CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044164	Campylobacter coli strain AR-0417 chromosome, complete genome	1 crisprs	csa3,cas1,cas2,cas14j	0	22	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044164_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044164_1

890380-891277

Unclear

Consensus_repeat	Method
TCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTA	PILER-CR
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	CRISPRCasFinder
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CRT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	PILER-CR

13 spacers

cas2,cas1

The CRISPR arrays of NZ_CP044164_1

>merge|NZ_CP044164|1|890380-891277|PILER-CR,CRISPRCasFinder,CRT,PILER-CR
TCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTAGTTTTGAAGTAAGCACAGCTTCTTTGCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTAATGATTTTAATTTTCATTTGTATCCTTTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTCCATTGTAGAAACAGGTGTTTTTATAGGATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACCTAAGGATAGTCATAGCGGTTTGAATTCTAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACCTTGTGCTATGTACTGAACCTGCACCCATAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTATCTAGTAAGGTAAAATACTGTTCGCCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTCTATAATATTTTTTAACTCGTAAAAATCAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTTAAGTTCTGCCATTTTTTTCTCCTTTATATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTATTATAAAAACATTATTTTCTAAAGGCTCATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTCATTTGTTGCTAATAATATTAACTTTTCATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACCTATTTATGTGGTGCAAGTCAAGTTGAAACATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTACTCATCTTTCAAATCAAATGCTTTATTAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTAGCGAAAACAATTTAAATAAAGCAAAATTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAAA

>NZ_CP044164|1|1|890380-890552|PILER-CR
TCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTA	GTTTTGAAGTAAGCACAGCTTCTTT
GCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTA	ATGATTTTAATTTTCATTTGTATCC
TTTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTCCATTGTAGAAACAGGTGTTTTTATAGGATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACCTAAGGATAGTCATAGCGGTTTGAATTCTAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTTGTGCTATGTACTGAACCTGCACCCATA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTATCTAGTAAGGTAAAATACTGTTCGCCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TCTATAATATTTTTTAACTCGTAAAAATCA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTTAAGTTCTGCCATTTTTTTCTCCTTTAT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TATTATAAAAACATTATTTTCTAAAGGCTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTCATTTGTTGCTAATAATATTAACTTTTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTATTTATGTGGTGCAAGTCAAGTTGAAAC


>NZ_CP044164|1|1|890383-891277|CRISPRCasFinder
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	AGTTTTGAAGTAAGCACAGCTTCTTTGCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	AATGATTTTAATTTTCATTTGTATCCTTT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	TCCATTGTAGAAACAGGTGTTTTTATAGG
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACC	TAAGGATAGTCATAGCGGTTTGAATTCTA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACC	TTGTGCTATGTACTGAACCTGCACCCATA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	TATCTAGTAAGGTAAAATACTGTTCGCCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	CTATAATATTTTTTAACTCGTAAAAATCA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	TTAAGTTCTGCCATTTTTTTCTCCTTTAT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	ATTATAAAAACATTATTTTCTAAAGGCTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	TCATTTGTTGCTAATAATATTAACTTTTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACC	TATTTATGTGGTGCAAGTCAAGTTGAAAC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	ACTCATCTTTCAAATCAAATGCTTTATTA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACT	AGCGAAAACAATTTAAATAAAGCAAAATT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAAA

>NZ_CP044164|1|1|890383-891276|CRT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TAGTTTTGAAGTAAGCACAGCTTCTTTGCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TAATGATTTTAATTTTCATTTGTATCCTTT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTCCATTGTAGAAACAGGTGTTTTTATAGG
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTAAGGATAGTCATAGCGGTTTGAATTCTA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTTGTGCTATGTACTGAACCTGCACCCATA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTATCTAGTAAGGTAAAATACTGTTCGCCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TCTATAATATTTTTTAACTCGTAAAAATCA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTTAAGTTCTGCCATTTTTTTCTCCTTTAT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TATTATAAAAACATTATTTTCTAAAGGCTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTCATTTGTTGCTAATAATATTAACTTTTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTATTTATGTGGTGCAAGTCAAGTTGAAAC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TACTCATCTTTCAAATCAAATGCTTTATTA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TAGCGAAAACAATTTAAATAAAGCAAAATT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAA

>NZ_CP044164|1|2|890647-891144|PILER-CR
	GTTTTGAAGTAAGCACAGCTTCTTT
GCTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTA	ATGATTTTAATTTTCATTTGTATCC
TTTATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACTTCCATTGTAGAAACAGGTGTTTTTATAGGATTTTACCATAAAGAAATTTAAAAAGGGACTAAAACCTAAGGATAGTCATAGCGGTTTGAATTCTAATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTTGTGCTATGTACTGAACCTGCACCCATA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTATCTAGTAAGGTAAAATACTGTTCGCCT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TCTATAATATTTTTTAACTCGTAAAAATCA
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTTAAGTTCTGCCATTTTTTTCTCCTTTAT
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TATTATAAAAACATTATTTTCTAAAGGCTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	TTCATTTGTTGCTAATAATATTAACTTTTC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC	CTATTTATGTGGTGCAAGTCAAGTTGAAAC
ATTTTACCATAAAGAAATTTAAAAAGGGACTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044164.1\|WP_002822573.1\|900714_901647_+\|formate-dehydrogenase-subunit-gamma	unknown	unknown	gnl\|CDD\|130645
NZ_CP044164.1\|WP_002779495.1\|883368_884346_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|340821
NZ_CP044164.1\|WP_002829610.1\|882319_883309_+\|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl\|CDD\|235439
NZ_CP044164.1\|WP_002858889.1\|892587_893034_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl\|CDD\|223391
NZ_CP044164.1\|WP_002807151.1\|888924_889815_+\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|274694
NZ_CP044164.1\|WP_151014788.1\|893257_894799_-\|multicopper-oxidase-CueO	unknown	unknown	gnl\|CDD\|225043
NZ_CP044164.1\|WP_002797817.1\|889807_890239_+\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NZ_CP044164.1\|WP_002816879.1\|897860_900074_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239153
NZ_CP044164.1\|WP_002784096.1\|897269_897812_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239153
NZ_CP044164.1\|WP_002829612.1\|881653_882259_-\|dephospho-CoA-kinase	unknown	unknown	gnl\|CDD\|234620
NZ_CP044164.1\|WP_002779484.1\|897078_897270_+\|twin-arginine-translocation-signal-domain-containing-protein	unknown	unknown	gnl\|CDD\|236534
NZ_CP044164.1\|WP_002779485.1\|896402_897104_+\|molecular-chaperone-TorD-family-protein	unknown	unknown	gnl\|CDD\|376858
NZ_CP044164.1\|WP_002822792.1\|879157_880195_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NZ_CP044164.1\|WP_002795329.1\|880907_881657_-\|diaminopimelate-epimerase	unknown	unknown	gnl\|CDD\|234768
NZ_CP044164.1\|WP_002790284.1\|893034_893256_-\|MoaD/ThiS-family-protein	unknown	unknown	gnl\|CDD\|340452
NZ_CP044164.1\|WP_002829615.1\|878459_878846_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|238382
NZ_CP044164.1\|WP_002867221.1\|891393_892584_-\|molybdopterin-molybdotransferase-MoeA	unknown	unknown	gnl\|CDD\|223380
NZ_CP044164.1\|WP_002790275.1\|880201_880933_-\|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase	unknown	unknown	gnl\|CDD\|225539
NZ_CP044164.1\|WP_151014790.1\|894922_896071_+\|carboxynorspermidine-decarboxylase	unknown	unknown	gnl\|CDD\|273414
NZ_CP044164.1\|WP_002790273.1\|877786_878236_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|223854

Protein	Function_ID	Function_description	E-value
NZ_CP044164.1\|WP_002822573.1\|900714_901647_+\|formate-dehydrogenase-subunit-gamma	gnl\|CDD\|130645	TIGR01583, Formate_dehydrogenase_cytochrome_b556_subunit, formate dehydrogenase, gamma subunit. This model represents the gamma chain of the gamma proteobacteria (and Aquifex aolicus) formate dehydrogenase. This subunit is integral to the cytoplasmic membrane, consisting of 4 transmembrane helices, and receives electrons from the beta subunit. The entire E. coli formate dehydrogenase N (nitrate-inducible form) has been crystallized. The gamma subunit contains two cytochromes, heme b(P) and heme b(C) near the periplasmic and cytoplasmic sides of the membrane respectively. The electron acceptor quinone binds at the cytoplasmic heme histidine ligand. NiFe-hydrogenase and thiosulfate reductase contain homologous gamma subunits, and these can be found scoring in the noise of this model. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport].	8.90177e-86
NZ_CP044164.1\|WP_002779495.1\|883368_884346_+\|hypothetical-protein	gnl\|CDD\|340821	cd03789, GT9_LPS_heptosyltransferase, lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.05794e-09
NZ_CP044164.1\|WP_002829610.1\|882319_883309_+\|phosphoribosylformylglycinamidine-cyclo-ligase	gnl\|CDD\|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP044164.1\|WP_002858889.1\|892587_893034_-\|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl\|CDD\|223391	COG0314, MoaE, Molybdopterin converting factor, large subunit [Coenzyme metabolism].	5.09823e-44
NZ_CP044164.1\|WP_002807151.1\|888924_889815_+\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	1.22802e-121
NZ_CP044164.1\|WP_151014788.1\|893257_894799_-\|multicopper-oxidase-CueO	gnl\|CDD\|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	5.52376e-120
NZ_CP044164.1\|WP_002797817.1\|889807_890239_+\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	4.92184e-59
NZ_CP044164.1\|WP_002816879.1\|897860_900074_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239153	cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. Members of the MopB_Formate-Dh-Na-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	4.07894e-157
NZ_CP044164.1\|WP_002784096.1\|897269_897812_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239153	cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. Members of the MopB_Formate-Dh-Na-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	3.35702e-61
NZ_CP044164.1\|WP_002829612.1\|881653_882259_-\|dephospho-CoA-kinase	gnl\|CDD\|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	6.84669e-70
NZ_CP044164.1\|WP_002779484.1\|897078_897270_+\|twin-arginine-translocation-signal-domain-containing-protein	gnl\|CDD\|236534	PRK09476, napG, quinol dehydrogenase periplasmic component; Provisional.	0.00343104
NZ_CP044164.1\|WP_002779485.1\|896402_897104_+\|molecular-chaperone-TorD-family-protein	gnl\|CDD\|376858	pfam02613, Nitrate_red_del, Nitrate reductase delta subunit. This family is the delta subunit of the nitrate reductase enzyme, The delta subunit is not part of the nitrate reductase enzyme but is most likely needed for assembly of the multi-subunit enzyme complex. In the absence of the delta subunit the core alpha beta enzyme complex is unstable. The delta subunit is essential for enzyme activity in vivo and in vitro. The nitrate reductase enzyme, EC:1.7.99.4 catalyze the conversion of nitrite to nitrate via the reduction of an acceptor. The nitrate reductase enzyme is composed of three subunits. Nitrate is the most widely used alternative electron acceptor after oxygen. This family also now contains the family TorD, a family of cytoplasmic chaperone proteins; like many prokaryotic molybdoenzymes, the TMAO reductase (TorA) of Escherichia coli requires the insertion of a bis(molybdopterin guanine dinucleotide) molybdenum (bis(MGD)Mo) cofactor in its catalytic site to be active and translocated to the periplasm. The TorD chaperone increases apoTorA activation up to four-fold, allowing maturation of most of the apoprotein. Therefore TorD is involved in the first step of TorA maturation to make it competent to receive the cofactor.	3.61703e-05
NZ_CP044164.1\|WP_002822792.1\|879157_880195_+\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.78191e-26
NZ_CP044164.1\|WP_002795329.1\|880907_881657_-\|diaminopimelate-epimerase	gnl\|CDD\|234768	PRK00450, dapF, diaminopimelate epimerase; Provisional.	1.81739e-90
NZ_CP044164.1\|WP_002790284.1\|893034_893256_-\|MoaD/ThiS-family-protein	gnl\|CDD\|340452	cd00754, Ubl_MoaD, ubiquitin-like (Ubl) domain found in molybdenum cofactor biosynthesis protein D (MoaD) and similar proteins. MoaD, also termed molybdopterin synthase sulfur carrier subunit, or MPT synthase subunit 1, or MPT synthase small subunit, or molybdopterin-converting factor small subunit, or molybdopterin-converting factor subunit 1, is a conserved small sulfur carrier protein that has beta-grasp ubiquitin-like (Ubl) fold involved in biosynthesis of the molybdenum cofactor (Moco), an essential cofactor of a diverse group of redox enzymes. MoaD is activated in an ATP-dependent manner by sulfurtransferases similar to the activation mechanism of ubiquitin-activating enzyme E1.	1.31013e-11
NZ_CP044164.1\|WP_002829615.1\|878459_878846_+\|hypothetical-protein	gnl\|CDD\|238382	cd00741, Lipase, Lipase. Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation", the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site.	0.00175478
NZ_CP044164.1\|WP_002867221.1\|891393_892584_-\|molybdopterin-molybdotransferase-MoeA	gnl\|CDD\|223380	COG0303, MoeA, Molybdopterin biosynthesis enzyme [Coenzyme metabolism].	8.12925e-144
NZ_CP044164.1\|WP_002790275.1\|880201_880933_-\|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase	gnl\|CDD\|225539	COG2992, Bax, Uncharacterized FlgJ-related protein [General function prediction only].	1.1922e-81
NZ_CP044164.1\|WP_151014790.1\|894922_896071_+\|carboxynorspermidine-decarboxylase	gnl\|CDD\|273414	TIGR01047, carboxynorspermidine_decarboxylase, carboxynorspermidine decarboxylase. This protein is related to diaminopimelate decarboxylase. It is the last enzyme in norspermidine biosynthesis by an unusual pathway shown in Vibrio alginolyticus. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP044164.1\|WP_002790273.1\|877786_878236_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	1.36734e-47

