain LZH-48 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
cactccgggggcggcggcaccggccgc	Protospacer
* * *******************   *

96. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NC_023549 (Clavibacter phage CN1A, complete genome) position: , mismatch: 5, identity: 0.815

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ctcaccgggggtggtggcaccggttac	Protospacer
***********.**.********   *

97. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to NZ_CP051686 (Duganella sp. GN2-R2 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
agtcgtccgacggtgtcgagaagtccgaa	Protospacer
*  **********.*.************

98. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to KY471269 (Gordonia phage DinoDaryn, complete genome) position: , mismatch: 5, identity: 0.828

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
ccgcgtccgacagcgccgagacgtccgac	Protospacer
 *.********.********* ******.

99. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MT553344 (Gordonia phage TZGordon, complete genome) position: , mismatch: 5, identity: 0.828

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
ccgcgtccgacagcgccgagacgtccgac	Protospacer
 *.********.********* ******.

100. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to KY471268 (Gordonia phage Huffy, complete genome) position: , mismatch: 5, identity: 0.828

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
ccgcgtccgacagcgccgagacgtccgac	Protospacer
 *.********.********* ******.

101. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to JQ067093 (Pseudomonas phage PaMx74, partial genome) position: , mismatch: 5, identity: 0.828

acacgtc---cgacggcgccgagaagtccgat	CRISPR spacer
---cgttccgcgacggcgccgagaagtccgag	Protospacer
   ***.   *********************

102. spacer 1.2|130415|30|NZ_CP023747|CRISPRCasFinder matches to NZ_HG938356 (Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141 plasmid pHAMBI1141a, complete sequence) position: , mismatch: 6, identity: 0.8

gcac-gcaggcgactgccgcggccctttctg	CRISPR spacer
-cgcggcaggcgactgcggcggccctgtcgt	Protospacer
 *.* ************ ******** **

103. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_AP014705 (Methylobacterium aquaticum strain MA-22A plasmid pMaq22A_1p, complete sequence) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gagttcccgggcatcgcccgccgcctcgcc	Protospacer
. *  **.****************** ***

104. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to KU160673 (Arthrobacter phage Wilde, complete genome) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gaggagcgggacatcgcccgccgcctggcc	Protospacer
. **. * **.*******************

105. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to KU160669 (Arthrobacter phage Tank, complete genome) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gaggagcgggacatcgcccgccgcctggcc	Protospacer
. **. * **.*******************

106. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP015419 (Rhodovulum sulfidophilum DSM 1374 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctcgaccgcggcatcgaccgccgcctggcc	Protospacer
 * *.**  ******* *************

107. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP015422 (Rhodovulum sulfidophilum strain SNK001 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctcgaccgcggcatcgaccgccgcctggcc	Protospacer
 * *.**  ******* *************

108. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP041043 (Paracoccus sp. AK26 plasmid pAK3, complete sequence) position: , mismatch: 6, identity: 0.8

atgggcctgggcatcgcccgcc---gcctggcc	CRISPR spacer
ctggtcctgggcatcgcccgccagggcatg---	Protospacer
 *** *****************   ** **

109. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to MT711977 (Streptomyces phage Dagobah, complete genome) position: , mismatch: 6, identity: 0.812

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
cgcccccagccgacgagccagatctcgccctt	Protospacer
** ** ..****** *********** *****

110. spacer 5.4|1970773|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 6, identity: 0.812

---accgcgtgactgctcccgttcgggtgggcccg	CRISPR spacer
cgtgccgtg---ctgctcccgttcgggtgcgcccg	Protospacer
   .***.*   ***************** *****

111. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029357 (Azospirillum sp. CFH 70021 plasmid unnamed2) position: , mismatch: 6, identity: 0.812

cgttcatcaccgccgcccggcaggc--gcagcag	CRISPR spacer
cgttcaccaccgccgcccggcagccctccacc--	Protospacer
******.**************** *   ** *

112. spacer 5.15|1971444|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 6, identity: 0.812

atcactg--cgaggcacccgccgaggtcccggag	CRISPR spacer
--cactggccgaggtagccgccgaggtcccgggc	Protospacer
  *****  *****.* ***************.

113. spacer 5.15|1971444|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032054 (Streptomyces clavuligerus strain F1D-5 plasmid pSCL1, complete sequence) position: , mismatch: 6, identity: 0.812

atcactg--cgaggcacccgccgaggtcccggag	CRISPR spacer
--cactggccgaggtagccgccgaggtcccgggc	Protospacer
  *****  *****.* ***************.

114. spacer 5.15|1971444|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016560 (Streptomyces clavuligerus strain F613-1 plasmid pSCL4, complete sequence) position: , mismatch: 6, identity: 0.812

atcactg--cgaggcacccgccgaggtcccggag	CRISPR spacer
--cactggccgaggtagccgccgaggtcccgggc	Protospacer
  *****  *****.* ***************.

115. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP029835 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed5, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
agcaccaccggcggcaccacggtggcc	Protospacer
. ********************   *

116. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to CP054927 (Streptomyces fulvissimus strain NA06532 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
tccaccaccggcggcaccacgacactg	Protospacer
 ********************.  ..*

117. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP039644 (Azospirillum sp. TSA2s plasmid p2, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
agcaccaccggcggcaccacggtggca	Protospacer
. ********************   *.

118. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP046723 (Pantoea agglomerans strain ASB05 plasmid pASB05p1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

119. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP016890 (Pantoea agglomerans strain C410P1 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

120. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP034470 (Pantoea agglomerans strain CFSAN047153 plasmid pCFSAN047153_1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

121. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP034149 (Pantoea agglomerans strain L15 plasmid pPagL15_1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

122. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to MK494099 (Mycobacterium phage Typha, complete genome) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
cccaccaccgggggcaccacggtcaac	Protospacer
 ********** ********** *

123. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
aacaccaccgacggcaccacggagtac	Protospacer
. ********.************ *

124. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP034475 (Pantoea agglomerans strain CFSAN047154 plasmid pCFSAN047154_1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

125. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP031650 (Pantoea agglomerans strain TH81 plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gttgccaccagcggcaccacggacttt	Protospacer
*...*****.***************.

126. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP032349 (Azospirillum brasilense strain MTCC4039 plasmid p3, complete sequence) position: , mismatch: 6, identity: 0.778

gccaccaccggcggcaccacggactcg	CRISPR spacer
gccaccaccggcggcacgacgcagcgc	Protospacer
***************** *** * .

127. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP025013 (Rhizobium leguminosarum strain Norway plasmid pRLN1, complete sequence) position: , mismatch: 6, identity: 0.8

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
gaaaacggcaccggaggcaacacccggcag	Protospacer
. .********************* **  *

128. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP029832 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gtcaccggggtcggcggcaccggcgtg	Protospacer
 ********* ************ ..

129. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to MH001450 (Mycobacterium phage Jeon, complete genome) position: , mismatch: 6, identity: 0.778

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gtcaccgggggcggcgccaccggggtg	Protospacer
 *************** ******...

130. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP054028 (Rhizobium sp. JKLM19E plasmid pPR19E01, complete sequence) position: , mismatch: 6, identity: 0.778

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
tccggcccgggcggcggcaccggaacc	Protospacer
..*. *  *******************

131. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP042915 (Rhodococcus qingshengii strain RL1 plasmid unnamed2) position: , mismatch: 6, identity: 0.778

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gacaccgggggcggcggcatcggttgc	Protospacer
  *****************.***   *

132. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
cagagtccgccggcgccgagacgtccgat	Protospacer
  . ***** *********** *******

133. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MH834599 (Microbacterium phage Bernstein, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

134. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MH834602 (Microbacterium phage Brahms, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

135. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MN183281 (Microbacterium phage Vitas, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

136. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MH834626 (Microbacterium phage Rollins, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

137. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MH834604 (Microbacterium phage Coltrane, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

138. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MH834596 (Microbacterium phage Armstrong, complete genome) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gcgtggccgacggcgccgagaagcccgag	Protospacer
.*..* *****************.****

139. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012383 (Streptomyces ambofaciens ATCC 23877 plasmid pSAM1, complete sequence) position: , mismatch: 6, identity: 0.793

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
tcaccgacgacggcgccgagaagttcgac	Protospacer
 ***   *****************.***.

140. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to JQ067089 (Pseudomonas phage PaMx28, partial genome) position: , mismatch: 6, identity: 0.793

acacgtc-cgacggcgccgagaagtccgat	CRISPR spacer
-cgctccgcgacggcgccgagaagtcggag	Protospacer
 *.* .* ****************** **

141. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
atgcgagcggcatccacctccaggcccacc	Protospacer
*    ************ ******** **

142. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
cgagttgcggcatccgcatccacgccgacg	Protospacer
 * *. *********.****** ******.

143. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to MT188704 (Mesorhizobium phage Cp1R7A-A1, complete genome) position: , mismatch: 7, identity: 0.767

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
gtcgggtcggcatcgacatccgggccgaca	Protospacer
. ** . ******* ******.********

144. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP049906 (Diaphorobacter sp. HDW4B plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
agcgcggaggcatccacatccagccgcgcg	Protospacer
*****.* *************** *  .*.

145. spacer 1.2|130415|30|NZ_CP023747|CRISPRCasFinder matches to MK494105 (Mycobacterium phage Pinnie, complete genome) position: , mismatch: 7, identity: 0.767

gcacgcaggcgactgccgcggccctttctg	CRISPR spacer
cgacctcggcgacagccgcggcccgttctg	Protospacer
  ** . ****** ********** *****

146. spacer 1.3|130354|36|NZ_CP023747|PILER-CR matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 7, identity: 0.806

agcgcagcggcatccacatccaggccgacaccgtag	CRISPR spacer
actcctgcggcatccacatccaggccgacaccgcca	Protospacer
* . * ***************************. .

147. spacer 1.3|130354|36|NZ_CP023747|PILER-CR matches to NZ_CP023976 (Streptomyces alboflavus strain MDJK44 plasmid pMDJK44.1, complete sequence) position: , mismatch: 7, identity: 0.806

agcgcagcggcatccacatccaggccgacaccgtag	CRISPR spacer
accgcagcggcatccacatccagcccgacagcacca	Protospacer
* ********************* ****** *.. .

148. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_008826 (Methylibium petroleiphilum PM1 plasmid RPME01, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctcatgcagggcatcgcccgccgcctggct	Protospacer
 * .  * *********************.

149. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP042268 (Pseudomonas aeruginosa strain HOU1 plasmid pHOU1-1, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctgggcctggccatcgcccgccgcgccatc	Protospacer
 ********* ************* . ..*

150. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctgggcctcgccatcgcccgccgcgcggtg	Protospacer
 ******* * ************* .**.

151. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
accaccctggtcatcgcccaccgcctggcg	Protospacer
*. . ***** ********.*********

152. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gaccgccggggcatcgcccgccgcctcggc	Protospacer
.   *** ****************** * *

153. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_017958 (Tistrella mobilis KA081020-065 plasmid pTM3, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cagcgccggggcatcggccgccgcctgatc	Protospacer
  * *** ******** **********..*

154. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
accaccctggtcatcgcccaccgcctggcg	Protospacer
*. . ***** ********.*********

155. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP019037 (Massilia putida strain 6NM-7 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
catggcctgggcaccgtccgccgcctcggc	Protospacer
   **********.**.********* * *

156. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP038238 (Leisingera sp. NJS201 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

-atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
aaccagtcc-ggcatcgcccgccgcctgtcc	Protospacer
 *. .*.*. ****************** **

157. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_007641 (Rhodospirillum rubrum ATCC 11170 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cagggcctgggtatagcccgccgccggccg	Protospacer
  *********.** ********** * *

158. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012477 (Arthrobacter sp. ERGS1:01 isolate water plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
agccacatcggcattgcccgccgcctggcc	Protospacer
*   .* * *****.***************

159. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP010865 (Marinovum algicola DG 898 plasmid pMaD10, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gccggcctcggcatcgccggccgcctcggc	Protospacer
.. ***** ********* ******* * *

160. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP016452 (Sinorhizobium sp. RAC02 plasmid pBSY16_1, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cttgagcaaggcatcgcccgccgcgtggcc	Protospacer
 * *. * .*************** *****

161. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to MN734437 (Sphingomonas phage Eidolon, complete genome) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
atacttgtgggcatcgcccgccgcgtcgcc	Protospacer
**.  . ***************** * ***

162. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP035420 (Leisingera sp. NJS204 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ttcggcctgcgcatcgcccgccgcgcgggt	Protospacer
 * ****** ************** .** .

163. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP035421 (Leisingera sp. NJS204 plasmid unnamed4, complete sequence) position: , mismatch: 7, identity: 0.767

-atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
aaccagtcc-ggcatcgcccgccgcctgtcc	Protospacer
 *. .*.*. ****************** **

164. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
acccacctggccatcgcccgccacctggac	Protospacer
*.  .***** ***********.***** *

165. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP010410 (Xanthomonas sacchari strain R1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

atgggcctgggcatcgcccgccg--cctggcc	CRISPR spacer
ctcggcctgggcatcgccggccgcacccag--	Protospacer
 * *************** ****  **..*

166. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP032696 (Rhizobium jaguaris strain CCGE525 plasmid pRCCGE525b, complete sequence) position: , mismatch: 7, identity: 0.767

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgctgcgccttgctcgctgcggtgaag	Protospacer
******************* * ** * .

167. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP015881 (Ensifer adhaerens strain Casida A plasmid pCasidaAA, complete sequence) position: , mismatch: 7, identity: 0.781

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
ggttcggcgaccgcgcggatatcccggcagaa	Protospacer
  .*. ********** **** **********

168. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP048642 (Streptomyces aureoverticillatus strain HN6 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.781

agctcc---tgcacgcggacgggcgcccgcacctc	CRISPR spacer
---tccaggcgcacgcgggcggacgcccgcacccc	Protospacer
   ***   .********.***.**********.*

169. spacer 4.7|1960522|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NC_007336 (Cupriavidus pinatubonensis JMP134 megaplasmid, complete sequence) position: , mismatch: 7, identity: 0.781

tgcctcatcgaccgactctttgacgtcgaaga	CRISPR spacer
gctctcgcggaacgactctttgacgtcgaaga	Protospacer
  .***.. ** ********************

170. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
aggtcacggccgtccagccggatctccccctc	Protospacer
 **.*..***** ******.***********.

171. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP043441 (Cupriavidus campinensis strain MJ1 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
gggccggagccgaccagccagatcgtgacctt	Protospacer
 ***** .**************** .  ****

172. spacer 5.2|1970651|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to MN304824 (Catenulispora phage 69_17, complete genome) position: , mismatch: 7, identity: 0.781

gtcccggaggtggtcctgtcaccgtccgcgaa	CRISPR spacer
gtgaccacggtggtcctgccaccgcccgcgaa	Protospacer
**  * . **********.*****.*******

173. spacer 5.5|1970834|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020895 (Legionella longbeachae strain F1157CHC plasmid pLLO-F1157CHC, complete sequence) position: , mismatch: 7, identity: 0.781

taatcggagcagaacatgccctacatcaccgt	CRISPR spacer
taaatcgcgctgaacatgccctaaatcaccgc	Protospacer
*** . * ** ************ *******.

174. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR594668 (Variovorax sp. SRS16 plasmid 3) position: , mismatch: 7, identity: 0.781

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
cggaagtcaccgccgcccgccaggcgctgcac	Protospacer
**   .************* ******* ***

175. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP030074 (Streptomyces sp. ZFG47 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.781

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccctggacaccgccgcccggcaggcgcggcgg	Protospacer
* .* . ********************.**.*

176. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_012520 (Rhodococcus opacus B4 plasmid pROB01, complete sequence) position: , mismatch: 7, identity: 0.781

cgttcatcaccgccgcccggcaggcgcagcag-	CRISPR spacer
acgccatcgccgccgcccggcaggccca-cagc	Protospacer
   .****.**************** ** ***

177. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_013856 (Azospirillum sp. B510 plasmid pAB510b, complete sequence) position: , mismatch: 7, identity: 0.781

-cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgagcgt-gccgccgccgggcaggcgcatcag	Protospacer
 **  *.* .******** ********** ***

178. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 7, identity: 0.781

-cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcgcg-cgccgccgcccggctggcggagcag	Protospacer
 **. *. *.************ **** *****

179. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP016455 (Sphingobium sp. RAC03 plasmid pBSY17_3, complete sequence) position: , mismatch: 7, identity: 0.781

-cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
gcattt-tcaccgccgcgcgccaggcgcaggat	Protospacer
 *.**. ********** ** ********* *

180. spacer 5.11|1971200|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_023283 (Streptomyces sp. FR1 plasmid pFRL3, complete sequence) position: , mismatch: 7, identity: 0.781

tttctcgggtccgaagtcgtcgggcgtctcga	CRISPR spacer
cttctcgggtccgatctcgtcgggcgcactga	Protospacer
.*************  **********. ..**

181. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054620 (Azospirillum oryzae strain KACC 14407 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.781

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
gccacatcgccgccgcctccgccgacatgcgc	Protospacer
* *** ***** ************* * *. *

182. spacer 5.13|1971322|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017077 (Novosphingobium resinovorum strain SA1 plasmid pSA2, complete sequence) position: , mismatch: 7, identity: 0.781

ggagtaccgatacggtcagcgct-cgcacaggc	CRISPR spacer
tgaggaccgttacggtcagcgctccacgctgg-	Protospacer
 *** **** ************* *.*.* **

183. spacer 5.14|1971383|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_014811 (Mycolicibacterium gilvum Spyr1 plasmid pMSPYR101, complete sequence) position: , mismatch: 7, identity: 0.781

gtgtccgacgccgtgatcggggtgctgttcgg	CRISPR spacer
gtgctgggtgcggtgatcggggtgctgttggg	Protospacer
***.. *..** ***************** **

184. spacer 7.2|2951960|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP028489 (Yersinia massiliensis strain GTA plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.741

gccaccaccggcggcaccacggactcg	CRISPR spacer
cccaccaccggcggcatcacggctaat	Protospacer
 ***************.***** .

185. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP027299 (Streptomyces sp. SGAir0924 plasmid unnamed_5) position: , mismatch: 7, identity: 0.767

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
acggacggcaccggcggcaacaccaccgcc	Protospacer
***.********** *********.  .*

186. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP015867 (Streptomyces parvulus strain 2297 plasmid pSPA1, complete sequence) position: , mismatch: 7, identity: 0.767

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
gcggacggcaccggcggcaacaccaccacc	Protospacer
.**.********** *********.  **

187. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_LR134459 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 17, complete sequence) position: , mismatch: 7, identity: 0.767

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
atcatcggcaccggcggcaacaccggcaac	Protospacer
*. * ********* *********** *

188. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP041652 (Streptomyces sp. RLB1-9 plasmid pRLB1-9.2, complete sequence) position: , mismatch: 7, identity: 0.767

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
aagaacggcaacggaggcaactccgcgcat	Protospacer
* ******** ********** *** *

189. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to MK524530 (Mycobacterium phage Pharaoh, complete genome) position: , mismatch: 7, identity: 0.767

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
atcgacggcacccgaggcgacaccggggcc	Protospacer
*. .******** *****.********.*

190. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ggatacggcggcggcggcaccggaacg	Protospacer
     *** *****************

191. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ggatacggcggcggcggcaccggaacg	Protospacer
     *** *****************

192. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP023286 (Xanthomonas citri pv. citri strain 03-1638-1-1 plasmid pCuR, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

193. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_LR134452 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 10, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
ttcaccgagggcggcggcaccgtcgag	Protospacer
.******.**************  .

194. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gtcaccgggggcggcggcacgccgtcg	Protospacer
 *******************   . *

195. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018859 (Xanthomonas citri pv. citri strain LH201 plasmid pLH201.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

196. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018848 (Xanthomonas citri pv. citri strain LL074-4 plasmid pLL074-4.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

197. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018855 (Xanthomonas citri pv. citri strain LH276 plasmid pLH276.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

198. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP023068 (Ensifer sojae CCBAU 05684 plasmid pSJ05684b, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gaagaggagggcggcggcaccggaacc	Protospacer
   .  *.*******************

199. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018729 (Xanthomonas gardneri strain JS749-3 plasmid pJS749-3.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

200. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018851 (Xanthomonas citri pv. citri strain LJ207-7 plasmid pLJ207-7.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

201. spacer 7.4|2952065|27|NZ_CP023747|CRISPRCasFinder matches to NZ_CP018726 (Xanthomonas vesicatoria ATCC 35937 strain LMG911 plasmid pLMG911.1, complete sequence) position: , mismatch: 7, identity: 0.741

ctcaccgggggcggcggcaccggaacc	CRISPR spacer
gcggtggggggcggcggcaccggaccc	Protospacer
 . .. ****************** **

202. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to NC_015727 (Cupriavidus necator N-1 plasmid pBB1, complete sequence) position: , mismatch: 7, identity: 0.759

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
gttcgtccgacagcgccgagaagtcgaac	Protospacer
.. ********.************* .*.

203. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to NZ_LR134465 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 23, complete sequence) position: , mismatch: 7, identity: 0.759

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
agggcgcccacggcgccgagtagtccgat	Protospacer
* .   ** *********** ********

204. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP007129 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
tccgcggcggcatccagatccaggcgcagg	Protospacer
  ***.********** ********  * .

205. spacer 1.2|130415|30|NZ_CP023747|CRISPRCasFinder matches to NC_012527 (Deinococcus deserti VCD115 plasmid 1, complete sequence) position: , mismatch: 8, identity: 0.733

gcacgcaggcgactgccgcggccctttctg-----	CRISPR spacer
gcacgccggcgactggcgcggc-----caggggat	Protospacer
****** ******** ******     * *

206. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP013744 (Streptomyces sp. CdTB01 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ggctatcccggcatcgcccgccgcctggcc	Protospacer
.   ..*. *********************

207. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP007796 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p3, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cagggcctcggcatcgcccgccggcagcgg	Protospacer
  ****** ************** * *

208. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP019603 (Croceicoccus marinus strain E4A9 plasmid pCME4A9I, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ggaggccggggcattgcccgccgcctgcgg	Protospacer
. .**** ******.************

209. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP032325 (Azospirillum brasilense strain MTCC4035 plasmid p4, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cagggcctcggcatcgcccgccggcagcgg	Protospacer
  ****** ************** * *

210. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cgcggccagggcatcggccgccgcctgatg	Protospacer
   **** ******** **********..

211. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_017385 (Ketogulonicigenium vulgare WSH-001 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gcgcgcctcggcatcgcccgccgccgccgc	Protospacer
..* **** ****************    *

212. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_014626 (Ketogulonicigenium vulgare Y25 plasmid pYP12, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gcgcgcctcggcatcgcccgccgccgccgc	Protospacer
..* **** ****************    *

213. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP054618 (Azospirillum oryzae strain KACC 14407 plasmid unnamed4, complete sequence) position: , mismatch: 8, identity: 0.733

---atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cgcacg---ctcggcatcgcccgccgcctgaaa	Protospacer
   *.*   ** ******************.

214. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_022061 (Mycobacterium phage KayaCho, complete genome) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cccgccctggtcagcgcccgccgcctgggt	Protospacer
 . * ***** ** ************** .

215. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to KJ433975 (Mycobacterium phage 40BC, complete genome) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cccgccctggtcagcgcccgccgcctgggt	Protospacer
 . * ***** ** ************** .

216. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to KJ433973 (Mycobacterium phage 39HC, complete genome) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cccgccctggtcagcgcccgccgcctgggt	Protospacer
 . * ***** ** ************** .

217. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NC_024145 (Mycobacterium phage Hosp, complete genome) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
cccgccctggtcagcgcccgccgcctgggt	Protospacer
 . * ***** ** ************** .

218. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP012910 (Ketogulonicigenium vulgare strain Hbe602 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gcgcgcctcggcatcgcccgccgccgccgc	Protospacer
..* **** ****************    *

219. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP054841 (Acidovorax sp. 16-35-5 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gagtgcctgtgcatcgccggccgcctgcag	Protospacer
. * ***** ******** ********

220. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctggtccagggcatcgcccgccgcatcagg	Protospacer
 *** ** **************** * .

221. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to NC_015184 (Agrobacterium sp. H13-3 plasmid pAspH13-3a, complete sequence) position: , mismatch: 8, identity: 0.733

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcctgctgcgccttgctcgctgcggcgaag	Protospacer
******************* * ** . .

222. spacer 2.1|130878|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP006843 (Corynebacterium glyciniphilum AJ 3170 plasmid pCgly1, complete sequence) position: , mismatch: 8, identity: 0.733

gcctgctgcgccttgctcggtccgttcgcc	CRISPR spacer
gcgtgctgcgccttgctcggccctggtacg	Protospacer
** *****************.**   ..*

223. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 8, identity: 0.75

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
atcaagcctacagcgctgatcgcccggcagaa	Protospacer
 **    * ** ******** ***********

224. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to AP014327 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S34-C97, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 8, identity: 0.75

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
gtctacgcgaccgcgttgatagccgtcaagac	Protospacer
 *** **********.********    ***

225. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP016083 (Streptomyces sp. SAT1 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.75

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tgatcctggacgcggacggccgcccggtgccc	Protospacer
 * ***** ********** ******   *.*

226. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.75

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tggtcggcgacgcggaccggcgcccccacctc	Protospacer
 * **    ******** ******* ******

227. spacer 4.3|1960278|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP030772 (Streptomyces sp. YIM 121038 plasmid pSSP121038, complete sequence) position: , mismatch: 8, identity: 0.75

accgtgcgggcgggcgctcatgccgccacctg	CRISPR spacer
acccgcgtggccgccgctcatgccgccacctt	Protospacer
***     *** * *****************

228. spacer 4.3|1960278|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP046321 (Gordonia bronchialis strain FDAARGOS_676 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

accgtgcg---ggcgggcgctcatgccgccacctg	CRISPR spacer
---gtacatgcggcgtgggctcatgccgccacctc	Protospacer
   **.*.   **** * ****************

229. spacer 4.3|1960278|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NC_013442 (Gordonia bronchialis DSM 43247 plasmid pGBRO01, complete sequence) position: , mismatch: 8, identity: 0.75

accgtgcg---ggcgggcgctcatgccgccacctg	CRISPR spacer
---gtacatgcggcgtgggctcatgccgccacctc	Protospacer
   **.*.   **** * ****************

230. spacer 4.3|1960278|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP015530 (Rhodococcus sp. WB1 plasmid pWB1, complete sequence) position: , mismatch: 8, identity: 0.75

accgtgcgggcgggcgctcatgcc-gccacctg	CRISPR spacer
tacgtgcgggcggaggctcatgccggccgaat-	Protospacer
  ***********. ********* ***.  *

231. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NC_041883 (Gordonia phage Attis, complete genome) position: , mismatch: 8, identity: 0.75

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
ttcatcgctgccgcacccgcgctcgtccaggg	Protospacer
*.. ******** ********* ****.. **

232. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to MK801734 (Gordonia phage LordFarquaad, complete genome) position: , mismatch: 8, identity: 0.75

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
ttcatcgctgccgcacccgcgctcgtccaggg	Protospacer
*.. ******** ********* ****.. **

233. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NC_031251 (Gordonia phage SoilAssassin, complete genome) position: , mismatch: 8, identity: 0.75

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
ttcatcgctgccgcacccgcgctcgtccaggg	Protospacer
*.. ******** ********* ****.. **

234. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049157 (Caballeronia sp. SBC1 plasmid pSBC1_1, complete sequence) position: , mismatch: 8, identity: 0.75

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
gtcagtgaggacttgctgccgcggctgtacaa	Protospacer
*   **  *** ********* *********

235. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP049317 (Caballeronia sp. SBC2 plasmid pSBC2-1, complete sequence) position: , mismatch: 8, identity: 0.75

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
gtcagtgaggacttgctgccgcggctgtacaa	Protospacer
*   **  *** ********* *********

236. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024977 (Escherichia coli strain CV839-15 plasmid pCV839-15-p3, complete sequence) position: , mismatch: 8, identity: 0.75

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
gttccgtggccgaccagcgtgatctccagctg	Protospacer
   ***************  *******  **

237. spacer 5.1|1970590|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to MN096362 (Arthrobacter phage Vibaki, complete genome) position: , mismatch: 8, identity: 0.75

tcttcgacgtgaaagagtccgtcgacgacgct	CRISPR spacer
actggatcgtgaacgagttcgtcgacgacgat	Protospacer
 **  . ****** ****.*********** *

238. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021653 (Ralstonia solanacearum strain RS 488 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccggaccgccgcgcgccaggcgcagcag	Protospacer
*  .*   ******** ** ************

239. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021408 (Celeribacter manganoxidans strain DY25 plasmid pDY25-D, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgaaaacgccgccgcccggcagacccagcag	Protospacer
*    * *.**************.* ******

240. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012688 (Ralstonia solanacearum strain UY031 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccggaccgccgcgcgccaggcgcagcag	Protospacer
*  .*   ******** ** ************

241. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to CP047139 (Ralstonia solanacearum strain CFBP 8695 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccggaccgccgcgcgccaggcgcagcag	Protospacer
*  .*   ******** ** ************

242. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to CP047137 (Ralstonia solanacearum strain CFBP 8697 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccggaccgccgcgcgccaggcgcagcag	Protospacer
*  .*   ******** ** ************

243. spacer 5.9|1971078|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to MN694302 (Marine virus AFVG_250M762, complete genome) position: , mismatch: 8, identity: 0.75

acgtcgccaccaccgtagacggccccggcccg	CRISPR spacer
cagccaacaccacggtagacggccccggccta	Protospacer
  *.*. ****** ****************..

244. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to MN871486 (UNVERIFIED: Pseudomonas phage PaSz-9_45_61k, complete genome) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccggcttcgcccccacctccgccgggaggacc	Protospacer
   .**********.*********.**** .*

245. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP035513 (Haematobacter massiliensis strain OT1 plasmid pOT1-3, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
gatcgcgcgccacctcctccgccgagaggttg	Protospacer
**.  . **** ** ****************

246. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022991 (Paraburkholderia aromaticivorans strain BN5 plasmid pBN1, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
gccctgtcgcccccgactgcgccgagaggagc	Protospacer
* * . ********* ** **********  *

247. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

248. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

249. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

250. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

251. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

252. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

253. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 8, identity: 0.75

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
ccctatccgccgccgcctccgccgacaggtcc	Protospacer
  *  *.**** ************* ****.*

254. spacer 5.15|1971444|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_LR134456 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 14, complete sequence) position: , mismatch: 8, identity: 0.75

--atcactgcgaggcacccgccgaggtcccggag	CRISPR spacer
ccgtgac--cgaggctcccgccgaggccccggcc	Protospacer
  .* **  ****** **********.*****

255. spacer 5.15|1971444|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP045407 (Roseovarius sp. THAF9 plasmid pTHAF9_c, complete sequence) position: , mismatch: 8, identity: 0.75

atcac-tgcgaggcacccgccgaggtcccggag	CRISPR spacer
-tggcgcgcgcgccacccgccgaggtcccgacg	Protospacer
 * .* .*** * *****************. *

256. spacer 5.16|1971505|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP027239 (Dietzia sp. oral taxon 368 strain W5195 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.75

tccacgtcagtctccagtcgttgggggctggt	CRISPR spacer
tcatggctggtctcctgtcgttcggggctggt	Protospacer
**   *...****** ****** *********

257. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 8, identity: 0.733

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
gggggcggcactggaggcgacaccgggatc	Protospacer
. *..******.******.*********.