>NZ_CP044164.1|WP_002797817.1|889807_890239_+|CRISPR-associated-endonuclease-Cas2
MIEDKFMRVLLMFDVPTKSKKEQKLASKFRNNLIKLGYFMLQFSVYMRICKGLSSAKSSIENVKKILPPYGNVRALIITEKQFDKMELLLGGIVFNEKVNNETNLTLFDIDSHGEFKYKNSNNEEIQINKKQEKYHQQNLFEF
>NZ_CP044164.1|WP_002807151.1|888924_889815_+|type-II-CRISPR-associated-endonuclease-Cas1
MSYDEAFKTLLISSNAKLNLELNHLVIKQDENIAKLFLKDINIIVLESLQVSISSALFNAFARHKIILLTCDETHSINGVFTPFLGHFQSAKIAKEQMNVSAQKKAILWQKIIKNKILNQAFVLKKHNKIEQSNELINLAKKVSLNDSKNIEAVAAALYFKTLFGVSFSRDELCFENSALNYGYAIIRACIIRAVCISGLLPWLGIKHDNIYNSFALCDDLIEVFRASVDDCVLKLKGESEFLSKDDKRALIGNLQSKINFDGQNYPLNRAINHYVANFKNALLYEDELKIVKFDD
>NZ_CP044164.1|WP_002779495.1|883368_884346_+|hypothetical-protein
MKNIVFHSDGFGDLLVCFKALYAIKQLYPEYKLFLLTNGLMESDFLEKIPFIDEVLIYKDDFLEKIQSKNPVIFITTRRQGLYFKKLKFLNVQKCIVFPHLISIISKNLTTPLPFFRAKKHMSEIVLKLVRMINTRHFDKNFNQIDFSKIKNLLPYDARLSDNFFKQIDTKYEKIIGINAFSNNSEYRGFNFFIKDWIGLARQLSLKYPKFLFILLNFSTNSIQYNIDQNANLKVFCNNKNIASLVSISQKLDFLITVDTGNLHLCDILQIPTLAFTSSLAAYRFGGGSYGGRFDKLIVKPAWQKEYRKIYEIFTKKAENNLENL
>NZ_CP044164.1|WP_002829610.1|882319_883309_+|phosphoribosylformylglycinamidine-cyclo-ligase
MKISYEDAGVSIDNGNAFVEAIKPLVKETFNDNVVGGIGSFAGAFRMPSGFKNPVILGATDGVGTKLRLAIDAKKYDTIGQDLVAMCVNDLICNFATPLFFLDYYATAKLEVEVAKAVVSGIAKGCKMANCALIGGETAEMPGMYAKDDFDLAGFAVGMAEEDEIDRSKFVKNGDILLALPSSGLHSNGYSLARKVLFEGLKLKFDDKIEGKNLIDVLLEPTRIYVRDFLTLKPYISALAHITGGGLVENLPRVLPRGMGATIRKHHLKTPEIFYTIGQAVEESEMYRSFNMGVGLVMVVDPSNVSRVLENSDAFIIGEICINEGIVLE
>NZ_CP044164.1|WP_002829612.1|881653_882259_-|dephospho-CoA-kinase
MKNAFFVTASIACGKSTFIEIANSLGFKSISADKIAHKILDKNALELEKIFSPFSLKNLLTKEKKIDRKILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILEQENKPFFVEIPLFFESGAYDGLGKVILIYAPKELSLKRIIQRDNLSLEAAKARLDSQIDIEEKLKKADFIIKNTNSYADFRQECVKVIQEISKGKM
>NZ_CP044164.1|WP_002795329.1|880907_881657_-|diaminopimelate-epimerase
MKFYKYCASGNDFVITNADRKEDRSALAKELCNRYEGIGADGFIVILPHEKYDFEWEFYNNDGSRAAMCGNGSRAAAHFAHHINGIKPHMAFLTGAGVIKANVDNNSVEVSLGKIKNIQDAFSECEKNWQLCDTGVPHLVHFCENLDEFDLKLCKQMREKYNANVNFVKVENDNTLRVRTFERGVEDETQACGTGMGACFYLAFLNKKIHNQARVIPKSGEELSFKFENEELFFKGKVRYCFEANYNFS
>NZ_CP044164.1|WP_002790275.1|880201_880933_-|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase
MKRIIIFLSFYLLPLFGNSELKNGFGEEYYKLNVEQKRQIFFTKMNAMFDKSFEEIAKERAFVEAFFYDAYKNGLRNSNQNNLEKLINLKNKYRVENLYDFTEYKKRIQKIPKSMGIAQALVESAMGTSRFAREANNLFGEWTWGEKGLIPDLRYPDKKHKIRIFDSLQDSVDSYVLNLNRHFAYEEFRNERAKFESEGKEITGLEAIKTLDSYSERKGYYINIVTKIIQRYDLERYDTPKSF
>NZ_CP044164.1|WP_002822792.1|879157_880195_+|ATP-binding-protein
MKVLNFFYENHPKFEISYERKVQIPLCNIIIKGPKFSGKKTLIFNYLSQFKPNEILFLNLYDTRFENQSLGHLSNFLEKNVQIKFLCIYNVEFALNLQDIKIPIIISTDKKDLHIEGFQELELDYFDFEEFVSISRKNLPINNLVGLFLQSGRSKLGEKNILLRQNFNTLELEILKYLALNLGQQISISKLFLELKKKLKTSKDSVYHTIKELENTYIIHPISHDEKKLQKIYFRDFGLRNNLCIQKDFAHLFENLILNELFKFKQEFFYNKFFTFYSKVSKIAYISSPTLDIDLIKLRAKKILSKSLELGIFHVVFITLSSEDSFFEQGVKFEVLPFDKFSLGF
>NZ_CP044164.1|WP_002829615.1|878459_878846_+|hypothetical-protein
MFKVLTHNIFQKECVIIGKFEPLMAFYFIKRFDLLAHINEDYLDSRGGFRASLFQNKENKEFILAIAGSDLRPLKFDIGDLISDFILLNGKIPKKQFDSLLKFYTLIKKEFCFGKITLVGHSLGGHLA
>NZ_CP044164.1|WP_002790273.1|877786_878236_+|DNA-starvation/stationary-phase-protection-protein
MSVTKQLLQMQADAHHLWVKFHNYHWNVKGLQFYSIHEYTEKAYEEMAELFDNCAERALQLGEKAITCQKTLMENAKSPKVEKDCFTPVEVMELIKKDYEYLLAEFKKLNEEAEKASDTTTAAFAQENIAKYEKSLWMLASVLQNTCKM
>NZ_CP044164.1|WP_002867221.1|891393_892584_-|molybdopterin-molybdotransferase-MoeA
MLMSYEESLKILHSHIKTYEKIEKIALTECLGRILAQDIKAPKNQPEFPTSAMDGYAIKFEDQDKPLKILGLTPAGTMPQFSVQNGTCVKTFTGSLMSEGSDTLVPVENVRVENDTLFIEKKVPQAFAVRAVGENYKKDEILLKKGTRLNYSEIALLAELGFFHISVFIKPIVGVLSSGSEIKDLGEALENPAQIRSSNHIAIANLAKNLNCDTRVFPLLKDDEKATFSTLESALQSCDILITTGGVSMGDFDFLKKAIKEYEIIIDKADIKPGRHIKIAKANEKFIIALPGFPYSAMVMFNLYAREILNSWLLQPKDYICKAFLQGSYKKKTPYLEFVACNVEFKNGRILANLEGKKEGSSAIINNLNNKAALMVVPKECEMLENESLVDIIFMP
>NZ_CP044164.1|WP_002858889.1|892587_893034_-|molybdenum-cofactor-biosynthesis-protein-MoaE
MKHFTLYQGSLDIPKIYSQWYEFSKDKNCGALLTFCGIVREEGGIEALSFDIYEPLLKKWFDEWQKRVDFDGISLLFAHSIGDVAIHESSYFAGILSKQRKLGLKLLNEFVEDFKASAPIWKYDVINKERIYAKERSTKLCGAGLLKG
>NZ_CP044164.1|WP_002790284.1|893034_893256_-|MoaD/ThiS-family-protein
MVKVEFLGPINKENLELEVKNLKELKEILQKDESLKEWLELCAVSLNDEIIFDENTSLKDGDKIALLPPVCGG
>NZ_CP044164.1|WP_151014788.1|893257_894799_-|multicopper-oxidase-CueO
MNRRNFLKFNALTLASMGVAYANPMHDMHSMHKNHSINHDLDTSFINFAPKNLKLLDPKQFPQREILKALPLLKNESKEKNIFRATLEIKENHIELIKGKKTLFYTYNGLVPAPKIEVFEGDKLEILVKNKLKEATTIHWHGVPVPPDQDGSPHDPILAGEERIYRFEIPQDSAGTYWYHPHPHYTASKQVFMGLAGAFVIKAKKDALSHLKEKDLMISDLRLDENAQIPNNNLNDWLNGREGEFVLINGQFKPKIKLATNERIRIYNATAARYLNLRIQGAKFILVGTDGGLIEKAIYKEELFLSPASRVEVLIDAPKDGEFRLESAYYDRDKMMVEEEPNTLFLASISLKKEKLELPKNLKIFKPLEEPKEFKEIIMSEDHMQMHGMMGKSENELKIALASMFLINGKSYDLKRIDLSSKLGVVEDWIVINKSHMDHPFHIHGTQFELISSKLNGKVQKAEFRAFRDTINVRPNEELRLRMKQDFKGLRMYHCHILEHEDLGMMGNLEVKE
>NZ_CP044164.1|WP_151014790.1|894922_896071_+|carboxynorspermidine-decarboxylase
MFYEKIQTPAYILEEDKLRKNCELLASVGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQAKTQKKSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESADALEAVLKVFEEKFGKWIKQMKWVNFGGGHHITKQGYDIQKIITLCKNFSDKYGVQVYLEPGEAVGWQSGVLVASVVDIVENEKRIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDFKENEFAYLLTGNTCLAGDVMGEYAFKEELKRGDRVVFLDQIHYSIVKNTTFNGIRLPNLMLLNSKNELEMVREFSYKDYALRN
>NZ_CP044164.1|WP_002779485.1|896402_897104_+|molecular-chaperone-TorD-family-protein
MDLEKLRLARSLYYQCLGELFVFSFSENRLCNLKAYLEAMQESLFDESLRTSFEILLRNLQDVQDLQAFYKEYDELFLALKNTIPMTFSYIEEGFENSKALLNVRQILAKSTIRRNEKIFKEAEDSVGFCFVLMSEFLKNKEDELAKALFEKVINQSIDEFLMLIFSNSKAKLYKEIANIAAQFIEFERYCFELEKPTIKPSKKVQNDLSRSEFLRREANKQRRSREKSQGIS
>NZ_CP044164.1|WP_002779484.1|897078_897270_+|twin-arginine-translocation-signal-domain-containing-protein
MKNRREFLKKSAIALGTASLLGGASVAFGQDEERKDLVRGKSKKKEVLYQRSANWEKYYMRAE
>NZ_CP044164.1|WP_002784096.1|897269_897812_+|molybdopterin-dependent-oxidoreductase
MSSMNETIKLNRRSFLKMAALSSLASPLLARSETLREANADELKEAYEGSQKIKSVCTACSVGCGIIAEVQNGVWLRQEIAQDHPVSSGGHCCKGSDMIDMVRSHVRLKYPMKKENGEWKRISYEQALSEIGEKLAAYRKENPESVMFLGSAKLNNEQAYYIRKFAAFFGTNNVDHQARI
>NZ_CP044164.1|WP_002816879.1|897860_900074_+|molybdopterin-dependent-oxidoreductase
MTNHLGDIQRSKCIIIIGANPAVNHPVGFRHFLKAKEKGAKLIVVDPRFTKSAAKADIYARIRPGTDIAFMYGMLKIIFDEGLEDTKYLDERVFGIDKIREEAAKWTAEEVENVTGISKELLIQITHEVAKNKPTTLIWAMGLTQHTVGTSNTRLAPIVQMVLGNIGKFGGGVNILRGHDNVQGASDMACLSENLPGYYPLNEATWRYYAKIWGVDYEWLLGNFVSKDWMHKTGLSLARWWAAALNGKDGNDKVDNAGTSLKALVVMGNGITSTAQQAKVKEGLEALELLVLADPFVNEAGIIAERKDGIYLLPAATQFETSGSVTATNRSGQWRFKIIDPLYESKEDQEILFELAKKLGFYEDFTKTLRDENGKIVWPENATREIASAVRSIGLNGWSPERLKKHTLNWDKFDEVTLEGKDELAGEYYGLPWPCWSDKHPGSPVLYNTDIEVAKGGMGFRNNFGLEYEGENLLAKNAPINSPIDTGYPQITKDNIEKVLGITLSAEEKEKMGAIWSYDDSNIIATKCIEKGIVPYGNAKARAVVWTFKDQIPLHREPLHSPRNDLVQKYPSFEDQKALYRVDTKFVSVQKAKDYSKEFPLNLVTARLVNLNGAGMENRASMYLTRLTPEMFCEINPELASEQKIKAGDMIWVHSPEGTKIHVRVKLNPGVAKDMIFLPFHFTGVMQGVDLTHNFPKGTKPYASGESANTVTNYGYDIMCQIPETKGGLCRISKDGV
>NZ_CP044164.1|WP_002822573.1|900714_901647_+|formate-dehydrogenase-subunit-gamma
MRKVFVTLLLSVVSLFAYGSERMGQDTQIWDFHRITNIPNYDTFGKLWTTLQGEYIATIALIAVIAVLSAFALHYMVIGPKQFSHDGKKIYAFTLFERLFHFIAAISWVILVPTGFVMMFGATFGGGLFVRVCKNLHAFATVLFIISIIPMFLWWIKRMLPASYDIRWMMIVGGYLSKVKRPVPAGKFNFGQKSWYYIAVFGGFLMIITGGFMYFLDFNSTAIQGLFGLTQIELLRLSAIIHNFLGIICAVFFGIHIYMAVFAIKGSIHSMVSGYKEEEEVYILHSYWYKELSNKKQIEPSFSYDPNVKI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044164_1	1.13\|891080\|29\|NZ_CP044164\|CRISPRCasFinder	891080-891108	29	MN530981	Campylobacter phage DA10, complete genome	18193-18221	0	1.0
NZ_CP044164_1	1.26\|891079\|30\|NZ_CP044164\|CRT,PILER-CR	891079-891108	30	MN530981	Campylobacter phage DA10, complete genome	18193-18222	0	1.0
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	MN530981	Campylobacter phage DA10, complete genome	28475-28503	1	0.966
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MN530981	Campylobacter phage DA10, complete genome	28474-28503	1	0.967
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	NC_013373	Staphylococcus sp. CDC3 plasmid SAP020A, complete sequence	62816-62840	2	0.92
NZ_CP044164_1	1.1\|890421\|25\|NZ_CP044164\|PILER-CR	890421-890445	25	HQ331142	Salmonella phage S16, complete genome	35423-35447	4	0.84
NZ_CP044164_1	1.1\|890421\|25\|NZ_CP044164\|PILER-CR	890421-890445	25	KJ000058	Salmonella phage STP4-a, complete genome	35417-35441	4	0.84
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	NZ_CP010131	Escherichia coli strain C9 plasmid B, complete genome	31367-31391	4	0.84
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	MG592562	Vibrio phage 1.193.O._10N.286.52.C6, partial genome	63233-63257	4	0.84
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	NZ_CP038630	Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence	3787-3811	4	0.84
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	MH383160	Escherichia phage UB, complete genome	188774-188798	4	0.84
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN698245	Pelagibacter phage HTVC111P, complete genome	24007-24035	4	0.862
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN698246	Pelagibacter phage HTVC112P, complete genome	25613-25641	4	0.862
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP031100	Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence	53123-53151	4	0.862
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP014173	Clostridium botulinum strain B609 plasmid pRSJ22_2, complete sequence	15418-15446	4	0.862
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP038620	Arsenophonus nasoniae strain FIN plasmid pArsFIN8, complete sequence	76859-76887	4	0.862
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN698245	Pelagibacter phage HTVC111P, complete genome	24006-24035	4	0.867
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN698246	Pelagibacter phage HTVC112P, complete genome	25612-25641	4	0.867
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP031100	Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence	53122-53151	4	0.867
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP014173	Clostridium botulinum strain B609 plasmid pRSJ22_2, complete sequence	15417-15446	4	0.867
NZ_CP044164_1	1.2\|890487\|25\|NZ_CP044164\|PILER-CR	890487-890511	25	NZ_CP030933	Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence	756960-756984	5	0.8
NZ_CP044164_1	1.4\|890486\|29\|NZ_CP044164\|CRISPRCasFinder	890486-890514	29	MN855763	Myoviridae sp. isolate 210, complete genome	65952-65980	5	0.828
NZ_CP044164_1	1.4\|890486\|29\|NZ_CP044164\|CRISPRCasFinder	890486-890514	29	MH383160	Escherichia phage UB, complete genome	188773-188801	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	AP017994	Planktothrix agardhii NIES-204 plasmid plasmid3 DNA, complete sequence	31101-31129	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	AP014501	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C4, * SEQUENCING IN PROGRESS *, 3 ordered pieces	18415-18443	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP015334	Borrelia hermsii HS1 isolate Browne Mountain plasmid lpG27, complete sequence	17747-17775	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693730	Marine virus AFVG_250M748, complete genome	50882-50910	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694145	Marine virus AFVG_250M840, complete genome	7440-7468	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694657	Marine virus AFVG_250M407, complete genome	31394-31422	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MT375527	Pelagibacter phage Hroenn EXVC0, complete genome	38851-38879	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MT375526	Pelagibacter phage Himinglaeva EXVC011P, complete genome	17743-17771	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MT375531	Pelagibacter phage Unn EXVC019P, complete genome	40345-40373	5	0.828
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MT375520	Pelagibacter phage Bylgja EXVC0, complete genome	17743-17771	5	0.828
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP028099	Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence	94929-94957	5	0.828
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NC_005229	Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence	94929-94957	5	0.828
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	CP009911	Borreliella chilensis strain VA1 plasmid cp26, complete sequence	25886-25914	5	0.828
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	NC_021803	Cellulophaga phage phi13:2, complete genome	37257-37285	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039088	Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence	52337-52365	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039113	Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence	50032-50060	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039061	Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence	113857-113885	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039093	Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence	53443-53471	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039172	Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence	52337-52365	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013797	Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence	146945-146973	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013976	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-1, complete sequence	37152-37180	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP012511	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence	168867-168895	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013824	Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence	168934-168962	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013804	Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence	168870-168898	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039869	Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence	58259-58287	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039233	Piscirickettsia salmonis strain SR1 plasmid unnamed6, complete sequence	22163-22191	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013820	Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence	146947-146975	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013792	Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence	146914-146942	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013815	Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence	146946-146974	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039071	Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence	50032-50060	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039103	Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence	52336-52364	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039177	Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence	52336-52364	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039108	Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence	50032-50060	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039051	Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence	64855-64883	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013946	Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence	166051-166079	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039078	Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence	53442-53470	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039082	Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence	59885-59913	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP038919	Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence	52336-52364	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP038899	Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence	58548-58576	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	14555-14583	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	189522-189550	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP038905	Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence	37007-37035	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP038928	Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence	38759-38787	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013787	Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence	35163-35191	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP011850	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence	80228-80256	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039098	Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence	114066-114094	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039056	Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence	58702-58730	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP039047	Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence	133191-133219	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013807	Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence	35158-35186	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP048060	Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence	116051-116079	5	0.828
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP013782	Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence	35157-35185	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	CP019144	Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence	89573-89601	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP032118	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.3, complete sequence	18934-18962	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP007625	Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence	180436-180464	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP009650	Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence	47007-47035	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MH853787	Acinetobacter phage vB_KpnM_IME284, complete genome	10430-10458	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP043832	Bacillus sp. BS98 plasmid unnamed2	151596-151624	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP020434	Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence	5153-5181	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	304606-304634	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	AP013560	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C14B-MedDCM-OCT-S35-C3, * SEQUENCING IN PROGRESS *, 5 ordered pieces	3064-3092	5	0.828
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	AP013779	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14-MedDCM-OCT-S36-C254, * SEQUENCING IN PROGRESS *	2917-2945	5	0.828
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	AP014501	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C4, * SEQUENCING IN PROGRESS *, 3 ordered pieces	18414-18443	5	0.833
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	NC_021803	Cellulophaga phage phi13:2, complete genome	37257-37286	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039088	Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence	52337-52366	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039113	Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence	50032-50061	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039061	Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence	113857-113886	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP038905	Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence	37006-37035	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP038928	Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence	38758-38787	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039093	Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence	53443-53472	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039172	Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence	52337-52366	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013797	Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence	146945-146974	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013976	Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-1, complete sequence	37152-37181	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP012511	Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence	168867-168896	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013787	Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence	35162-35191	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013824	Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence	168934-168963	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013804	Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence	168870-168899	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039869	Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence	58259-58288	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039233	Piscirickettsia salmonis strain SR1 plasmid unnamed6, complete sequence	22163-22192	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013820	Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence	146947-146976	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP053952	Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence	427463-427492	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013792	Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence	146914-146943	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013815	Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence	146946-146975	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP011850	Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence	80227-80256	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039071	Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence	50032-50061	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039098	Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence	114065-114094	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039103	Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence	52336-52365	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039177	Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence	52336-52365	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039108	Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence	50032-50061	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039051	Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence	64855-64884	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013946	Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence	166051-166080	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039056	Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence	58701-58730	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039078	Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence	53442-53471	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039082	Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence	59885-59914	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP039047	Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence	133190-133219	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP038919	Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence	52336-52365	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP038899	Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence	58548-58577	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013807	Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence	35157-35186	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP048060	Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence	116050-116079	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP013782	Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence	35156-35185	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	14555-14584	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP048053	Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence	189522-189551	5	0.833
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP053949	Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence	77521-77550	5	0.833
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	CP019144	Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence	89572-89601	5	0.833
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP032118	Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.3, complete sequence	18934-18963	5	0.833
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MH853787	Acinetobacter phage vB_KpnM_IME284, complete genome	10430-10459	5	0.833
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP043832	Bacillus sp. BS98 plasmid unnamed2	151595-151624	5	0.833
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP020434	Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence	5152-5181	5	0.833
NZ_CP044164_1	1.3\|890420\|29\|NZ_CP044164\|CRISPRCasFinder	890420-890448	29	HQ331142	Salmonella phage S16, complete genome	35422-35450	6	0.793
NZ_CP044164_1	1.3\|890420\|29\|NZ_CP044164\|CRISPRCasFinder	890420-890448	29	KJ000058	Salmonella phage STP4-a, complete genome	35416-35444	6	0.793
NZ_CP044164_1	1.5\|890552\|29\|NZ_CP044164\|CRISPRCasFinder	890552-890580	29	MN693384	Marine virus AFVG_25M512, complete genome	22480-22508	6	0.793
NZ_CP044164_1	1.5\|890552\|29\|NZ_CP044164\|CRISPRCasFinder	890552-890580	29	AP013554	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C28-MedDCM-OCT-S23-C36, * SEQUENCING IN PROGRESS *, 7 ordered pieces	26797-26825	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694024	Marine virus AFVG_250M601, complete genome	42304-42332	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694464	Marine virus AFVG_250M526, complete genome	14059-14087	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693873	Marine virus AFVG_250M921, complete genome	6401-6429	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448860	Streptococcus phage Javan172, complete genome	7188-7216	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448848	Streptococcus phage Javan126, complete genome	4879-4907	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448857	Streptococcus phage Javan164, complete genome	4879-4907	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448677	Streptococcus phage Javan133, complete genome	5871-5899	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448679	Streptococcus phage Javan137, complete genome	5413-5441	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	AP013455	Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S38-C40	22019-22047	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	AP018399	Xanthomonas phage XacN1 DNA, complete genome	248480-248508	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP007767	Campylobacter peloridis LMG 23910 plasmid pPEL1, complete sequence	28419-28447	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NC_018701	Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence	1393148-1393176	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP044261	Campylobacter armoricus strain CA639 plasmid pCA639-1, complete sequence	27105-27133	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP021802	Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence	2004854-2004882	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP021831	Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence	1606266-1606294	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP021810	Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence	517045-517073	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	163718-163746	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK867354	Synechococcus phage S-SCSM1, complete genome	141978-142006	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693598	Marine virus AFVG_25M403, complete genome	28655-28683	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693285	Marine virus AFVG_25M368, complete genome	32918-32946	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693833	Marine virus AFVG_250M459, complete genome	19848-19876	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP016706	Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8C, complete sequence	1911-1939	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NC_004981	Lactococcus lactis ML8 plasmid pCL2.1, complete sequence	1114-1142	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	CP016703	Lactococcus lactis subsp. lactis strain C10 plasmid pC10A, complete sequence	1912-1940	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP016712	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109F, complete sequence	2205-2233	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP013007	Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence	34397-34425	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694503	Marine virus AFVG_250M970, complete genome	5816-5844	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448729	Streptococcus phage Javan31, complete genome	20980-21008	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693518	Marine virus AFVG_25M99, complete genome	6433-6461	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448691	Streptococcus phage Javan17, complete genome	20980-21008	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448948	Streptococcus phage Javan46, complete genome	20924-20952	6	0.793
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448768	Streptococcus phage Javan47, complete genome	22628-22656	6	0.793
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MK554696	Fusobacterium phage Fnu1, complete genome	116972-117000	6	0.793
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	AB897757	Klebsiella phage K64-1 DNA, complete genome	323940-323968	6	0.793
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	LC121099	Klebsiella phage K64-1 S1-3 gene for tail spike protein, complete cds	1843-1871	6	0.793
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1925456-1925484	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MT774379	CrAssphage cr118_1, complete genome	27064-27092	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	AP022644	Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence	329841-329869	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP014283	Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence	456089-456117	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	462827-462855	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP032614	Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence	145273-145301	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP013276	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence	288282-288310	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP039722	Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence	66071-66099	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NC_018688	Bacillus thuringiensis MC28 plasmid pMC319, complete sequence	159829-159857	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	4908-4936	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP045023	Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence	288283-288311	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP016590	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence	50254-50282	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MN694105	Marine virus AFVG_250M210, complete genome	10619-10647	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MN694723	Marine virus AFVG_250M211, complete genome	15838-15866	6	0.793