258. spacer 7.3|2952011|30|NZ_CP023747|CRISPRCasFinder matches to MN586040 (Gordonia phage Stormageddon, complete genome) position: , mismatch: 8, identity: 0.733

acgaacggcaccggaggcaacaccgggacg	CRISPR spacer
ctgcggggcaccggacgcaacaccggtacc	Protospacer
 .* . ********* ********** **

259. spacer 9.1|5208401|29|NZ_CP023747|CRISPRCasFinder matches to MT664984 (Xanthomonas phage Xp12, complete genome) position: , mismatch: 8, identity: 0.724

acacgtccgacggcgccgagaagtccgat	CRISPR spacer
ccttccgcgacggcgccgagaagtcggag	Protospacer
 * . . ****************** **

260. spacer 1.1|130354|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

agcgcagcggcatccacatccaggccgaca	CRISPR spacer
gaaccatcggcatccacttccaggccgcgc	Protospacer
..  ** ********** *********

261. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP053565 (Pseudonocardia sp. Gen01 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
caccacctgggcatcgcccgcggcctgcgg	Protospacer
    .**************** *****

262. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP041197 (Pseudarthrobacter sp. NIBRBAC000502770 plasmid pMK-1, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
taccacctggccatcgcccgccgccaggat	Protospacer
    .***** ************** ** .

263. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP007794 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p1, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ctcactgtggccatcgcccgccgcctggtt	Protospacer
 * . . *** *****************..

264. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP021368 (Acidovorax carolinensis strain P4 plasmid pACP4.2, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gtgggccagggcatcgcccaccgcgccagt	Protospacer
.****** ***********.**** . . .

265. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP021364 (Acidovorax carolinensis strain P3 plasmid pACP3.2, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
gtgggccagggcatcgcccaccgcgccagt	Protospacer
.****** ***********.**** . . .

266. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP015733 (Arthrobacter sp. U41 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
tatcacctggtcatcgcccgccgccgggat	Protospacer
    .***** ************** ** .

267. spacer 1.9|130659|30|NZ_CP023747|CRISPRCasFinder matches to NZ_CP013739 (Streptomyces globisporus C-1027 plasmid SGLP1, complete sequence) position: , mismatch: 9, identity: 0.7

atgggcctgggcatcgcccgccgcctggcc	CRISPR spacer
ggcgagtacggcatcgcccgccgcatggcc	Protospacer
.  *. .  *************** *****

268. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP054621 (Azospirillum oryzae strain KACC 14407 plasmid unnamed6, complete sequence) position: , mismatch: 9, identity: 0.719

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
ctggaactgaacgcgctgatggcccggcagac	Protospacer
**     .** *********.**********

269. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP035514 (Haematobacter massiliensis strain OT1 plasmid pOT1-4, complete sequence) position: , mismatch: 9, identity: 0.719

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
cagttctggacgcggccgggcgcccgcacggg	Protospacer
 . *.*** ****** *************

270. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP040824 (Paraoceanicella profunda strain D4M1 plasmid pD4M1F, complete sequence) position: , mismatch: 9, identity: 0.719

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
actgcctgcacgcggccgggcgcgcgcgctct	Protospacer
* . *********** ******* ***.*...

271. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024426 (Paracoccus yeei strain TT13 plasmid pTT13-4, complete sequence) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
ccctggcccatgcgggcgacgacgaaggggcc	Protospacer
*****  *****************.   .*..

272. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020445 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed5, complete sequence) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
ccctggcccatgcgggcgacgacgaaggggcc	Protospacer
*****  *****************.   .*..

273. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014690 (Gluconobacter albidus strain TMW2.1191 plasmid pGS1191_1, complete sequence) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
ccctgtgccatgagcgcgacgacgtcatgtcc	Protospacer
************ * ********* * .. ..

274. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044079 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
ccctggcccatgcgggcgacgacgaaggggcc	Protospacer
*****  *****************.   .*..

275. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031079 (Paracoccus yeei strain CCUG 32053 plasmid pYEE1, complete sequence) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
ccctggcccatgcgggcgacgacgaaggggcc	Protospacer
*****  *****************.   .*..

276. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to KM879463 (Arthrobacter phage vB_ArtM-ArV1, complete genome) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
caagttgccacgagggcgacgacggcccacag	Protospacer
*    *****.* ****************

277. spacer 4.4|1960339|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to MN234234 (Arthrobacter phage Lymara, complete genome) position: , mismatch: 9, identity: 0.719

ccctgtgccatgcgggcgacgacggcccagtt	CRISPR spacer
caagttgccacgagggcgacgacggcccacag	Protospacer
*    *****.* ****************

278. spacer 4.6|1960461|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022137 (Salmonella enterica subsp. diarizonae serovar 65:c:z str. SA20044251 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

ccgcccgggaactacggcaggtgatgacggac	CRISPR spacer
ccgcccgggaactacgggacgtggccgctggt	Protospacer
***************** * ***.. .* *..

279. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024423 (Paracoccus yeei strain TT13 plasmid pTT13-1, complete sequence) position: , mismatch: 9, identity: 0.719

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
cgcgatccggggttgctgccggcgctgtccga	Protospacer
 *  .*****.*********** ***** *.

280. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP020441 (Paracoccus yeei strain FDAARGOS_252 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
cgcgatccggggttgctgccggcgctgtccga	Protospacer
 *  .*****.*********** ***** *.

281. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP044080 (Paracoccus yeei strain FDAARGOS_643 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
cgtgatccggggttgctgccggcgctgtccga	Protospacer
 *  .*****.*********** ***** *.

282. spacer 4.8|1960583|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP031082 (Paracoccus yeei strain CCUG 32053 plasmid pYEE4, complete sequence) position: , mismatch: 9, identity: 0.719

gggcgtccggagttgctgccggggctgtacac	CRISPR spacer
cgtgatccggggttgctgccggcgctgtccga	Protospacer
 *  .*****.*********** ***** *.

283. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to KX397373 (Erwinia phage vB_EamM_Stratton, complete genome) position: , mismatch: 9, identity: 0.719

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
acggcgtgggcgaccagccagttctccatagt	Protospacer
  * ***** *********** ***** .  *

284. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to JX316028 (Erwinia phage phiEaH2, complete genome) position: , mismatch: 9, identity: 0.719

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
acggcgtgggcgaccagccagttctccatagt	Protospacer
  * ***** *********** ***** .  *

285. spacer 5.1|1970590|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to KC117378 (Halovirus HSTV-1, complete genome) position: , mismatch: 9, identity: 0.719

tcttcgacgtgaaagagtccgtcgacgacgct	CRISPR spacer
ccgaggacgcgaaagagtccgccgacgaggag	Protospacer
.*   ****.***********.****** *

286. spacer 5.4|1970773|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to LT599585 (Pseudomonas veronii 1YdBTEX2 genome assembly, plasmid: PVE_plasmid) position: , mismatch: 9, identity: 0.719

accgcgtgactgctcccgttcgggtgggcccg	CRISPR spacer
aagggccgactgttgccgttcgggtgggccaa	Protospacer
*  *  .*****.* *************** .

287. spacer 5.6|1970895|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 9, identity: 0.719

caggcccccaggttgctgcgggtgatgcgcaa	CRISPR spacer
acgtccgcctggttgctgcgggtgatgtcgac	Protospacer
  * ** ** *****************.  *

288. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acctgatcgccgccgcccggcaggcccagggc	Protospacer
  .* ***.**************** *** .

289. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022363 (Azospirillum sp. TSH58 plasmid TSH58_p03, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acctgatcgccgccgcccggcaggcccagggc	Protospacer
  .* ***.**************** *** .

290. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ggcgcatcaacgccgcccggcacgcgcattgc	Protospacer
 *. ***** ************ ***** ..

291. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ggcgcatcaacgccgcccggcacgcgcattgc	Protospacer
 *. ***** ************ ***** ..

292. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acatgatcgccgccgcccggcaggcccagggc	Protospacer
   * ***.**************** *** .

293. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032341 (Azospirillum brasilense strain MTCC4038 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acatgatcgccgccgcccggcaggcccagggc	Protospacer
   * ***.**************** *** .

294. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acctgatcgccgccgcccggcaggcccagggc	Protospacer
  .* ***.**************** *** .

295. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012916 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
acatgatcgccgccgcccggcaggcccagggc	Protospacer
   * ***.**************** *** .

296. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

297. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026091 (Ralstonia solanacearum strain IBSBF 2570 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

298. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_014309 (Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

299. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

300. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

301. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026093 (Ralstonia solanacearum strain SFC plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

302. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

303. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccggcatcgccgccgcccggcgggcgcgtccc	Protospacer
*   ****.************.*****. *

304. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012940 (Ralstonia solanacearum strain UW163 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

305. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP012944 (Ralstonia solanacearum strain IBSBF1503 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

306. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

307. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_016623 (Azospirillum lipoferum 4B plasmid AZO_p3, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
aaggcgaccccgccgcccggcagggccagcag	Protospacer
 .  *. * ***************  ******

308. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
gatccgccaccggcgcccggccggcgcagccc	Protospacer
 .*.*..***** ******** ********

309. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP040819 (Paraoceanicella profunda strain D4M1 plasmid pD4M1A, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
gatccgccaccggcgcccggccggcgcagccc	Protospacer
 .*.*..***** ******** ********

310. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

311. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

312. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

313. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_017575 (Ralstonia solanacearum Po82 megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

314. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

315. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

316. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

317. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP026308 (Ralstonia solanacearum strain IBSBF 2571 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

318. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

319. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP051295 (Ralstonia solanacearum strain CIAT_078 plasmid megaplasmid, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

320. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

321. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

322. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
ccgcccgggccgccgcgcgccaggcgcagcag	Protospacer
*  .*   .******* ** ************

323. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP050082 (Rhizobium leguminosarum bv. trifolii strain 31B plasmid pRL31b4, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
tcgatgtccgatccggcaaaggcagccgagcg	Protospacer
 *. * .  **.* ******************

324. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053441 (Rhizobium leguminosarum bv. trifolii strain CC275e plasmid pRltCC275eE, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
tccatgtccgatccggcaaaggcagccgagcg	Protospacer
 *  * .  **.* ******************

325. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032703 (Pantoea dispersa strain DSM 32899 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
gatgttattgaccaggcagcggcagccgagcg	Protospacer
*   *.   *********. ************

326. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054023 (Rhizobium sp. JKLM12A2 plasmid pPR12A202, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
tcgatgtccgatccggcaaaggcagccgagcg	Protospacer
 *. * .  **.* ******************

327. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP054033 (Rhizobium sp. JKLM13E plasmid pPR13E02, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
tcgatgtccgatccggcaaaggcagccgagcg	Protospacer
 *. * .  **.* ******************

328. spacer 5.10|1971139|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP053208 (Rhizobium leguminosarum bv. trifolii TA1 plasmid pRltTA1B, complete sequence) position: , mismatch: 9, identity: 0.719

gcactccgagaccaggcaaaggcagccgagcg	CRISPR spacer
tccatgtccgatccggcaaaggcagccgagcg	Protospacer
 *  * .  **.* ******************

329. spacer 5.11|1971200|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP034813 (Paracoccus sp. Arc7-R13 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.719

tttctcgggtccgaagtcgtcgggcgtctcga	CRISPR spacer
ggtctcggggccgatgtcgtcgggcttggaaa	Protospacer
  ******* **** ********** *   .*

330. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP024585 (Roseomonas sp. FDAARGOS_362 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.719

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
gggttcacgcccccgccttcgccgcgaggtgc	Protospacer
*.  .. ***********.***** ***** *

331. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP029833 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.719

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
tcgccttcgccgccgcctccgccgtgatgctg	Protospacer
    ******* ************ ** *.*

332. spacer 5.14|1971383|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP014597 (Yangia sp. CCB-MM3 plasmid unnamed1, complete sequence) position: , mismatch: 9, identity: 0.719

gtgtccgacgccgtgatcggggtgctgttcgg	CRISPR spacer
agcgccggcgccgtgatcgggctgctgtcggc	Protospacer
.   ***.************* ******. *

333. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP042809 (Acetobacter oryzoeni strain B6 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
tcgcccagaactgcgctgatagcccgtcagaa	Protospacer
.. ..*. .**.************** *****

334. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP021511 (Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-2, complete sequence) position: , mismatch: 10, identity: 0.688

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
tcgcccagaactgcgctgatagcccgtcagaa	Protospacer
.. ..*. .**.************** *****

335. spacer 4.1|1960156|32|NZ_CP023747|CRISPRCasFinder,CRT matches to NZ_CP021512 (Acetobacter pasteurianus subsp. pasteurianus strain SRCM101342 plasmid pAP1342-3, complete sequence) position: , mismatch: 10, identity: 0.688

ctcttcgcgaccgcgctgatagcccggcagaa	CRISPR spacer
tcgcccagaactgcgctgatagcccgtcagaa	Protospacer
.. ..*. .**.************** *****

336. spacer 4.3|1960278|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP038638 (Cupriavidus oxalaticus strain X32 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.688

accgtgcgggcgggcgctcatgccgccacctg	CRISPR spacer
ggattcgcggcgggcgctcatgctgcgacctc	Protospacer
.   *   ***************.** ****

337. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to LR606152 (Rhizobium sp. Q54 genome assembly, plasmid: 9) position: , mismatch: 10, identity: 0.688

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
gcactcgctgcctcacccgccagcgtcgtcaa	Protospacer
 * .****************  *****  ...

338. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP016905 (Ralstonia solanacearum strain KACC 10709 plasmid unnamed1) position: , mismatch: 10, identity: 0.688

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
gcgcgtgcggcgtcacccgcgcgcgtctggtt	Protospacer
 * . .** ** *****************

339. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP048425 (Rhizobium daejeonense strain KACC 13094 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
gcactcgctgcctcacccgccagcgtcgtcaa	Protospacer
 * .****************  *****  ...

340. spacer 4.5|1960400|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022791 (Ralstonia solanacearum strain SL3103 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

tctttcgctgcctcacccgcgcgcgtctgtgg	CRISPR spacer
gcgcgtgcggcgtcacccgcgcgcgtctggtt	Protospacer
 * . .** ** *****************

341. spacer 4.7|1960522|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP022543 (Antarctobacter heliothermus strain SMS3 plasmid pSMS3-3, complete sequence) position: , mismatch: 10, identity: 0.688

tgcctcatcgaccgactctttgacgtcgaaga	CRISPR spacer
ccgctcttcgaccgactctgtgacgtgatcgg	Protospacer
.  *** ************ ****** .  *.

342. spacer 4.7|1960522|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 10, identity: 0.688

tgcctcatcgaccgactctttgacgtcgaaga	CRISPR spacer
gctcgggcggaacgcctctttgacgtcgaaga	Protospacer
  .*  .. ** ** *****************

343. spacer 4.7|1960522|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP038637 (Cupriavidus oxalaticus strain X32 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.688

tgcctcatcgaccgactctttgacgtcgaaga	CRISPR spacer
gctcgggcggaacgacgctttgacgtcgaaga	Protospacer
  .*  .. ** **** ***************

344. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to NC_031107 (Erwinia phage vB_EamM_Asesino, complete genome) position: , mismatch: 10, identity: 0.688

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
accgcgtgggcgaccagccagttctccatagt	Protospacer
    ***** *********** ***** .  *

345. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to KX397371 (Erwinia phage vB_EamM_Parshik, complete genome) position: , mismatch: 10, identity: 0.688

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
accgcgtgggcgaccagccagttctccataat	Protospacer
    ***** *********** ***** .  *

346. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to MT710307 (Salmonella phage pSal-SNUABM-04, complete genome) position: , mismatch: 10, identity: 0.688

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
accgcgtgggcgaccagccagttctccataat	Protospacer
    ***** *********** ***** .  *

347. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to KX397368 (Erwinia phage vB_EamM_Huxley, complete genome) position: , mismatch: 10, identity: 0.688

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
accgcgtgggcgaccagccagttctccataat	Protospacer
    ***** *********** ***** .  *

348. spacer 4.10|1960705|32|NZ_CP023747|CRISPRCasFinder,CRT,PILER-CR matches to KX397370 (Erwinia phage vB_EamM_Machina, complete genome) position: , mismatch: 10, identity: 0.688

cggccgtggccgaccagccagatctccccctt	CRISPR spacer
accgcgtgggcgaccagccagttctccataat	Protospacer
    ***** *********** ***** .  *

349. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021525 (Acetobacter ascendens strain SRCM101447 plasmid pAP1447-1) position: , mismatch: 10, identity: 0.688

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
gcaccggcaccgcaggccggcaggcgcagcct	Protospacer
   .*. ****** * **************

350. spacer 5.8|1971017|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021525 (Acetobacter ascendens strain SRCM101447 plasmid pAP1447-1) position: , mismatch: 10, identity: 0.688

cgttcatcaccgccgcccggcaggcgcagcag	CRISPR spacer
gcaccggcaccgcaggccggcaggcgcagcct	Protospacer
   .*. ****** * **************

351. spacer 5.11|1971200|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 10, identity: 0.688

tttctcgggtccgaagtcgtcgggcgtctcga	CRISPR spacer
cgcgtcgggtccgacgacgtcgggcgtcaacg	Protospacer
. . ********** * ***********   .

352. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP017076 (Novosphingobium resinovorum strain SA1 plasmid pSA1, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
tcgacttcgcccccgacttcgccgagccgcgt	Protospacer
   ************ **.*******  *. .

353. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032323 (Azospirillum brasilense strain MTCC4035 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagaccggc	Protospacer
 .  ******** *** **********    *

354. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007795 (Azospirillum brasilense strain Az39 plasmid AbAZ39_p2, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagactggc	Protospacer
 .  ******** *** **********    *

355. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032342 (Azospirillum brasilense strain MTCC4038 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagaccggc	Protospacer
 .  ******** *** **********    *

356. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP025552 (Streptomyces rimosus strain WT5260 plasmid unnamed, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
tatgtgccgcccccgcctccgacgacaggtgg	Protospacer
 *... .************** *** ****

357. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033321 (Azospirillum brasilense strain Cd plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagaccggc	Protospacer
 .  ******** *** **********    *

358. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP033315 (Azospirillum brasilense strain Sp 7 plasmid p3, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagaccggc	Protospacer
 .  ******** *** **********    *

359. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP032347 (Azospirillum brasilense strain MTCC4039 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
cgatcttcgcccgcgcatccgccgagaccggc	Protospacer
 .  ******** *** **********    *

360. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to KU160673 (Arthrobacter phage Wilde, complete genome) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
agaacttcgccccctcctacgccgagtccccc	Protospacer
.. *********** *** *******   ..*

361. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to KU160669 (Arthrobacter phage Tank, complete genome) position: , mismatch: 10, identity: 0.688

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
agaacttcgccccctcctacgccgagtccccc	Protospacer
.. *********** *** *******   ..*

362. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022775 (Ralstonia solanacearum strain T12 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

363. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NC_014310 (Ralstonia solanacearum PSI07 plasmid mpPSI07, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

364. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022762 (Ralstonia solanacearum strain T95 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

365. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP021767 (Ralstonia solanacearum strain RS 489 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tcgccctgcaggcggacgggcgcacgctgtgg	Protospacer
   .****** ************ ***  .

366. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP023017 (Ralstonia solanacearum strain SL3022 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

367. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP014703 (Ralstonia solanacearum strain KACC 10722 plasmid, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

368. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022760 (Ralstonia solanacearum strain T98 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

369. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022789 (Ralstonia solanacearum strain SL3175 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

370. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022771 (Ralstonia solanacearum strain T51 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

371. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022777 (Ralstonia solanacearum strain T11 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

372. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022799 (Ralstonia solanacearum strain SL2064 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

373. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP021765 (Ralstonia pseudosolanacearum strain CRMRs218 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tcgccctgcaggcggacgggcgcacgctgtgg	Protospacer
   .****** ************ ***  .

374. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022764 (Ralstonia solanacearum strain T82 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

375. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022797 (Ralstonia solanacearum strain SL2312 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

376. spacer 4.2|1960217|32|NZ_CP023747|CRISPRCasFinder,PILER-CR matches to NZ_CP022758 (Ralstonia solanacearum strain T101 plasmid unnamed, complete sequence) position: , mismatch: 11, identity: 0.656

agctcctgcacgcggacgggcgcccgcacctc	CRISPR spacer
tttccctgcaggcggacgggcgcacgctgtgg	Protospacer
  ..****** ************ ***  .

377. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 11, identity: 0.656

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
accactccgcccccgccaccgccgacgaacag	Protospacer
. ****.********** ******* ....

378. spacer 5.12|1971261|32|NZ_CP023747|PILER-CR,CRISPRCasFinder,CRT matches to NC_003903 (Streptomyces coelicolor A3(2) plasmid SCP1, complete sequence) position: , mismatch: 11, identity: 0.656

gacacttcgcccccgcctccgccgagaggttc	CRISPR spacer
accactccgcccccgccaccgccgacgaacag	Protospacer
. ****.********** ******* ....

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

57257 : 94111

Streptomyces_phage(33.33%)

transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150478098.1\|57257_58634_-\|transposase	IS1380 family transposase	A0A222ZN33	Mycobacterium_phage	5.3e-127	57.0
WP_150478099.1\|59755_60067_-	hypothetical protein	NA	NA	NA	NA
WP_150478100.1\|60169_60643_-	VOC family protein	NA	NA	NA	NA
WP_150478101.1\|61123_61873_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_150478102.1\|61952_62828_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_150478103.1\|63061_63475_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_150478104.1\|64341_65585_-\|transposase	IS3 family transposase	H6WZH1	Escherichia_phage	2.1e-69	49.8
WP_150478105.1\|65616_65853_-\|transposase	transposase	A0A0N9SHJ4	Paenibacillus_phage	7.7e-10	43.5
WP_170307419.1\|65851_67192_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_170307420.1\|67476_67869_+	MFS transporter	NA	NA	NA	NA
WP_170307415.1\|67922_68063_-	hypothetical protein	NA	NA	NA	NA
WP_150478108.1\|68542_69550_-	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_150478109.1\|69658_70231_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_150478110.1\|70394_70541_+	hypothetical protein	NA	NA	NA	NA
WP_150478111.1\|70668_71262_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_150478112.1\|71302_72214_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_043447764.1\|74131_74431_-	hypothetical protein	NA	NA	NA	NA
WP_043436619.1\|74632_76228_+\|transposase	ISL3 family transposase	NA	NA	NA	NA
WP_052453878.1\|76250_76742_-	SUKH-3 domain-containing protein	NA	NA	NA	NA
WP_043436622.1\|76869_78357_-	UvrD-helicase domain-containing protein	M4M8Y5	Vibrio_phage	9.4e-45	29.6
WP_079161929.1\|78353_78836_-	hypothetical protein	NA	NA	NA	NA
WP_043436624.1\|78832_79693_-	hypothetical protein	NA	NA	NA	NA
WP_043436626.1\|79862_80126_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_150478113.1\|81534_82188_+	hypothetical protein	NA	NA	NA	NA
WP_161240369.1\|83182_83869_-	hypothetical protein	NA	NA	NA	NA
WP_158508298.1\|85110_85272_+	hypothetical protein	NA	NA	NA	NA
WP_144401397.1\|85545_86391_+	hypothetical protein	NA	NA	NA	NA
WP_052453880.1\|86671_87439_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_043447757.1\|87550_88486_-	helix-turn-helix domain-containing protein	A0A1J0MCL6	Streptomyces_phage	2.8e-26	30.0
WP_043436635.1\|88570_88807_-	DUF397 domain-containing protein	A0A1J0MC88	Streptomyces_phage	3.9e-06	45.6
WP_150478114.1\|88925_89480_+\|transposase	transposase	NA	NA	NA	NA
WP_079161931.1\|91060_91396_+	hypothetical protein	NA	NA	NA	NA
WP_052453881.1\|92102_92489_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043447749.1\|92593_93289_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_150478115.1\|93340_94111_-\|transposase	transposase family protein	NA	NA	NA	NA