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MF158042	Shigella phage Sd1, complete genome	44729-44757	6	0.793
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	MN855763	Myoviridae sp. isolate 210, complete genome	65951-65980	6	0.8
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	MH383160	Escherichia phage UB, complete genome	188772-188801	6	0.8
NZ_CP044164_1	1.18\|890551\|30\|NZ_CP044164\|CRT	890551-890580	30	MN693384	Marine virus AFVG_25M512, complete genome	22480-22509	6	0.8
NZ_CP044164_1	1.18\|890551\|30\|NZ_CP044164\|CRT	890551-890580	30	AP013554	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C28-MedDCM-OCT-S23-C36, * SEQUENCING IN PROGRESS *, 7 ordered pieces	26797-26826	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	AP017994	Planktothrix agardhii NIES-204 plasmid plasmid3 DNA, complete sequence	31100-31129	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693730	Marine virus AFVG_250M748, complete genome	50881-50910	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448860	Streptococcus phage Javan172, complete genome	7188-7217	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448848	Streptococcus phage Javan126, complete genome	4879-4908	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448857	Streptococcus phage Javan164, complete genome	4879-4908	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448677	Streptococcus phage Javan133, complete genome	5871-5900	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448679	Streptococcus phage Javan137, complete genome	5413-5442	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694145	Marine virus AFVG_250M840, complete genome	7440-7469	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	AP018399	Xanthomonas phage XacN1 DNA, complete genome	248480-248509	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP016706	Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8C, complete sequence	1911-1940	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NC_004981	Lactococcus lactis ML8 plasmid pCL2.1, complete sequence	1114-1143	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	CP016703	Lactococcus lactis subsp. lactis strain C10 plasmid pC10A, complete sequence	1912-1941	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP016712	Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109F, complete sequence	2205-2234	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP044261	Campylobacter armoricus strain CA639 plasmid pCA639-1, complete sequence	27104-27133	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694657	Marine virus AFVG_250M407, complete genome	31393-31422	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK867354	Synechococcus phage S-SCSM1, complete genome	141977-142006	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693598	Marine virus AFVG_25M403, complete genome	28654-28683	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693285	Marine virus AFVG_25M368, complete genome	32917-32946	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693518	Marine virus AFVG_25M99, complete genome	6433-6462	6	0.8
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693833	Marine virus AFVG_250M459, complete genome	19848-19877	6	0.8
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP028099	Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence	94928-94957	6	0.8
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NC_005229	Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence	94928-94957	6	0.8
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	CP009911	Borreliella chilensis strain VA1 plasmid cp26, complete sequence	25885-25914	6	0.8
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP032535	Bacillus megaterium NCT-2 plasmid pNCT2_7, complete sequence	1230-1259	6	0.8
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MK554696	Fusobacterium phage Fnu1, complete genome	116972-117001	6	0.8
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	AB897757	Klebsiella phage K64-1 DNA, complete genome	323940-323969	6	0.8
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	LC121099	Klebsiella phage K64-1 S1-3 gene for tail spike protein, complete cds	1842-1871	6	0.8
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	360740-360769	6	0.8
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	1925455-1925484	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP009650	Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence	47006-47035	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP007625	Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence	180436-180465	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	304605-304634	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MF158042	Shigella phage Sd1, complete genome	44728-44757	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MT774379	CrAssphage cr118_1, complete genome	27064-27093	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	AP022644	Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence	329840-329869	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	462826-462855	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP013276	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence	288281-288310	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP039722	Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence	66070-66099	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP009349	Bacillus thuringiensis HD1002 plasmid 1, complete sequence	4907-4936	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP045023	Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence	288282-288311	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP014283	Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence	456089-456118	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP032614	Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence	145273-145302	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NC_018688	Bacillus thuringiensis MC28 plasmid pMC319, complete sequence	159829-159858	6	0.8
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP016590	Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence	50254-50283	6	0.8
NZ_CP044164_1	1.4\|890486\|29\|NZ_CP044164\|CRISPRCasFinder	890486-890514	29	NZ_CP038630	Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence	3786-3814	7	0.759
NZ_CP044164_1	1.9\|890816\|29\|NZ_CP044164\|CRISPRCasFinder	890816-890844	29	NZ_CP021643	Campylobacter concisus strain P2CDO4 plasmid pICON, complete sequence	100191-100219	7	0.759
NZ_CP044164_1	1.9\|890816\|29\|NZ_CP044164\|CRISPRCasFinder	890816-890844	29	CAJDKA010000002	Enterococcus phage 163 genome assembly, contig: phage163-genome, whole genome shotgun sequence	55391-55419	7	0.759
NZ_CP044164_1	1.9\|890816\|29\|NZ_CP044164\|CRISPRCasFinder	890816-890844	29	MT774393	CrAssphage cr127_1, complete genome	78610-78638	7	0.759
NZ_CP044164_1	1.9\|890816\|29\|NZ_CP044164\|CRISPRCasFinder	890816-890844	29	KY549443	Enterococcus phage EFP01, complete genome	45147-45175	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	40189-40217	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694260	Marine virus AFVG_250M1009, complete genome	30929-30957	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694525	Marine virus AFVG_250M794, complete genome	30811-30839	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	93982-94010	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694657	Marine virus AFVG_250M407, complete genome	23879-23907	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693377	Marine virus AFVG_25M301, complete genome	31600-31628	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693833	Marine virus AFVG_250M459, complete genome	24008-24036	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693079	Marine virus AFVG_25M302, complete genome	31598-31626	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP016746	Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence	116658-116686	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP013929	Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence	30216-30244	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	CP013931	Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence	30222-30250	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP031793	Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed1, complete sequence	7755-7783	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	30239-30267	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	268607-268635	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP018322	Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence	30761-30789	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MK448704	Streptococcus phage Javan213, complete genome	39467-39495	7	0.759
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MH153807	Rhodococcus phage Peregrin, complete genome	108404-108432	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP044347	Escherichia coli strain P225M plasmid pP225M-CTX-M-55, complete sequence	20050-20078	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	11618-11646	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP039267	Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence	16269-16297	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	769116-769144	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	MH552525	Siphoviridae sp. isolate ctbc8, complete genome	36018-36046	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NC_015907	Borreliella bissettii DN127 plasmid cp26, complete sequence	10445-10473	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_MK461928	Escherichia coli strain F2_14D plasmid pF2_14D_F, complete sequence	101738-101766	7	0.759
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	AP013521	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S42-C60	21868-21896	7	0.759
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MT774385	CrAssphage cr108_1, complete genome	67782-67810	7	0.759
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN657062	Psychrobacter sp. strain ANT_P27 plasmid pA27P2, complete sequence	553-581	7	0.759
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN694016	Marine virus AFVG_250M811, complete genome	14460-14488	7	0.759
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN693800	Marine virus AFVG_250M813, complete genome	14447-14475	7	0.759
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MN694554	Marine virus AFVG_250M812, complete genome	14463-14491	7	0.759
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	MG029511	Staphylococcus phage phiSa2wa_st30, complete genome	19550-19578	7	0.759
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	MN856071	Myoviridae sp. isolate 215, complete genome	15815-15843	7	0.759
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP053952	Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence	427464-427492	7	0.759
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	NZ_CP053949	Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence	77522-77550	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP015011	Rickettsia bellii isolate An04 plasmid unnamed, complete sequence	23128-23156	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP032196	Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence	3387-3415	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP027615	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence	9844-9872	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP034172	Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence	3067-3095	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP017464	Staphylococcus pasteuri strain JS7 plasmid pSNJS701, complete sequence	9625-9653	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	NZ_CP045608	Bacillus cereus strain SB1 plasmid p2, complete sequence	15633-15661	7	0.759
NZ_CP044164_1	1.15\|891212\|29\|NZ_CP044164\|CRISPRCasFinder	891212-891240	29	MN694259	Marine virus AFVG_250M30, complete genome	17922-17950	7	0.759
NZ_CP044164_1	1.16\|890419\|30\|NZ_CP044164\|CRT	890419-890448	30	HQ331142	Salmonella phage S16, complete genome	35421-35450	7	0.767
NZ_CP044164_1	1.16\|890419\|30\|NZ_CP044164\|CRT	890419-890448	30	KJ000058	Salmonella phage STP4-a, complete genome	35415-35444	7	0.767
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP010131	Escherichia coli strain C9 plasmid B, complete genome	31364-31393	7	0.767
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP038630	Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence	3785-3814	7	0.767
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP033246	Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence	186322-186351	7	0.767
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP033248	Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence	186362-186391	7	0.767
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP013238	Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence	318651-318680	7	0.767
NZ_CP044164_1	1.22\|890815\|30\|NZ_CP044164\|CRT,PILER-CR	890815-890844	30	KY549443	Enterococcus phage EFP01, complete genome	45146-45175	7	0.767
NZ_CP044164_1	1.22\|890815\|30\|NZ_CP044164\|CRT,PILER-CR	890815-890844	30	NZ_CP021643	Campylobacter concisus strain P2CDO4 plasmid pICON, complete sequence	100191-100220	7	0.767
NZ_CP044164_1	1.22\|890815\|30\|NZ_CP044164\|CRT,PILER-CR	890815-890844	30	CAJDKA010000002	Enterococcus phage 163 genome assembly, contig: phage163-genome, whole genome shotgun sequence	55391-55420	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694464	Marine virus AFVG_250M526, complete genome	14059-14088	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693873	Marine virus AFVG_250M921, complete genome	6401-6430	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694024	Marine virus AFVG_250M601, complete genome	42303-42332	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	AP013455	Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S38-C40	22019-22048	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694260	Marine virus AFVG_250M1009, complete genome	30928-30957	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694525	Marine virus AFVG_250M794, complete genome	30810-30839	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP007767	Campylobacter peloridis LMG 23910 plasmid pPEL1, complete sequence	28418-28447	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP013007	Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence	34397-34426	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_LR134418	Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9	163717-163746	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694503	Marine virus AFVG_250M970, complete genome	5816-5845	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	AX059140	Sequence 1 from Patent WO0075335	5666-5695	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694657	Marine virus AFVG_250M407, complete genome	23878-23907	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	KY653126	Staphylococcus phage IME1354_01, complete genome	15431-15460	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693377	Marine virus AFVG_25M301, complete genome	31599-31628	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448729	Streptococcus phage Javan31, complete genome	20980-21009	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693833	Marine virus AFVG_250M459, complete genome	24007-24036	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448691	Streptococcus phage Javan17, complete genome	20980-21009	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NC_004735	Rhodothermus phage RM378, complete genome	5666-5695	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MH153807	Rhodococcus phage Peregrin, complete genome	108404-108433	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693079	Marine virus AFVG_25M302, complete genome	31597-31626	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448948	Streptococcus phage Javan46, complete genome	20924-20953	7	0.767
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448768	Streptococcus phage Javan47, complete genome	22628-22657	7	0.767
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP029455	Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence	11617-11646	7	0.767
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP044347	Escherichia coli strain P225M plasmid pP225M-CTX-M-55, complete sequence	20049-20078	7	0.767
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP039267	Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence	16268-16297	7	0.767
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_MK461928	Escherichia coli strain F2_14D plasmid pF2_14D_F, complete sequence	101738-101767	7	0.767
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	769115-769144	7	0.767
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	283816-283845	7	0.767
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN657062	Psychrobacter sp. strain ANT_P27 plasmid pA27P2, complete sequence	553-582	7	0.767
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP038620	Arsenophonus nasoniae strain FIN plasmid pArsFIN8, complete sequence	76858-76887	7	0.767
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MN694105	Marine virus AFVG_250M210, complete genome	10618-10647	7	0.767
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MN694723	Marine virus AFVG_250M211, complete genome	15837-15866	7	0.767
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP045608	Bacillus cereus strain SB1 plasmid p2, complete sequence	15633-15662	7	0.767
NZ_CP044164_1	1.4\|890486\|29\|NZ_CP044164\|CRISPRCasFinder	890486-890514	29	NZ_CP030933	Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence	756957-756985	8	0.724
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	910373-910401	8	0.724
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN694579	Marine virus AFVG_250M1138, complete genome	469-497	8	0.724
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693144	Marine virus AFVG_25M372, complete genome	22976-23004	8	0.724
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP013682	Clostridium botulinum strain 1169 plasmid pRSJ8_1, complete sequence	59725-59753	8	0.724
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	NZ_CP013295	Clostridium botulinum strain CDC_54064 plasmid pNPD1_1, complete sequence	70441-70469	8	0.724
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	MN692973	Marine virus AFVG_117M33, complete genome	23003-23031	8	0.724
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	KT997860	Uncultured Mediterranean phage uvDeep-CGR2-KM19-C269, complete genome	21143-21171	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	KY779848	Staphylococcus phage qdsa001, complete genome	109525-109553	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	LC492751	Staphylococcus phage KSAP7 genomic DNA, compelete genome	75950-75978	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	AP013516	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S29-C44	25501-25529	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	LC492752	Staphylococcus phage KSAP11 genomic DNA, compelete genome	75770-75798	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	NC_022090	Staphylococcus phage vB_SauM_Remus, complete genome	73688-73716	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	LC576631	Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence	110645-110673	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	MT080595	UNVERIFIED: Staphylococcus phage vB_SauM_EW41, partial genome	66364-66392	8	0.724
NZ_CP044164_1	1.12\|891014\|29\|NZ_CP044164\|CRISPRCasFinder	891014-891042	29	NC_020877	Staphylococcus phage vB_SauM_Romulus, complete genome	73688-73716	8	0.724
NZ_CP044164_1	1.13\|891080\|29\|NZ_CP044164\|CRISPRCasFinder	891080-891108	29	GU943077	Uncultured phage MedDCM-OCT-S09-C5 genomic sequence	9825-9853	8	0.724
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	AP013513	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-C84-MedDCM-OCT-S32-C77	2101-2129	8	0.724
NZ_CP044164_1	1.14\|891146\|29\|NZ_CP044164\|CRISPRCasFinder	891146-891174	29	FJ429185	Lactococcus phage P087, complete genome	19983-20011	8	0.724
NZ_CP044164_1	1.17\|890485\|30\|NZ_CP044164\|CRT	890485-890514	30	NZ_CP030933	Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence	756957-756986	8	0.733
NZ_CP044164_1	1.22\|890815\|30\|NZ_CP044164\|CRT,PILER-CR	890815-890844	30	MT774393	CrAssphage cr127_1, complete genome	78609-78638	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_LR134399	Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence	40188-40217	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP048287	Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence	93981-94010	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP016746	Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence	116658-116687	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP013929	Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence	30216-30245	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	CP013931	Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence	30222-30251	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP031793	Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed1, complete sequence	7755-7784	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	30239-30268	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NC_019394	Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence	268607-268636	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP018322	Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence	30761-30790	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MK448704	Streptococcus phage Javan213, complete genome	39467-39496	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693300	Marine virus AFVG_25M71, complete genome	13469-13498	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693144	Marine virus AFVG_25M372, complete genome	22976-23005	8	0.733
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693380	Marine virus AFVG_25M72, complete genome	13451-13480	8	0.733
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NC_015907	Borreliella bissettii DN127 plasmid cp26, complete sequence	10445-10474	8	0.733
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	AP013521	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S42-C60	21868-21897	8	0.733
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MH552525	Siphoviridae sp. isolate ctbc8, complete genome	36017-36046	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MT774385	CrAssphage cr108_1, complete genome	67782-67811	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	KY779848	Staphylococcus phage qdsa001, complete genome	109524-109553	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	LC492751	Staphylococcus phage KSAP7 genomic DNA, compelete genome	75949-75978	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	LC492752	Staphylococcus phage KSAP11 genomic DNA, compelete genome	75769-75798	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	NC_022090	Staphylococcus phage vB_SauM_Remus, complete genome	73687-73716	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	LC576631	Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence	110644-110673	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MT080595	UNVERIFIED: Staphylococcus phage vB_SauM_EW41, partial genome	66363-66392	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	NC_020877	Staphylococcus phage vB_SauM_Romulus, complete genome	73687-73716	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN694016	Marine virus AFVG_250M811, complete genome	14459-14488	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	AP013516	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S29-C44	25500-25529	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN693800	Marine virus AFVG_250M813, complete genome	14446-14475	8	0.733
NZ_CP044164_1	1.25\|891013\|30\|NZ_CP044164\|CRT,PILER-CR	891013-891042	30	MN694554	Marine virus AFVG_250M812, complete genome	14462-14491	8	0.733
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	MG029511	Staphylococcus phage phiSa2wa_st30, complete genome	19550-19579	8	0.733
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	MN856071	Myoviridae sp. isolate 215, complete genome	15815-15844	8	0.733
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	FJ429185	Lactococcus phage P087, complete genome	19983-20012	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP015011	Rickettsia bellii isolate An04 plasmid unnamed, complete sequence	23127-23156	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP032196	Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence	3386-3415	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP027615	Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence	9843-9872	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	MN694259	Marine virus AFVG_250M30, complete genome	17921-17950	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP034172	Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence	3067-3096	8	0.733
NZ_CP044164_1	1.28\|891211\|30\|NZ_CP044164\|CRT	891211-891240	30	NZ_CP017464	Staphylococcus pasteuri strain JS7 plasmid pSNJS701, complete sequence	9625-9654	8	0.733
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693285	Marine virus AFVG_25M368, complete genome	42037-42065	9	0.69
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693300	Marine virus AFVG_25M71, complete genome	13469-13497	9	0.69
NZ_CP044164_1	1.10\|890882\|29\|NZ_CP044164\|CRISPRCasFinder	890882-890910	29	MN693380	Marine virus AFVG_25M72, complete genome	13451-13479	9	0.69
NZ_CP044164_1	1.11\|890948\|29\|NZ_CP044164\|CRISPRCasFinder	890948-890976	29	MN693197	Marine virus AFVG_25M502, complete genome	19051-19079	9	0.69
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	NZ_CP022523	Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence	910373-910402	9	0.7
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN694579	Marine virus AFVG_250M1138, complete genome	469-498	9	0.7
NZ_CP044164_1	1.23\|890881\|30\|NZ_CP044164\|CRT,PILER-CR	890881-890910	30	MN693285	Marine virus AFVG_25M368, complete genome	42036-42065	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP013682	Clostridium botulinum strain 1169 plasmid pRSJ8_1, complete sequence	59725-59754	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NZ_CP013295	Clostridium botulinum strain CDC_54064 plasmid pNPD1_1, complete sequence	70441-70470	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MK809530	Salmonella phage vB_SenS_SB6, complete genome	8352-8381	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MN692973	Marine virus AFVG_117M33, complete genome	23003-23032	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431738	Bacteriophage T5-like poul149, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431738	Bacteriophage T5-like poul149, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MK972709	Salmonella phage SE20, complete genome	35619-35648	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431736	Bacteriophage T5-like chee130_1, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431736	Bacteriophage T5-like chee130_1, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MT074463	Salmonella phage gmork, complete genome	1336-1365	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431737	Bacteriophage T5-like saus132, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431737	Bacteriophage T5-like saus132, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MK972707	Salmonella phage SE24, complete genome	11282-11311	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431739	Bacteriophage T5-like chee158, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431739	Bacteriophage T5-like chee158, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MT074457	Salmonella phage rokbiter, complete genome	1408-1437	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MH370386	Salmonella phage S147, complete genome	99815-99844	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431740	Bacteriophage T5-like cott162, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431740	Bacteriophage T5-like cott162, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431741	Bacteriophage T5-like saus176N, complete genome	6960-6989	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MF431741	Bacteriophage T5-like saus176N, complete genome	120229-120258	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	CP000917	Enterobacteria phage EPS7, complete genome	8530-8559	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MT074452	Salmonella phage vaffelhjerte, complete genome	2005-2034	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MT074453	Salmonella phage misterkot, complete genome	2142-2171	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MK972704	Salmonella phage SE19, complete genome	110883-110912	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	NC_048867	Salmonella phage faergetype, complete genome	1564-1593	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	KT997860	Uncultured Mediterranean phage uvDeep-CGR2-KM19-C269, complete genome	21143-21172	9	0.7
NZ_CP044164_1	1.26\|891079\|30\|NZ_CP044164\|CRT,PILER-CR	891079-891108	30	GU943077	Uncultured phage MedDCM-OCT-S09-C5 genomic sequence	9825-9854	9	0.7
NZ_CP044164_1	1.27\|891145\|30\|NZ_CP044164\|CRT	891145-891174	30	AP013513	Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-C84-MedDCM-OCT-S32-C77	2101-2130	9	0.7
NZ_CP044164_1	1.24\|890947\|30\|NZ_CP044164\|CRT,PILER-CR	890947-890976	30	MN693197	Marine virus AFVG_25M502, complete genome	19051-19080	10	0.667

1. spacer 1.13|891080|29|NZ_CP044164|CRISPRCasFinder matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 0, identity: 1.0

tatttatgtggtgcaagtcaagttgaaac	CRISPR spacer
tatttatgtggtgcaagtcaagttgaaac	Protospacer
*****************************

2. spacer 1.26|891079|30|NZ_CP044164|CRT,PILER-CR matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 0, identity: 1.0

ctatttatgtggtgcaagtcaagttgaaac	CRISPR spacer
ctatttatgtggtgcaagtcaagttgaaac	Protospacer
******************************

3. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 1, identity: 0.966

attataaaaacattattttctaaaggctc	CRISPR spacer
attataaaaacattgttttctaaaggctc	Protospacer
**************.**************

4. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 1, identity: 0.967

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattataaaaacattgttttctaaaggctc	Protospacer
***************.**************

5. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to NC_013373 (Staphylococcus sp. CDC3 plasmid SAP020A, complete sequence) position: , mismatch: 2, identity: 0.92

atgattttaattttcattt-gtatcc	CRISPR spacer
atgattttaattttcatttagtatt-	Protospacer
******************* ****.

6. spacer 1.1|890421|25|NZ_CP044164|PILER-CR matches to HQ331142 (Salmonella phage S16, complete genome) position: , mismatch: 4, identity: 0.84

gttttgaagtaagcacagcttcttt	CRISPR spacer
tttttgaagtcatcacagcttcttg	Protospacer
 ********* * ***********

7. spacer 1.1|890421|25|NZ_CP044164|PILER-CR matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 4, identity: 0.84

gttttgaagtaagcacagcttcttt	CRISPR spacer
tttttgaagtcatcacagcttcttg	Protospacer
 ********* * ***********

8. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to NZ_CP010131 (Escherichia coli strain C9 plasmid B, complete genome) position: , mismatch: 4, identity: 0.84

atgattttaattttcatttgtatcc	CRISPR spacer
atgattttaattttcatttatttat	Protospacer
*******************.* * .

9. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to MG592562 (Vibrio phage 1.193.O._10N.286.52.C6, partial genome) position: , mismatch: 4, identity: 0.84

atgattttaattttcatttgtatcc	CRISPR spacer
atgattgcaattttcatttgtatat	Protospacer
****** .*************** .

10. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to NZ_CP038630 (Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence) position: , mismatch: 4, identity: 0.84

atgattttaattttcatttgtatcc	CRISPR spacer
atgattttaattgttatttgtatta	Protospacer
************ *.********.

11. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 4, identity: 0.84

atgattttaattttcatttgtatcc	CRISPR spacer
atgattttcattttcatttgcattt	Protospacer
******** ***********.**..

12. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 4, identity: 0.862

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttattgttaataatattaactttgt	Protospacer
******.***.**************** .

13. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN698246 (Pelagibacter phage HTVC112P, complete genome) position: , mismatch: 4, identity: 0.862

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttattgttaataatattaactttgt	Protospacer
******.***.**************** .

14. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP031100 (Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence) position: , mismatch: 4, identity: 0.862

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
acagaaaacaatttaaataaagtaacatt	Protospacer
*  *******************.** ***

15. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP014173 (Clostridium botulinum strain B609 plasmid pRSJ22_2, complete sequence) position: , mismatch: 4, identity: 0.862

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
acagaaaacaatttaaataaagtaacatt	Protospacer
*  *******************.** ***

16. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038620 (Arsenophonus nasoniae strain FIN plasmid pArsFIN8, complete sequence) position: , mismatch: 4, identity: 0.862

-agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
cagc-aattcaatttaaatatagcaaaatt	Protospacer
 *** **  *********** *********

17. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN698245 (Pelagibacter phage HTVC111P, complete genome) position: , mismatch: 4, identity: 0.867

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttattgttaataatattaactttgt	Protospacer
*******.***.**************** .

18. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN698246 (Pelagibacter phage HTVC112P, complete genome) position: , mismatch: 4, identity: 0.867

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttattgttaataatattaactttgt	Protospacer
*******.***.**************** .

19. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP031100 (Clostridium botulinum strain CFSAN034202 plasmid p1_CFSAN034202, complete sequence) position: , mismatch: 4, identity: 0.867

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tacagaaaacaatttaaataaagtaacatt	Protospacer
**  *******************.** ***

20. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP014173 (Clostridium botulinum strain B609 plasmid pRSJ22_2, complete sequence) position: , mismatch: 4, identity: 0.867

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tacagaaaacaatttaaataaagtaacatt	Protospacer
**  *******************.** ***

21. spacer 1.2|890487|25|NZ_CP044164|PILER-CR matches to NZ_CP030933 (Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence) position: , mismatch: 5, identity: 0.8

atgattttaattttcatttgtatcc	CRISPR spacer
ccaattttatttttcatttgtatca	Protospacer
 ..****** **************

22. spacer 1.4|890486|29|NZ_CP044164|CRISPRCasFinder matches to MN855763 (Myoviridae sp. isolate 210, complete genome) position: , mismatch: 5, identity: 0.828

aatgattttaattttcatttgtatccttt	CRISPR spacer
aaaaatttcaattttcatttgtttccttc	Protospacer
** .****.************* *****.

23. spacer 1.4|890486|29|NZ_CP044164|CRISPRCasFinder matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 5, identity: 0.828

aatgattttaattttcatttgtatccttt	CRISPR spacer
aatgattttcattttcatttgcattttct	Protospacer
********* ***********.**..*.*

24. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to AP017994 (Planktothrix agardhii NIES-204 plasmid plasmid3 DNA, complete sequence) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttaagttctgccatattttactccttaga	Protospacer
************** **** ****** .

25. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to AP014501 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C4, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
tctttttctgccatttttttctccttttt	Protospacer
*.   ********************** *

26. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP015334 (Borrelia hermsii HS1 isolate Browne Mountain plasmid lpG27, complete sequence) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttgttctgccatttatttctcctttcg	Protospacer
**  ************ **********

27. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693730 (Marine virus AFVG_250M748, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
tcatcttctgccatttttttctccgttgt	Protospacer
*.*  ******************* **.*

28. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694145 (Marine virus AFVG_250M840, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
tcatcttctgccatttttttctccgttgt	Protospacer
*.*  ******************* **.*

29. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694657 (Marine virus AFVG_250M407, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttgttctgccattttatcctcctttct	Protospacer
**  ************* *.******* *

30. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MT375527 (Pelagibacter phage Hroenn EXVC0, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttagttattgccattgttttctcctttat	Protospacer
***. * .******* *************

31. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MT375526 (Pelagibacter phage Himinglaeva EXVC011P, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttagttattgccattgttttctcctttat	Protospacer
***. * .******* *************

32. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MT375531 (Pelagibacter phage Unn EXVC019P, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttagttattgccattgttttctcctttat	Protospacer
***. * .******* *************

33. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MT375520 (Pelagibacter phage Bylgja EXVC0, complete genome) position: , mismatch: 5, identity: 0.828

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttagttattgccattgttttctcctttat	Protospacer
***. * .******* *************

34. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP028099 (Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence) position: , mismatch: 5, identity: 0.828

attataaaaacattattttctaaaggctc	CRISPR spacer
cgtataaaaatattattttctaaagccgc	Protospacer
  ********.************** * *

35. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NC_005229 (Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence) position: , mismatch: 5, identity: 0.828

attataaaaacattattttctaaaggctc	CRISPR spacer
cgtataaaaatattattttctaaagccgc	Protospacer
  ********.************** * *

36. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to CP009911 (Borreliella chilensis strain VA1 plasmid cp26, complete sequence) position: , mismatch: 5, identity: 0.828

attataaaaacattattttctaaaggctc	CRISPR spacer
attataaaaacattattttttataatctt	Protospacer
*******************.** *. **.

37. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to NC_021803 (Cellulophaga phage phi13:2, complete genome) position: , mismatch: 5, identity: 0.828

tcatttgttgctaataatattaacttttc	CRISPR spacer
ccatttgtttccaataatattaactttaa	Protospacer
.******** *.***************

38. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039088 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

39. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039113 (Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

40. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039061 (Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

41. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039093 (Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

42. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039172 (Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

43. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013797 (Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

44. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013976 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

45. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP012511 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

46. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013824 (Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

47. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013804 (Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

48. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039869 (Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

49. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039233 (Piscirickettsia salmonis strain SR1 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

50. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013820 (Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

51. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013792 (Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

52. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013815 (Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

53. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039071 (Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

54. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039103 (Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

55. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039177 (Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

56. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039108 (Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

57. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039051 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

58. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013946 (Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

59. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039078 (Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

60. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039082 (Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

61. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038919 (Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

62. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038899 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

63. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

64. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

65. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038905 (Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

66. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038928 (Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

67. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013787 (Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

68. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP011850 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

69. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039098 (Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

70. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039056 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

71. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039047 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

72. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013807 (Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

73. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP048060 (Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

74. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013782 (Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence) position: , mismatch: 5, identity: 0.828

-actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatc-tctttcacatcaaattctttattg	Protospacer
 * ** ******* ******* *******.

75. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to CP019144 (Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gtagaaaaaaatttagataaagcaaaatt	Protospacer
.  ***** ******.*************

76. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP032118 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.3, complete sequence) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gtagaaaaaaatttagataaagcaaaatt	Protospacer
.  ***** ******.*************

77. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP007625 (Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggcgaaaacaaaataaataaagcaaaggt	Protospacer
.**********  *************. *

78. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP009650 (Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggcgaaaacaaaataaataaagcaaaggt	Protospacer
.**********  *************. *

79. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MH853787 (Acinetobacter phage vB_KpnM_IME284, complete genome) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aaagaaaacaatttaaataaaacaaatat	Protospacer
*. ******************.****  *

80. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP043832 (Bacillus sp. BS98 plasmid unnamed2) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaagt	Protospacer
.*.********  ************** *

81. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP020434 (Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaagt	Protospacer
.*.********  ************** *

82. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
actgaaaaaaatgtaaataaagcaaaaat	Protospacer
* .***** *** ************** *

83. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to AP013560 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C14B-MedDCM-OCT-S35-C3, *** SEQUENCING IN PROGRESS ***, 5 ordered pieces) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aactataacaatttaactaaaacaaaatt	Protospacer
*.* * ********** ****.*******

84. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to AP013779 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C14-MedDCM-OCT-S36-C254, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.828

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aactataacaatttaactaaaacaaaatt	Protospacer
*.* * ********** ****.*******

85. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to AP014501 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S32-C4, *** SEQUENCING IN PROGRESS ***, 3 ordered pieces) position: , mismatch: 5, identity: 0.833

tttaagttctgccatttttttctcctttat	CRISPR spacer
ttctttttctgccatttttttctccttttt	Protospacer
**.   ********************** *

86. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to NC_021803 (Cellulophaga phage phi13:2, complete genome) position: , mismatch: 5, identity: 0.833

ttcatttgttgctaataatattaacttttc	CRISPR spacer
tccatttgtttccaataatattaactttaa	Protospacer
*.******** *.***************

87. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039088 (Piscirickettsia salmonis strain Psal-111 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

88. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039113 (Piscirickettsia salmonis strain Psal-135 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

89. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039061 (Piscirickettsia salmonis strain Psal-099 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

90. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP038905 (Piscirickettsia salmonis strain Psal-008 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

91. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP038928 (Piscirickettsia salmonis strain Psal-013 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

92. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039093 (Piscirickettsia salmonis strain Psal-114 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

93. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039172 (Piscirickettsia salmonis strain Psal-138 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

94. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013797 (Piscirickettsia salmonis strain AY6532B plasmid p1PS9, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

95. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013976 (Piscirickettsia salmonis strain CGR02 plasmid pPSCRG02-1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

96. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP012511 (Piscirickettsia salmonis strain PM32597B1 plasmid pPSB1-3, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

97. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013787 (Piscirickettsia salmonis strain PM58386B plasmid p1PS7, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

98. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013824 (Piscirickettsia salmonis strain PM25344B plasmid p3PS14, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

99. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013804 (Piscirickettsia salmonis strain PM22180B plasmid p3PS13, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

100. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039869 (Piscirickettsia salmonis strain Psal-113 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

101. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039233 (Piscirickettsia salmonis strain SR1 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

102. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013820 (Piscirickettsia salmonis strain AY3800B plasmid p4PS10, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

103. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP053952 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaat-atctttcaaataaaatgcgttataa	Protospacer
 ** * *********** ****** **** *

104. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013792 (Piscirickettsia salmonis strain AY6297B plasmid p1PS8, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

105. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013815 (Piscirickettsia salmonis strain AY3864B plasmid p4PS11, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

106. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP011850 (Piscirickettsia salmonis LF-89 = ATCC VR-1361 plasmid pPSLF89-1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

107. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039071 (Piscirickettsia salmonis strain Psal-108 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

108. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039098 (Piscirickettsia salmonis strain Psal-117 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

109. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039103 (Piscirickettsia salmonis strain Psal-118 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

110. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039177 (Piscirickettsia salmonis strain Psal-139 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

111. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039108 (Piscirickettsia salmonis strain Psal-134 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

112. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039051 (Piscirickettsia salmonis strain Psal-081 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

113. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013946 (Piscirickettsia salmonis strain PSCGR01 plasmid pPsCRG01-1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

114. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039056 (Piscirickettsia salmonis strain Psal-098 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

115. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039078 (Piscirickettsia salmonis strain Psal-109 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

116. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039082 (Piscirickettsia salmonis strain Psal-110 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

117. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP039047 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

118. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP038919 (Piscirickettsia salmonis strain Psal-010b plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

119. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP038899 (Piscirickettsia salmonis strain Psal-006b plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

120. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013807 (Piscirickettsia salmonis strain PM31429B plasmid p1PS12, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

121. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP048060 (Piscirickettsia salmonis strain Ps-8942B plasmid Ps8942B-p4, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

122. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP013782 (Piscirickettsia salmonis strain PM49811B plasmid p1PS6, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

123. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

124. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP048053 (Piscirickettsia salmonis strain Ps-11091B plasmid Ps11091B-p1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaatc-tctttcacatcaaattctttattg	Protospacer
 ** ** ******* ******* *******.

125. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP053949 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

-tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gtaat-atctttcaaataaaatgcgttataa	Protospacer
 ** * *********** ****** **** *

126. spacer 1.28|891211|30|NZ_CP044164|CRT matches to CP019144 (Acinetobacter lwoffii strain ZS207 plasmid pmZS, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tgtagaaaaaaatttagataaagcaaaatt	Protospacer
*.  ***** ******.*************

127. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP032118 (Acinetobacter lwoffii strain ED45-23 plasmid pALWED2.3, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tgtagaaaaaaatttagataaagcaaaatt	Protospacer
*.  ***** ******.*************

128. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MH853787 (Acinetobacter phage vB_KpnM_IME284, complete genome) position: , mismatch: 5, identity: 0.833

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
taaagaaaacaatttaaataaaacaaatat	Protospacer
**. ******************.****  *

129. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP043832 (Bacillus sp. BS98 plasmid unnamed2) position: , mismatch: 5, identity: 0.833

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaagt	Protospacer
*.*.********  ************** *

130. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP020434 (Bacillus sp. FDAARGOS_235 plasmid 1, complete sequence) position: , mismatch: 5, identity: 0.833

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaagt	Protospacer
*.*.********  ************** *

131. spacer 1.3|890420|29|NZ_CP044164|CRISPRCasFinder matches to HQ331142 (Salmonella phage S16, complete genome) position: , mismatch: 6, identity: 0.793

agttttgaagtaagcacagcttctttgct	CRISPR spacer
atttttgaagtcatcacagcttcttggta	Protospacer
* ********* * *********** *.

132. spacer 1.3|890420|29|NZ_CP044164|CRISPRCasFinder matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 6, identity: 0.793

agttttgaagtaagcacagcttctttgct	CRISPR spacer
atttttgaagtcatcacagcttcttggta	Protospacer
* ********* * *********** *.

133. spacer 1.5|890552|29|NZ_CP044164|CRISPRCasFinder matches to MN693384 (Marine virus AFVG_25M512, complete genome) position: , mismatch: 6, identity: 0.793

tccattgtagaaacaggtgtttttatagg	CRISPR spacer
gctgttgaagaaacaggtgattttataga	Protospacer
 *..*** *********** ********.

134. spacer 1.5|890552|29|NZ_CP044164|CRISPRCasFinder matches to AP013554 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C28-MedDCM-OCT-S23-C36, *** SEQUENCING IN PROGRESS ***, 7 ordered pieces) position: , mismatch: 6, identity: 0.793

tccattgtagaaacaggtgtttttatagg	CRISPR spacer
gctgttgaagaaacaggtgattttataga	Protospacer
 *..*** *********** ********.

135. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694024 (Marine virus AFVG_250M601, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tttgaatctgccatttatttctcctttag	Protospacer
** .. ********** ***********

136. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694464 (Marine virus AFVG_250M526, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tctttttcagccattttattctcctttat	Protospacer
*.   *** ******** ***********

137. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693873 (Marine virus AFVG_250M921, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
gtatccgctgccatttttttctcctatat	Protospacer
 **  . ****************** ***

138. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448860 (Streptococcus phage Javan172, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggattttctaccattttttactcctttat	Protospacer
  *  ****.********* *********

139. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448848 (Streptococcus phage Javan126, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggattttctaccattttttactcctttat	Protospacer
  *  ****.********* *********

140. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448857 (Streptococcus phage Javan164, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggattttctaccattttttactcctttat	Protospacer
  *  ****.********* *********

141. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448677 (Streptococcus phage Javan133, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggattttctaccattttttactcctttat	Protospacer
  *  ****.********* *********

142. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448679 (Streptococcus phage Javan137, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggattttctaccattttttactcctttat	Protospacer
  *  ****.********* *********

143. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to AP013455 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S38-C40) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
taattgtctgccattgttttctcctttaa	Protospacer
* *   ********* ************

144. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tatccttctgccacttttttctcctatat	Protospacer
*    ********.*********** ***

145. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP007767 (Campylobacter peloridis LMG 23910 plasmid pPEL1, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tttacaaatgccatttttttctccttaat	Protospacer
** *    ****************** **

146. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NC_018701 (Sinorhizobium meliloti Rm41 plasmid pSYMB, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tgaagctctgccatctttttctcctatcc	Protospacer
* ***.********.********** * .

147. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP044261 (Campylobacter armoricus strain CA639 plasmid pCA639-1, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tttacgaatgccatttttttctccttaat	Protospacer
** *    ****************** **

148. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP021802 (Sinorhizobium meliloti strain USDA1021 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tgaagctctgccatctttttctcctatcc	Protospacer
* ***.********.********** * .

149. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP021831 (Sinorhizobium meliloti strain HM006 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tgaagctctgccattttgttctcctatcc	Protospacer
* ***.*********** ******* * .

150. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP021810 (Sinorhizobium meliloti strain Rm41 plasmid psymB, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tgaagctctgccatctttttctcctatcc	Protospacer
* ***.********.********** * .

151. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
atcatgtctgccattttactctcctttat	Protospacer
 * *  *********** .**********

152. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK867354 (Synechococcus phage S-SCSM1, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tacgggtctgccctttttttgtcctttat	Protospacer
*  .* ****** ******* ********

153. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693598 (Marine virus AFVG_25M403, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttgtcgtctgacatttttttctcctatat	Protospacer
**.   **** ************** ***

154. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693285 (Marine virus AFVG_25M368, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tcgtgatttgccatttttatctcctttat	Protospacer
*.. * *.********** **********

155. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693833 (Marine virus AFVG_250M459, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttcgcctctgccatttttatctccttgat	Protospacer
** . .************ ******* **

156. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP016706 (Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8C, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttctcttctgccattttttactccttcaa	Protospacer
**   ************** ******.*

157. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NC_004981 (Lactococcus lactis ML8 plasmid pCL2.1, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttctcttctgccattttttactccttcaa	Protospacer
**   ************** ******.*

158. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to CP016703 (Lactococcus lactis subsp. lactis strain C10 plasmid pC10A, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttctcttctgccattttttactccttcaa	Protospacer
**   ************** ******.*

159. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP016712 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109F, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttctcttctgccattttttactccttcaa	Protospacer
**   ************** ******.*

160. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013007 (Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ctacgttctgccatttttttcttactgat	Protospacer
.** ******************. .* **

161. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694503 (Marine virus AFVG_250M970, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
tcattatctgccatctttttctccttttt	Protospacer
*.*   ********.************ *

162. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448729 (Streptococcus phage Javan31, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttcttctgccataattttctcctttag	Protospacer
**   *********  ************

163. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693518 (Marine virus AFVG_25M99, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttcttctgccatttttgtctccttagt	Protospacer
**   ************* ******* .*

164. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448691 (Streptococcus phage Javan17, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttcttctgccataattttctcctttag	Protospacer
**   *********  ************

165. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448948 (Streptococcus phage Javan46, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttcttctgccataattttctcctttag	Protospacer
**   *********  ************

166. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448768 (Streptococcus phage Javan47, complete genome) position: , mismatch: 6, identity: 0.793

ttaagttctgccatttttttctcctttat	CRISPR spacer
ttttcttctgccataattttctcctttag	Protospacer
**   *********  ************

167. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MK554696 (Fusobacterium phage Fnu1, complete genome) position: , mismatch: 6, identity: 0.793

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcattagttgctaataataataaagattt	Protospacer
***** ************* ***   **.

168. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 6, identity: 0.793

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcagttgtttctaataatattaatggctc	Protospacer
*** ***** *************.  .**

169. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to LC121099 (Klebsiella phage K64-1 S1-3 gene for tail spike protein, complete cds) position: , mismatch: 6, identity: 0.793

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcagttgtttctaataatattaatggctc	Protospacer
*** ***** *************.  .**

170. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.793

actcatctttcaaatcaaatgctttatta	CRISPR spacer
tcccctctttcaattcaaatgctgtattc	Protospacer
 *.* ******** ********* ****

171. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MT774379 (CrAssphage cr118_1, complete genome) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
attttaaacattttaaataaagtaaaatt	Protospacer
* .  ***** ***********.******

172. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to AP022644 (Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

173. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP014283 (Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tgtgaaaacaacataaataaagcaaaggt	Protospacer
 *.********. *************. *

174. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

175. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP032614 (Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tgtgaaaacaacataaataaagcaaaggt	Protospacer
 *.********. *************. *

176. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013276 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

177. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039722 (Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

178. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NC_018688 (Bacillus thuringiensis MC28 plasmid pMC319, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

179. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP009349 (Bacillus thuringiensis HD1002 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

180. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP045023 (Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

181. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP016590 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggtgaaaacaaaataaataaagcaaaggt	Protospacer
.*.********  *************. *

182. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MN694105 (Marine virus AFVG_250M210, complete genome) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aaaaaaaacaaattaaataaaacaaaaat	Protospacer
*. .******* *********.***** *

183. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MN694723 (Marine virus AFVG_250M211, complete genome) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aaaaaaaacaaattaaataaaacaaaaat	Protospacer
*. .******* *********.***** *

184. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MF158042 (Shigella phage Sd1, complete genome) position: , mismatch: 6, identity: 0.793

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
agcgaaaacaagttatataaagctcgagt	Protospacer
*********** *** *******  .* *

185. spacer 1.17|890485|30|NZ_CP044164|CRT matches to MN855763 (Myoviridae sp. isolate 210, complete genome) position: , mismatch: 6, identity: 0.8

taatgattttaattttcatttgtatccttt	CRISPR spacer
caaaaatttcaattttcatttgtttccttc	Protospacer
.** .****.************* *****.

186. spacer 1.17|890485|30|NZ_CP044164|CRT matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 6, identity: 0.8

taatgattttaattttcatttgtatccttt	CRISPR spacer
aaatgattttcattttcatttgcattttct	Protospacer
 ********* ***********.**..*.*

187. spacer 1.18|890551|30|NZ_CP044164|CRT matches to MN693384 (Marine virus AFVG_25M512, complete genome) position: , mismatch: 6, identity: 0.8

ttccattgtagaaacaggtgtttttatagg	CRISPR spacer
tgctgttgaagaaacaggtgattttataga	Protospacer
* *..*** *********** ********.

188. spacer 1.18|890551|30|NZ_CP044164|CRT matches to AP013554 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C28-MedDCM-OCT-S23-C36, *** SEQUENCING IN PROGRESS ***, 7 ordered pieces) position: , mismatch: 6, identity: 0.8

ttccattgtagaaacaggtgtttttatagg	CRISPR spacer
tgctgttgaagaaacaggtgattttataga	Protospacer
* *..*** *********** ********.

189. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to AP017994 (Planktothrix agardhii NIES-204 plasmid plasmid3 DNA, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
attaagttctgccatattttactccttaga	Protospacer
 ************** **** ****** .

190. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693730 (Marine virus AFVG_250M748, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
gtcatcttctgccatttttttctccgttgt	Protospacer
 *.*  ******************* **.*

191. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448860 (Streptococcus phage Javan172, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggattttctaccattttttactcctttat	Protospacer
*  *  ****.********* *********

192. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448848 (Streptococcus phage Javan126, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggattttctaccattttttactcctttat	Protospacer
*  *  ****.********* *********

193. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448857 (Streptococcus phage Javan164, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggattttctaccattttttactcctttat	Protospacer
*  *  ****.********* *********

194. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448677 (Streptococcus phage Javan133, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggattttctaccattttttactcctttat	Protospacer
*  *  ****.********* *********

195. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448679 (Streptococcus phage Javan137, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggattttctaccattttttactcctttat	Protospacer
*  *  ****.********* *********

196. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694145 (Marine virus AFVG_250M840, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
gtcatcttctgccatttttttctccgttgt	Protospacer
 *.*  ******************* **.*

197. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
ttatccttctgccacttttttctcctatat	Protospacer
**    ********.*********** ***

198. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP016706 (Lactococcus lactis subsp. lactis strain UL8 plasmid pUL8C, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttctcttctgccattttttactccttcaa	Protospacer
***   ************** ******.*

199. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NC_004981 (Lactococcus lactis ML8 plasmid pCL2.1, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttctcttctgccattttttactccttcaa	Protospacer
***   ************** ******.*

200. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to CP016703 (Lactococcus lactis subsp. lactis strain C10 plasmid pC10A, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttctcttctgccattttttactccttcaa	Protospacer
***   ************** ******.*

201. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP016712 (Lactococcus lactis subsp. cremoris strain UC109 plasmid pUC109F, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttctcttctgccattttttactccttcaa	Protospacer
***   ************** ******.*

202. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP044261 (Campylobacter armoricus strain CA639 plasmid pCA639-1, complete sequence) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
ttttacgaatgccatttttttctccttaat	Protospacer
*** *    ****************** **

203. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694657 (Marine virus AFVG_250M407, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
cttttgttctgccattttatcctcctttct	Protospacer
.**  ************* *.******* *

204. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK867354 (Synechococcus phage S-SCSM1, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
ttacgggtctgccctttttttgtcctttat	Protospacer
**  .* ****** ******* ********

205. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693598 (Marine virus AFVG_25M403, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttgtcgtctgacatttttttctcctatat	Protospacer
***.   **** ************** ***

206. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693285 (Marine virus AFVG_25M368, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
ttcgtgatttgccatttttatctcctttat	Protospacer
**.. * *.********** **********

207. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693518 (Marine virus AFVG_25M99, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttttcttctgccatttttgtctccttagt	Protospacer
***   ************* ******* .*

208. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693833 (Marine virus AFVG_250M459, complete genome) position: , mismatch: 6, identity: 0.8

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttcgcctctgccatttttatctccttgat	Protospacer
*** . .************ ******* **

209. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP028099 (Synechocystis sp. IPPAS B-1465 plasmid pSYSM, complete sequence) position: , mismatch: 6, identity: 0.8

tattataaaaacattattttctaaaggctc	CRISPR spacer
gcgtataaaaatattattttctaaagccgc	Protospacer
   ********.************** * *

210. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NC_005229 (Synechocystis sp. PCC 6803 plasmid pSYSM, complete sequence) position: , mismatch: 6, identity: 0.8

tattataaaaacattattttctaaaggctc	CRISPR spacer
gcgtataaaaatattattttctaaagccgc	Protospacer
   ********.************** * *

211. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to CP009911 (Borreliella chilensis strain VA1 plasmid cp26, complete sequence) position: , mismatch: 6, identity: 0.8

tattataaaaacattattttctaaaggctc	CRISPR spacer
gattataaaaacattattttttataatctt	Protospacer
 *******************.** *. **.

212. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP032535 (Bacillus megaterium NCT-2 plasmid pNCT2_7, complete sequence) position: , mismatch: 6, identity: 0.8

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattattaaaacattattttttataagtta	Protospacer
****** *************.** *.*.*

213. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MK554696 (Fusobacterium phage Fnu1, complete genome) position: , mismatch: 6, identity: 0.8

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcattagttgctaataataataaagattt	Protospacer
****** ************* ***   **.

214. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcagttgtttctaataatattaatggctc	Protospacer
**** ***** *************.  .**

215. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to LC121099 (Klebsiella phage K64-1 S1-3 gene for tail spike protein, complete cds) position: , mismatch: 6, identity: 0.8

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcagttgtttctaataatattaatggctc	Protospacer
**** ***** *************.  .**

216. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
tactcttctttcaaatcaaatagttgttga	Protospacer
***** ***************. **  * *

217. spacer 1.27|891145|30|NZ_CP044164|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.8

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
ttcccctctttcaattcaaatgctgtattc	Protospacer
* *.* ******** ********* ****

218. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP009650 (Bacillus pseudomycoides strain BTZ plasmid pBTZ_1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
cggcgaaaacaaaataaataaagcaaaggt	Protospacer
..**********  *************. *

219. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP007625 (Bacillus pseudomycoides strain 219298 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
cggcgaaaacaaaataaataaagcaaaggt	Protospacer
..**********  *************. *

220. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aactgaaaaaaatgtaaataaagcaaaaat	Protospacer
 * .***** *** ************** *

221. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MF158042 (Shigella phage Sd1, complete genome) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tagcgaaaacaagttatataaagctcgagt	Protospacer
************ *** *******  .* *

222. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MT774379 (CrAssphage cr118_1, complete genome) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tattttaaacattttaaataaagtaaaatt	Protospacer
** .  ***** ***********.******

223. spacer 1.28|891211|30|NZ_CP044164|CRT matches to AP022644 (Bacillus wiedmannii PL1 plasmid pBwiPL1-1 DNA, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

224. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

225. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP013276 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-1-360K, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

226. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP039722 (Bacillus thuringiensis strain BT-59 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

227. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP009349 (Bacillus thuringiensis HD1002 plasmid 1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

228. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP045023 (Bacillus thuringiensis strain JW-1 plasmid p1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

229. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP014283 (Bacillus thuringiensis strain Bt185 plasmid pBT1850636, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ttgtgaaaacaacataaataaagcaaaggt	Protospacer
* *.********. *************. *

230. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP032614 (Bacillus thuringiensis strain QZL38 plasmid p.1, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ttgtgaaaacaacataaataaagcaaaggt	Protospacer
* *.********. *************. *

231. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NC_018688 (Bacillus thuringiensis MC28 plasmid pMC319, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

232. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP016590 (Bacillus thuringiensis strain KNU-07 plasmid pBTKNU07-02, complete sequence) position: , mismatch: 6, identity: 0.8

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tggtgaaaacaaaataaataaagcaaaggt	Protospacer
*.*.********  *************. *

233. spacer 1.4|890486|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP038630 (Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence) position: , mismatch: 7, identity: 0.759

aatgattttaattttcatttgtatccttt	CRISPR spacer
tatgattttaattgttatttgtattaaat	Protospacer
 ************ *.********.   *

234. spacer 1.9|890816|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP021643 (Campylobacter concisus strain P2CDO4 plasmid pICON, complete sequence) position: , mismatch: 7, identity: 0.759

ctataatattttttaactcgtaaaaatca	CRISPR spacer
atatgatattttttaactcgtatatgata	Protospacer
 ***.***************** * . .*

235. spacer 1.9|890816|29|NZ_CP044164|CRISPRCasFinder matches to CAJDKA010000002 (Enterococcus phage 163 genome assembly, contig: phage163-genome, whole genome shotgun sequence) position: , mismatch: 7, identity: 0.759

ctataa----tattttttaactcgtaaaaatca	CRISPR spacer
----agtgtttatttgttaagtcgtaaaaatca	Protospacer
    *.    ***** **** ************

236. spacer 1.9|890816|29|NZ_CP044164|CRISPRCasFinder matches to MT774393 (CrAssphage cr127_1, complete genome) position: , mismatch: 7, identity: 0.759

ctataatattttttaactcgtaaaaatca	CRISPR spacer
ctataatattatttaattcgtaagttcct	Protospacer
********** *****.******.  .*

237. spacer 1.9|890816|29|NZ_CP044164|CRISPRCasFinder matches to KY549443 (Enterococcus phage EFP01, complete genome) position: , mismatch: 7, identity: 0.759

ctataa----tattttttaactcgtaaaaatca	CRISPR spacer
----agtgtttatttgttaagtcgtaaaaatca	Protospacer
    *.    ***** **** ************

238. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
aaaaggtttgccatttttttctcctccaa	Protospacer
  *** *.*****************..*

239. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694260 (Marine virus AFVG_250M1009, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
aatccttctgccatttctttctccttgat	Protospacer
     ***********.********* **

240. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694525 (Marine virus AFVG_250M794, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
aatccttctgccatttctttctccttgat	Protospacer
     ***********.********* **

241. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
ctaagttctggcatttttttcaccccttg	Protospacer
.********* ********** **..*

242. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694657 (Marine virus AFVG_250M407, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
gtaagttctgctatttttttctttgatgt	Protospacer
 **********.**********..  *.*

243. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693377 (Marine virus AFVG_25M301, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggttgttctgccatttatttctcctattt	Protospacer
    ************ ******** * *

244. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693833 (Marine virus AFVG_250M459, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
gtaagttctgctatttttttctttgatgt	Protospacer
 **********.**********..  *.*

245. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693079 (Marine virus AFVG_25M302, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
ggttgttctgccatttatttctcctattt	Protospacer
    ************ ******** * *

246. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP016746 (Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
ctgtcatctgccattttcttctcctttgt	Protospacer
.*.   ***********.*********.*

247. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013929 (Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
attgtgtctgacatttttctctcctttat	Protospacer
 * .  **** *******.**********

248. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to CP013931 (Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
attgtgtctgacatttttctctcctttat	Protospacer
 * .  **** *******.**********

249. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP031793 (Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
ctgagttgagccatttttttctccttatc	Protospacer
.*.****  *****************  .

250. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
attgtgtctgacatttttctctcctttat	Protospacer
 * .  **** *******.**********

251. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
attgtgtctgacatttttctctcctttat	Protospacer
 * .  **** *******.**********

252. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP018322 (Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
attgtgtctgacatttttctctcctttat	Protospacer
 * .  **** *******.**********

253. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MK448704 (Streptococcus phage Javan213, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
caattatatgccatgtttttctcctttat	Protospacer
. *   * ****** **************

254. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MH153807 (Rhodococcus phage Peregrin, complete genome) position: , mismatch: 7, identity: 0.759

ttaagttctgccatttttttctcctttat	CRISPR spacer
aatggttctggcatttatttctcctttct	Protospacer
   .****** ***** ********** *

255. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP044347 (Escherichia coli strain P225M plasmid pP225M-CTX-M-55, complete sequence) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
tttataaaaacattattttatattaggtg	Protospacer
 ****************** **  .* *

256. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
attagaaaaacattattttttaattgtat	Protospacer
**** **************.***  *. .

257. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP039267 (Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
aacttaataacattattttctaaagtatt	Protospacer
* . *** *****************  *.

258. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
ttaataaaaaaattattttctaaaatatt	Protospacer
 * ******* *************.  *.

259. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to MH552525 (Siphoviridae sp. isolate ctbc8, complete genome) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
gatataaaaccattattttctaatgcata	Protospacer
. ******* ************* *  *

260. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NC_015907 (Borreliella bissettii DN127 plasmid cp26, complete sequence) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
gttataattacattattttctaaaaattg	Protospacer
.******  ***************...*

261. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_MK461928 (Escherichia coli strain F2_14D plasmid pF2_14D_F, complete sequence) position: , mismatch: 7, identity: 0.759

attataaaaacattatttt---ctaaaggctc	CRISPR spacer
tttataaaaacattattttatattagggg---	Protospacer
 ******************   .**..**

262. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to AP013521 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S42-C60) position: , mismatch: 7, identity: 0.759

attataaaaacattattttctaaaggctc	CRISPR spacer
gatacaaaaacattatcttctaaagaatt	Protospacer
. **.***********.********. *.

263. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MT774385 (CrAssphage cr108_1, complete genome) position: , mismatch: 7, identity: 0.759

tcatttgttgctaataatattaacttttc	CRISPR spacer
agatttattgctaataatattcacttgaa	Protospacer
  ****.************** ****

264. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN657062 (Psychrobacter sp. strain ANT_P27 plasmid pA27P2, complete sequence) position: , mismatch: 7, identity: 0.759

tcatttgttgctaataatattaacttttc	CRISPR spacer
tctacaattgctaataatattaacctttg	Protospacer
**  . .*****************.***

265. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN694016 (Marine virus AFVG_250M811, complete genome) position: , mismatch: 7, identity: 0.759

tcatttgttgctaataatattaacttttc	CRISPR spacer
tttattgttgctaataatggtaactttgg	Protospacer
*.  **************. *******

266. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN693800 (Marine virus AFVG_250M813, complete genome) position: , mismatch: 7, identity: 0.759

tcatttgttgctaataatattaacttttc	CRISPR spacer
tttattgttgctaataatggtaactttgg	Protospacer
*.  **************. *******

267. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MN694554 (Marine virus AFVG_250M812, complete genome) position: , mismatch: 7, identity: 0.759

tcatttgttgctaataatattaacttttc	CRISPR spacer
tttattgttgctaataatggtaactttgg	Protospacer
*.  **************. *******

268. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to MG029511 (Staphylococcus phage phiSa2wa_st30, complete genome) position: , mismatch: 7, identity: 0.759

actcatctttcaaatcaaatgctttatta	CRISPR spacer
tcaagttattcaaatctaatgctttatta	Protospacer
 *  .*. ******** ************

269. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to MN856071 (Myoviridae sp. isolate 215, complete genome) position: , mismatch: 7, identity: 0.759

actcatctttcaaatcaaatgctttatta	CRISPR spacer
cagcatcttttaaagcaaatgctttactc	Protospacer
   *******.*** ***********.*

270. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP053952 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatatctttcaaataaaatgcgttataa	Protospacer
   .*********** ****** **** *

271. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP053949 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.759

actcatctttcaaatcaaatgctttatta	CRISPR spacer
taatatctttcaaataaaatgcgttataa	Protospacer
   .*********** ****** **** *

272. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP015011 (Rickettsia bellii isolate An04 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
attaaaaacaaattaaataaagcaaatga	Protospacer
* ..******* **************

273. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP032196 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aagccaatcaatttaaataaaggaaaata	Protospacer
*.   ** ************** *****

274. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP027615 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aagccaatcaatttaaataaaggaaaata	Protospacer
*.   ** ************** *****

275. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP034172 (Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
ggttcaaaaaatttacataaagcaaaatc	Protospacer
.*.  *** ****** ************.

276. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP017464 (Staphylococcus pasteuri strain JS7 plasmid pSNJS701, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
acacaaaacaatttaaataacgtaaaaac	Protospacer
*   **************** *.**** .

277. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP045608 (Bacillus cereus strain SB1 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gatgaaaacaaaataaataaagcaaaggt	Protospacer
...********  *************. *

278. spacer 1.15|891212|29|NZ_CP044164|CRISPRCasFinder matches to MN694259 (Marine virus AFVG_250M30, complete genome) position: , mismatch: 7, identity: 0.759

agcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gaagggaacaatttaaatacagcaagatt	Protospacer
.. *..************* *****.***

279. spacer 1.16|890419|30|NZ_CP044164|CRT matches to HQ331142 (Salmonella phage S16, complete genome) position: , mismatch: 7, identity: 0.767

tagttttgaagtaagcacagcttctttgct	CRISPR spacer
aatttttgaagtcatcacagcttcttggta	Protospacer
 * ********* * *********** *.

280. spacer 1.16|890419|30|NZ_CP044164|CRT matches to KJ000058 (Salmonella phage STP4-a, complete genome) position: , mismatch: 7, identity: 0.767

tagttttgaagtaagcacagcttctttgct	CRISPR spacer
aatttttgaagtcatcacagcttcttggta	Protospacer
 * ********* * *********** *.

281. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP010131 (Escherichia coli strain C9 plasmid B, complete genome) position: , mismatch: 7, identity: 0.767

taatgattttaattttcatttgtatccttt	CRISPR spacer
taatgattttaattttcatttatttataaa	Protospacer
*********************.* * .

282. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP038630 (Arsenophonus nasoniae strain FIN plasmid pArsFIN18, complete sequence) position: , mismatch: 7, identity: 0.767

taatgattttaattttcatttgtatccttt	CRISPR spacer
ttatgattttaattgttatttgtattaaat	Protospacer
* ************ *.********.   *

283. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP033246 (Clostridium butyricum strain CFSA3987 plasmid pCFSA3987, complete sequence) position: , mismatch: 7, identity: 0.767

taatgattttaattttcatttgtatccttt	CRISPR spacer
taatgattttaattttaatttttcaaaatt	Protospacer
**************** **** *     **

284. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP033248 (Clostridium butyricum strain CFSA3989 plasmid pCFSA3989, complete sequence) position: , mismatch: 7, identity: 0.767

taatgattttaattttcatttgtatccttt	CRISPR spacer
taatgattttaattttaatttttcaaaatt	Protospacer
**************** **** *     **

285. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP013238 (Clostridium butyricum strain CDC_51208 plasmid pNPD4_2, complete sequence) position: , mismatch: 7, identity: 0.767

taatgattttaattttcatttgtatccttt	CRISPR spacer
taatgattttaattttaatttttcaaaatt	Protospacer
**************** **** *     **

286. spacer 1.22|890815|30|NZ_CP044164|CRT,PILER-CR matches to KY549443 (Enterococcus phage EFP01, complete genome) position: , mismatch: 7, identity: 0.767

tctataa-----tattttttaactcgtaaaaatca	CRISPR spacer
-----aagtgtttatttgttaagtcgtaaaaatca	Protospacer
     **     ***** **** ************

287. spacer 1.22|890815|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP021643 (Campylobacter concisus strain P2CDO4 plasmid pICON, complete sequence) position: , mismatch: 7, identity: 0.767

tctataatattttttaactcgtaaaaatca	CRISPR spacer
tatatgatattttttaactcgtatatgata	Protospacer
* ***.***************** * . .*

288. spacer 1.22|890815|30|NZ_CP044164|CRT,PILER-CR matches to CAJDKA010000002 (Enterococcus phage 163 genome assembly, contig: phage163-genome, whole genome shotgun sequence) position: , mismatch: 7, identity: 0.767

tctataa-----tattttttaactcgtaaaaatca	CRISPR spacer
-----aagtgtttatttgttaagtcgtaaaaatca	Protospacer
     **     ***** **** ************

289. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694464 (Marine virus AFVG_250M526, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
atctttttcagccattttattctcctttat	Protospacer
 *.   *** ******** ***********

290. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693873 (Marine virus AFVG_250M921, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
cgtatccgctgccatttttttctcctatat	Protospacer
. **  . ****************** ***

291. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694024 (Marine virus AFVG_250M601, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
atttgaatctgccatttatttctcctttag	Protospacer
 ** .. ********** ***********

292. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to AP013455 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G17, isolate: uvMED-CGR-U-MedDCM-OCT-S38-C40) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
ataattgtctgccattgttttctcctttaa	Protospacer
 * *   ********* ************

293. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694260 (Marine virus AFVG_250M1009, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
taatccttctgccatttctttctccttgat	Protospacer
*     ***********.********* **

294. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694525 (Marine virus AFVG_250M794, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
taatccttctgccatttctttctccttgat	Protospacer
*     ***********.********* **

295. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP007767 (Campylobacter peloridis LMG 23910 plasmid pPEL1, complete sequence) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
ctttacaaatgccatttttttctccttaat	Protospacer
.** *    ****************** **

296. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP013007 (Xanthomonas citri pv. malvacearum strain XcmN1003 plasmid pXcmN, complete sequence) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
gctacgttctgccatttttttcttactgat	Protospacer
 .** ******************. .* **

297. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_LR134418 (Legionella adelaidensis strain NCTC12735 genome assembly, plasmid: 9) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
catcatgtctgccattttactctcctttat	Protospacer
. * *  *********** .**********

298. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694503 (Marine virus AFVG_250M970, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
gtcattatctgccatctttttctccttttt	Protospacer
 *.*   ********.************ *

299. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to AX059140 (Sequence 1 from Patent WO0075335) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttaagttctttcatttttttctgaagttt	Protospacer
********** .***********    * *

300. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694657 (Marine virus AFVG_250M407, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tgtaagttctgctatttttttctttgatgt	Protospacer
* **********.**********..  *.*

301. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to KY653126 (Staphylococcus phage IME1354_01, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttaatttctgccatttttctctatctttc	Protospacer
***** *************.*** ..** .

302. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693377 (Marine virus AFVG_25M301, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggttgttctgccatttatttctcctattt	Protospacer
*    ************ ******** * *

303. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448729 (Streptococcus phage Javan31, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
attttcttctgccataattttctcctttag	Protospacer
 **   *********  ************

304. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693833 (Marine virus AFVG_250M459, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tgtaagttctgctatttttttctttgatgt	Protospacer
* **********.**********..  *.*

305. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448691 (Streptococcus phage Javan17, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
attttcttctgccataattttctcctttag	Protospacer
 **   *********  ************

306. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NC_004735 (Rhodothermus phage RM378, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tttaagttctttcatttttttctgaagttt	Protospacer
********** .***********    * *

307. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MH153807 (Rhodococcus phage Peregrin, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
taatggttctggcatttatttctcctttct	Protospacer
*   .****** ***** ********** *

308. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693079 (Marine virus AFVG_25M302, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
tggttgttctgccatttatttctcctattt	Protospacer
*    ************ ******** * *

309. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448948 (Streptococcus phage Javan46, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
attttcttctgccataattttctcctttag	Protospacer
 **   *********  ************

310. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448768 (Streptococcus phage Javan47, complete genome) position: , mismatch: 7, identity: 0.767

tttaagttctgccatttttttctcctttat	CRISPR spacer
attttcttctgccataattttctcctttag	Protospacer
 **   *********  ************

311. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP029455 (Bacillus cereus strain FORC087 plasmid pFORC087.1, complete sequence) position: , mismatch: 7, identity: 0.767

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattagaaaaacattattttttaattgtat	Protospacer
***** **************.***  *. .

312. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP044347 (Escherichia coli strain P225M plasmid pP225M-CTX-M-55, complete sequence) position: , mismatch: 7, identity: 0.767

tattataaaaacattattttctaaaggctc	CRISPR spacer
ttttataaaaacattattttatattaggtg	Protospacer
* ****************** **  .* *

313. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP039267 (Lactobacillus crispatus strain DC21.1 plasmid pLcDC21.1_1, complete sequence) position: , mismatch: 7, identity: 0.767

tattataaaaacattattttctaaaggctc	CRISPR spacer
taacttaataacattattttctaaagtatt	Protospacer
** . *** *****************  *.

314. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_MK461928 (Escherichia coli strain F2_14D plasmid pF2_14D_F, complete sequence) position: , mismatch: 7, identity: 0.767

tattataaaaacattatttt---ctaaaggctc	CRISPR spacer
ttttataaaaacattattttatattagggg---	Protospacer
* ******************   .**..**

315. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 7, identity: 0.767

tattataaaaacattattttctaaaggctc	CRISPR spacer
tttaataaaaaaattattttctaaaatatt	Protospacer
* * ******* *************.  *.

316. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 7, identity: 0.767

ttcatttgttgctaataatattaacttttc----	CRISPR spacer
ttcatttgatgctaataatatga----ctcaaaa	Protospacer
******** ************ *    .**

317. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN657062 (Psychrobacter sp. strain ANT_P27 plasmid pA27P2, complete sequence) position: , mismatch: 7, identity: 0.767

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttctacaattgctaataatattaacctttg	Protospacer
***  . .*****************.***

318. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP038620 (Arsenophonus nasoniae strain FIN plasmid pArsFIN8, complete sequence) position: , mismatch: 7, identity: 0.767

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tcagcaattcaatttaaatatagcaaaatt	Protospacer
* .  **  *********** *********

319. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MN694105 (Marine virus AFVG_250M210, complete genome) position: , mismatch: 7, identity: 0.767

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
caaaaaaaacaaattaaataaaacaaaaat	Protospacer
.*. .******* *********.***** *

320. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MN694723 (Marine virus AFVG_250M211, complete genome) position: , mismatch: 7, identity: 0.767

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
caaaaaaaacaaattaaataaaacaaaaat	Protospacer
.*. .******* *********.***** *

321. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP045608 (Bacillus cereus strain SB1 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
tgatgaaaacaaaataaataaagcaaaggt	Protospacer
*...********  *************. *

322. spacer 1.4|890486|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP030933 (Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence) position: , mismatch: 8, identity: 0.724

aatgattttaattttcatttgtatccttt	CRISPR spacer
tccaattttatttttcatttgtatcatcc	Protospacer
  ..****** ************** *..

323. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 8, identity: 0.724

ttaagttctgccatttttttctcctttat	CRISPR spacer
ataagttctgcaatttttttcttatcgga	Protospacer
 ********** **********. *. .

324. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN694579 (Marine virus AFVG_250M1138, complete genome) position: , mismatch: 8, identity: 0.724

ttaagttctgccatttttttctcctttat	CRISPR spacer
aatggaattgccattttttgctcctttat	Protospacer
   .*  .*********** *********

325. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693144 (Marine virus AFVG_25M372, complete genome) position: , mismatch: 8, identity: 0.724

ttaagttctgccatttttttctcctttat	CRISPR spacer
gctgttattgccatttttttctccttaat	Protospacer
 . . * .****************** **

326. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013682 (Clostridium botulinum strain 1169 plasmid pRSJ8_1, complete sequence) position: , mismatch: 8, identity: 0.724

attataaaaacattattttctaaaggctc	CRISPR spacer
tttataaaatcattattttctataattaa	Protospacer
 ******** ************ *. .

327. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to NZ_CP013295 (Clostridium botulinum strain CDC_54064 plasmid pNPD1_1, complete sequence) position: , mismatch: 8, identity: 0.724

attataaaaacattattttctaaaggctc	CRISPR spacer
tttataaaatcattattttctataattaa	Protospacer
 ******** ************ *. .

328. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to MN692973 (Marine virus AFVG_117M33, complete genome) position: , mismatch: 8, identity: 0.724

attataaaaacattattttctaaaggctc	CRISPR spacer
tctttaaatacattattttctaaagttgt	Protospacer
 .* **** **************** . .

329. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to KT997860 (Uncultured Mediterranean phage uvDeep-CGR2-KM19-C269, complete genome) position: , mismatch: 8, identity: 0.724

attataaaaacattattttctaaaggctc	CRISPR spacer
gatacaaaaacattatcttctaaagaact	Protospacer
. **.***********.********. ..

330. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to KY779848 (Staphylococcus phage qdsa001, complete genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

331. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to LC492751 (Staphylococcus phage KSAP7 genomic DNA, compelete genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

332. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to AP013516 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S29-C44) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
aaatttgttgctaataaaactaactccct	Protospacer
  *************** *.*****....

333. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to LC492752 (Staphylococcus phage KSAP11 genomic DNA, compelete genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

334. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to NC_022090 (Staphylococcus phage vB_SauM_Remus, complete genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

335. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to LC576631 (Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

336. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to MT080595 (UNVERIFIED: Staphylococcus phage vB_SauM_EW41, partial genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

337. spacer 1.12|891014|29|NZ_CP044164|CRISPRCasFinder matches to NC_020877 (Staphylococcus phage vB_SauM_Romulus, complete genome) position: , mismatch: 8, identity: 0.724

tcatttgttgctaataatattaacttttc	CRISPR spacer
tcatttgtagctaataatattgtaaatca	Protospacer
******** ************.    *.

338. spacer 1.13|891080|29|NZ_CP044164|CRISPRCasFinder matches to GU943077 (Uncultured phage MedDCM-OCT-S09-C5 genomic sequence) position: , mismatch: 8, identity: 0.724

tatttatgtggtgcaagtcaagttgaaac	CRISPR spacer
actttatctggtgcaagtcaatttgtttg	Protospacer
  ***** ************* ***

339. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to AP013513 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-C84-MedDCM-OCT-S32-C77) position: , mismatch: 8, identity: 0.724

actcatctttcaaatcaaatgctttatta	CRISPR spacer
ctacattttttaaatcaaatgctttaaat	Protospacer
 . ***.***.***************

340. spacer 1.14|891146|29|NZ_CP044164|CRISPRCasFinder matches to FJ429185 (Lactococcus phage P087, complete genome) position: , mismatch: 8, identity: 0.724

actcatctttcaaatcaaatgctttatta	CRISPR spacer
ctgaatcattcaaatcaaattctttatct	Protospacer
 .  *** ************ ******.

341. spacer 1.17|890485|30|NZ_CP044164|CRT matches to NZ_CP030933 (Enterococcus gilvus strain CR1 plasmid pCR1A, complete sequence) position: , mismatch: 8, identity: 0.733

taatgattttaattttcatttgtatccttt	CRISPR spacer
ttccaattttatttttcatttgtatcatcc	Protospacer
*  ..****** ************** *..

342. spacer 1.22|890815|30|NZ_CP044164|CRT,PILER-CR matches to MT774393 (CrAssphage cr127_1, complete genome) position: , mismatch: 8, identity: 0.733

tctataatattttttaactcgtaaaaatca	CRISPR spacer
gctataatattatttaattcgtaagttcct	Protospacer
 ********** *****.******.  .*

343. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_LR134399 (Listeria monocytogenes strain NCTC7974 plasmid 2, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
aaaaaggtttgccatttttttctcctccaa	Protospacer
   *** *.*****************..*

344. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP048287 (Paenibacillus sp. 14171R-81 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gctaagttctggcatttttttcaccccttg	Protospacer
 .********* ********** **..*

345. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP016746 (Lactococcus lactis subsp. cremoris strain JM1 plasmid pMPJM1, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
actgtcatctgccattttcttctcctttgt	Protospacer
 .*.   ***********.*********.*

346. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP013929 (Alteromonas mediterranea strain UM8 plasmid pAMEDUM8_300, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gattgtgtctgacatttttctctcctttat	Protospacer
  * .  **** *******.**********

347. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to CP013931 (Alteromonas mediterranea strain U10 plasmid pAMED10_300, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gattgtgtctgacatttttctctcctttat	Protospacer
  * .  **** *******.**********

348. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP031793 (Klebsiella pneumoniae strain INF116-sc-2279924 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
cctgagttgagccatttttttctccttatc	Protospacer
..*.****  *****************  .

349. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gattgtgtctgacatttttctctcctttat	Protospacer
  * .  **** *******.**********

350. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NC_019394 (Alteromonas mediterranea DE1 plasmid pAMDE1, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gattgtgtctgacatttttctctcctttat	Protospacer
  * .  **** *******.**********

351. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP018322 (Alteromonas macleodii strain Te101 plasmid pTE101a, complete sequence) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
gattgtgtctgacatttttctctcctttat	Protospacer
  * .  **** *******.**********

352. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MK448704 (Streptococcus phage Javan213, complete genome) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
ccaattatatgccatgtttttctcctttat	Protospacer
.. *   * ****** **************

353. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693300 (Marine virus AFVG_25M71, complete genome) position: , mismatch: 8, identity: 0.733

---tttaagttctgccatttttttctcctttat	CRISPR spacer
agcttc---ttctgccattttcttctccttggg	Protospacer
   **.   ************.******** .

354. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693144 (Marine virus AFVG_25M372, complete genome) position: , mismatch: 8, identity: 0.733

tttaagttctgccatttttttctcctttat	CRISPR spacer
tgctgttattgccatttttttctccttaat	Protospacer
* . . * .****************** **

355. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693380 (Marine virus AFVG_25M72, complete genome) position: , mismatch: 8, identity: 0.733

---tttaagttctgccatttttttctcctttat	CRISPR spacer
agcttc---ttctgccattttcttctccttggg	Protospacer
   **.   ************.******** .

356. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NC_015907 (Borreliella bissettii DN127 plasmid cp26, complete sequence) position: , mismatch: 8, identity: 0.733

tattataaaaacattattttctaaaggctc	CRISPR spacer
agttataattacattattttctaaaaattg	Protospacer
 .******  ***************...*

357. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to AP013521 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S42-C60) position: , mismatch: 8, identity: 0.733

tattataaaaacattattttctaaaggctc	CRISPR spacer
agatacaaaaacattatcttctaaagaatt	Protospacer
 . **.***********.********. *.

358. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MH552525 (Siphoviridae sp. isolate ctbc8, complete genome) position: , mismatch: 8, identity: 0.733

tattataaaaacattattttctaaaggctc	CRISPR spacer
agatataaaaccattattttctaatgcata	Protospacer
 . ******* ************* *  *

359. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MT774385 (CrAssphage cr108_1, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
aagatttattgctaataatattcacttgaa	Protospacer
   ****.************** ****

360. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to KY779848 (Staphylococcus phage qdsa001, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

361. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to LC492751 (Staphylococcus phage KSAP7 genomic DNA, compelete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

362. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to LC492752 (Staphylococcus phage KSAP11 genomic DNA, compelete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

363. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to NC_022090 (Staphylococcus phage vB_SauM_Remus, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

364. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to LC576631 (Staphylococcus phage vB_SauH_DELF3 DNA, complete sequence) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

365. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MT080595 (UNVERIFIED: Staphylococcus phage vB_SauM_EW41, partial genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

366. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to NC_020877 (Staphylococcus phage vB_SauM_Romulus, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
ttcatttgtagctaataatattgtaaatca	Protospacer
********* ************.    *.

367. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN694016 (Marine virus AFVG_250M811, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
gtttattgttgctaataatggtaactttgg	Protospacer
 *.  **************. *******

368. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to AP013516 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-U-MedDCM-OCT-S29-C44) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
taaatttgttgctaataaaactaactccct	Protospacer
*  *************** *.*****....

369. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN693800 (Marine virus AFVG_250M813, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
gtttattgttgctaataatggtaactttgg	Protospacer
 *.  **************. *******

370. spacer 1.25|891013|30|NZ_CP044164|CRT,PILER-CR matches to MN694554 (Marine virus AFVG_250M812, complete genome) position: , mismatch: 8, identity: 0.733

ttcatttgttgctaataatattaacttttc	CRISPR spacer
gtttattgttgctaataatggtaactttgg	Protospacer
 *.  **************. *******

371. spacer 1.27|891145|30|NZ_CP044164|CRT matches to MG029511 (Staphylococcus phage phiSa2wa_st30, complete genome) position: , mismatch: 8, identity: 0.733

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
atcaagttattcaaatctaatgctttatta	Protospacer
  *  .*. ******** ************

372. spacer 1.27|891145|30|NZ_CP044164|CRT matches to MN856071 (Myoviridae sp. isolate 215, complete genome) position: , mismatch: 8, identity: 0.733

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
acagcatcttttaaagcaaatgctttactc	Protospacer
    *******.*** ***********.*

373. spacer 1.27|891145|30|NZ_CP044164|CRT matches to FJ429185 (Lactococcus phage P087, complete genome) position: , mismatch: 8, identity: 0.733

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
tctgaatcattcaaatcaaattctttatct	Protospacer
* .  *** ************ ******.

374. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP015011 (Rickettsia bellii isolate An04 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gattaaaaacaaattaaataaagcaaatga	Protospacer
 * ..******* **************

375. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP032196 (Klebsiella pneumoniae strain AR_0097 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aaagccaatcaatttaaataaaggaaaata	Protospacer
 *.   ** ************** *****

376. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP027615 (Klebsiella pneumoniae subsp. ozaenae strain AR_0096 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
aaagccaatcaatttaaataaaggaaaata	Protospacer
 *.   ** ************** *****

377. spacer 1.28|891211|30|NZ_CP044164|CRT matches to MN694259 (Marine virus AFVG_250M30, complete genome) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
agaagggaacaatttaaatacagcaagatt	Protospacer
 .. *..************* *****.***

378. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP034172 (Chryseobacterium taklimakanense strain H4753 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
cggttcaaaaaatttacataaagcaaaatc	Protospacer
..*.  *** ****** ************.

379. spacer 1.28|891211|30|NZ_CP044164|CRT matches to NZ_CP017464 (Staphylococcus pasteuri strain JS7 plasmid pSNJS701, complete sequence) position: , mismatch: 8, identity: 0.733

tagcgaaaacaatttaaataaagcaaaatt	CRISPR spacer
gacacaaaacaatttaaataacgtaaaaac	Protospacer
 *   **************** *.**** .

380. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693285 (Marine virus AFVG_25M368, complete genome) position: , mismatch: 9, identity: 0.69

ttaagttctgccatttttttctcctttat	CRISPR spacer
gcttgttctgccattattttctcctaggg	Protospacer
 .  *********** *********  .

381. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693300 (Marine virus AFVG_25M71, complete genome) position: , mismatch: 9, identity: 0.69

ttaagttctgccatttttttctcctttat	CRISPR spacer
gcttcttctgccattttcttctccttggg	Protospacer
 .   ************.******** .

382. spacer 1.10|890882|29|NZ_CP044164|CRISPRCasFinder matches to MN693380 (Marine virus AFVG_25M72, complete genome) position: , mismatch: 9, identity: 0.69

ttaagttctgccatttttttctcctttat	CRISPR spacer
gcttcttctgccattttcttctccttggg	Protospacer
 .   ************.******** .

383. spacer 1.11|890948|29|NZ_CP044164|CRISPRCasFinder matches to MN693197 (Marine virus AFVG_25M502, complete genome) position: , mismatch: 9, identity: 0.69

attataaaaacattattttctaaaggctc	CRISPR spacer
tggttaaaaactttattttctaaagaaga	Protospacer
    ******* *************.

384. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP022523 (Pseudoalteromonas sp. NC201 plasmid pNC201, complete sequence) position: , mismatch: 9, identity: 0.7

tttaagttctgccatttttttctcctttat	CRISPR spacer
aataagttctgcaatttttttcttatcgga	Protospacer
  ********** **********. *. .

385. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN694579 (Marine virus AFVG_250M1138, complete genome) position: , mismatch: 9, identity: 0.7

tttaagttctgccatttttttctcctttat	CRISPR spacer
gaatggaattgccattttttgctcctttat	Protospacer
    .*  .*********** *********

386. spacer 1.23|890881|30|NZ_CP044164|CRT,PILER-CR matches to MN693285 (Marine virus AFVG_25M368, complete genome) position: , mismatch: 9, identity: 0.7

tttaagttctgccatttttttctcctttat	CRISPR spacer
tgcttgttctgccattattttctcctaggg	Protospacer
* .  *********** *********  .

387. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP013682 (Clostridium botulinum strain 1169 plasmid pRSJ8_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
atttataaaatcattattttctataattaa	Protospacer
  ******** ************ *. .

388. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NZ_CP013295 (Clostridium botulinum strain CDC_54064 plasmid pNPD1_1, complete sequence) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
atttataaaatcattattttctataattaa	Protospacer
  ******** ************ *. .

389. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MK809530 (Salmonella phage vB_SenS_SB6, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

390. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MN692973 (Marine virus AFVG_117M33, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
atctttaaatacattattttctaaagttgt	Protospacer
  .* **** **************** . .

391. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431738 (Bacteriophage T5-like poul149, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

392. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431738 (Bacteriophage T5-like poul149, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

393. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MK972709 (Salmonella phage SE20, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

394. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431736 (Bacteriophage T5-like chee130_1, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

395. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431736 (Bacteriophage T5-like chee130_1, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

396. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MT074463 (Salmonella phage gmork, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

397. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431737 (Bacteriophage T5-like saus132, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

398. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431737 (Bacteriophage T5-like saus132, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

399. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MK972707 (Salmonella phage SE24, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

400. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431739 (Bacteriophage T5-like chee158, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

401. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431739 (Bacteriophage T5-like chee158, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

402. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MT074457 (Salmonella phage rokbiter, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

403. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MH370386 (Salmonella phage S147, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

404. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431740 (Bacteriophage T5-like cott162, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

405. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431740 (Bacteriophage T5-like cott162, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

406. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431741 (Bacteriophage T5-like saus176N, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

407. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MF431741 (Bacteriophage T5-like saus176N, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

408. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to CP000917 (Enterobacteria phage EPS7, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

409. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MT074452 (Salmonella phage vaffelhjerte, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

410. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MT074453 (Salmonella phage misterkot, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

411. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MK972704 (Salmonella phage SE19, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

412. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to NC_048867 (Salmonella phage faergetype, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
tattatgaaaactttattttctattttgct	Protospacer
******.***** **********     ..

413. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to KT997860 (Uncultured Mediterranean phage uvDeep-CGR2-KM19-C269, complete genome) position: , mismatch: 9, identity: 0.7

tattataaaaacattattttctaaaggctc	CRISPR spacer
agatacaaaaacattatcttctaaagaact	Protospacer
 . **.***********.********. ..

414. spacer 1.26|891079|30|NZ_CP044164|CRT,PILER-CR matches to GU943077 (Uncultured phage MedDCM-OCT-S09-C5 genomic sequence) position: , mismatch: 9, identity: 0.7

ctatttatgtggtgcaagtcaagttgaaac	CRISPR spacer
tactttatctggtgcaagtcaatttgtttg	Protospacer
.  ***** ************* ***

415. spacer 1.27|891145|30|NZ_CP044164|CRT matches to AP013513 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G21, isolate: uvMED-CGR-C84-MedDCM-OCT-S32-C77) position: , mismatch: 9, identity: 0.7

tactcatctttcaaatcaaatgctttatta	CRISPR spacer
gctacattttttaaatcaaatgctttaaat	Protospacer
  . ***.***.***************

416. spacer 1.24|890947|30|NZ_CP044164|CRT,PILER-CR matches to MN693197 (Marine virus AFVG_25M502, complete genome) position: , mismatch: 10, identity: 0.667

tattataaaaacattattttctaaaggctc	CRISPR spacer
ctggttaaaaactttattttctaaagaaga	Protospacer
.    ******* *************.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1014924 : 1061808

Campylobacter_phage(55.17%)

tRNA,integrase,tail,transposase,plate,terminase

attL 1030630:1030650|attR 1062264:1062284

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002798038.1\|1014924_1016349_-	catalase	A0A2K9L0T1	Tupanvirus	1.2e-92	38.0
WP_002777843.1\|1016535_1016853_+	DUF2325 domain-containing protein	NA	NA	NA	NA
WP_002783868.1\|1016852_1017548_+	hypothetical protein	NA	NA	NA	NA
WP_002777839.1\|1017547_1018039_+	flavodoxin FldA	NA	NA	NA	NA
WP_019109136.1\|1018846_1019200_-	hypothetical protein	NA	NA	NA	NA
WP_019109137.1\|1019203_1019518_-	hypothetical protein	J9SP73	Campylobacter_phage	8.3e-52	98.1
WP_044260196.1\|1019514_1020498_-	hypothetical protein	NA	NA	NA	NA
WP_151014812.1\|1020848_1021478_+	S24 family peptidase	A7YG70	Campylobacter_phage	1.1e-58	96.5
WP_002865000.1\|1021558_1021879_+	hypothetical protein	A7YGI4	Campylobacter_phage	1.3e-52	100.0
WP_002843339.1\|1021888_1022083_+	hypothetical protein	A7YG72	Campylobacter_phage	1.8e-28	100.0
WP_002865289.1\|1022162_1022450_+	hypothetical protein	A7YGG4	Campylobacter_phage	1.9e-47	100.0
WP_002872726.1\|1022477_1023293_-	DNA adenine methylase	A7YGG5	Campylobacter_phage	2.4e-151	99.6
WP_107701867.1\|1023397_1023886_-	virion morphogenesis protein	A7YG96	Campylobacter_phage	7.7e-89	99.4
WP_151014815.1\|1023889_1026223_-\|tail	phage tail tape measure protein	A7YGE8	Campylobacter_phage	0.0e+00	89.6
WP_002791365.1\|1026264_1026570_+	hypothetical protein	A7YG88	Campylobacter_phage	1.9e-32	90.1
WP_002791367.1\|1026681_1026921_-\|tail	phage tail assembly protein	A7YG75	Campylobacter_phage	1.5e-08	89.9
WP_002794205.1\|1027024_1027534_-\|tail	tail protein	A7YGZ4	Campylobacter_phage	5.6e-90	99.4
WP_002784660.1\|1027557_1028751_-\|tail	phage tail sheath family protein	A7YGY2	Campylobacter_phage	8.2e-201	99.5
WP_002784662.1\|1028761_1029775_-	hypothetical protein	A7YGY4	Campylobacter_phage	6.1e-189	98.2
WP_002784664.1\|1029771_1030158_-	DUF1353 domain-containing protein	A7YGM3	Campylobacter_phage	4.6e-60	87.6
WP_