DBSCAN-SWA_2

207858 : 259674

Staphylococcus_phage(50.0%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170307421.1\|207858_208341_-\|transposase	transposase	NA	NA	NA	NA
WP_170307422.1\|208326_208575_+\|transposase	transposase	NA	NA	NA	NA
WP_043436785.1\|209812_210196_-	peptidase inhibitor family I36 protein	NA	NA	NA	NA
WP_079162473.1\|210406_211528_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_144401406.1\|211866_212316_+	ATP-binding protein	NA	NA	NA	NA
WP_144401407.1\|212222_212804_+	type I restriction enzyme HsdR N-terminal domain-containing protein	NA	NA	NA	NA
WP_144401408.1\|212840_213023_+	hypothetical protein	NA	NA	NA	NA
WP_043436786.1\|213089_213623_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_043436788.1\|214187_214478_-	hypothetical protein	NA	NA	NA	NA
WP_052453902.1\|215070_215874_-	hypothetical protein	NA	NA	NA	NA
WP_107070329.1\|215870_216866_-	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_043436789.1\|216862_217084_-	hypothetical protein	NA	NA	NA	NA
WP_079161940.1\|219083_220472_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_052453904.1\|220942_222046_-	hypothetical protein	NA	NA	NA	NA
WP_144401409.1\|222807_223989_+	insulinase family protein	NA	NA	NA	NA
WP_144401410.1\|223985_224801_+	hypothetical protein	NA	NA	NA	NA
WP_043447862.1\|224797_225751_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-21	30.0
WP_043436799.1\|225747_226521_+	ABC transporter permease	NA	NA	NA	NA
WP_158508304.1\|226517_227306_+	ABC transporter permease	NA	NA	NA	NA
WP_043436802.1\|227769_228150_+	hypothetical protein	NA	NA	NA	NA
WP_158508305.1\|229590_229755_+	hypothetical protein	NA	NA	NA	NA
WP_079161943.1\|229781_230954_-\|protease	cysteine protease StiP family protein	A0A172Q0S8	Acinetobacter_phage	5.3e-35	30.5
WP_150478120.1\|231029_232085_-	FomB family phosphonate monophosphate kinase	NA	NA	NA	NA
WP_043436805.1\|232359_233310_-	hypothetical protein	NA	NA	NA	NA
WP_144401413.1\|233331_233592_+	hypothetical protein	NA	NA	NA	NA
WP_043436806.1\|234575_235115_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_043436809.1\|235862_236462_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_043436814.1\|237246_237678_-	hypothetical protein	NA	NA	NA	NA
WP_043436815.1\|237910_238342_+	hypothetical protein	NA	NA	NA	NA
WP_043436816.1\|238413_239046_+	SigE family RNA polymerase sigma factor	NA	NA	NA	NA
WP_052453907.1\|239042_239408_+	hypothetical protein	NA	NA	NA	NA
WP_043436819.1\|239543_240431_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_079161945.1\|240656_241232_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_043436823.1\|241177_241717_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_150478121.1\|242119_243004_-	hypothetical protein	NA	NA	NA	NA
WP_144401414.1\|243434_243824_-	hypothetical protein	NA	NA	NA	NA
WP_043436826.1\|244039_244576_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_043447877.1\|245041_245404_+	hypothetical protein	NA	NA	NA	NA
WP_052453908.1\|247392_247983_+	hypothetical protein	NA	NA	NA	NA
WP_043436831.1\|247983_248433_-	hypothetical protein	NA	NA	NA	NA
WP_079162474.1\|250067_250415_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_043447881.1\|250781_251396_+	DUF4240 domain-containing protein	NA	NA	NA	NA
WP_144401415.1\|251557_251815_-	hypothetical protein	NA	NA	NA	NA
WP_158508306.1\|251866_253312_-\|transposase	ISL3 family transposase	A9YX10	Burkholderia_phage	2.0e-07	29.1
WP_043436836.1\|253502_254180_-	response regulator transcription factor	NA	NA	NA	NA
WP_052453909.1\|254176_255460_-	two-component sensor histidine kinase	NA	NA	NA	NA
WP_043436843.1\|255568_256426_-	ABC transporter permease	NA	NA	NA	NA
WP_043436846.1\|256422_257382_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.9e-28	35.8
WP_043436849.1\|258451_258832_+	hypothetical protein	NA	NA	NA	NA
WP_162484966.1\|258892_259674_-\|transposase	IS5 family transposase	NA	NA	NA	NA

DBSCAN-SWA_3

7235456 : 7267632

Agrobacterium_phage(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_170307438.1\|7235456_7236344_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_043446870.1\|7236499_7236892_+	VOC family protein	NA	NA	NA	NA
WP_043446873.1\|7236966_7238037_+	adenosine deaminase	NA	NA	NA	NA
WP_043446876.1\|7238018_7238534_-	DinB family protein	NA	NA	NA	NA
WP_043446879.1\|7238613_7239513_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_043446881.1\|7239621_7240611_+	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_043446884.1\|7241140_7243639_+\|protease	ATP-dependent Clp protease ATP-binding subunit	K4FB40	Cronobacter_phage	1.7e-131	39.4
WP_043446887.1\|7243732_7244122_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_043446889.1\|7244549_7244960_+	hypothetical protein	NA	NA	NA	NA
WP_043446891.1\|7245046_7245487_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_043446892.1\|7245644_7246247_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	3.4e-38	44.0
WP_043446894.1\|7246248_7246887_-\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	2.0e-36	46.0
WP_043446896.1\|7247141_7247624_+	VOC family protein	NA	NA	NA	NA
WP_043446897.1\|7247848_7249378_+	glycoside hydrolase family 43 protein	NA	NA	NA	NA
WP_079162595.1\|7249613_7250876_+	S1 family peptidase	NA	NA	NA	NA
WP_079162428.1\|7251174_7253673_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_043446900.1\|7253804_7255814_+	TetM/TetW/TetO/TetS family tetracycline resistance ribosomal protection protein	E4ZFJ7	Streptococcus_phage	1.9e-109	37.4
WP_043446901.1\|7255978_7256245_+	hypothetical protein	NA	NA	NA	NA
WP_043446902.1\|7256496_7259484_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_043446903.1\|7259689_7260991_-	erythromycin esterase family protein	NA	NA	NA	NA
WP_052454423.1\|7261076_7261769_-	CatB-related O-acetyltransferase	M1HS53	Paramecium_bursaria_Chlorella_virus	2.6e-13	32.7
WP_043446904.1\|7261815_7263453_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.5e-35	25.7
WP_043446905.1\|7263588_7264236_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_052454656.1\|7264439_7265267_+	recombinase family protein	NA	NA	NA	NA
WP_052454424.1\|7265841_7267632_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP023747

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection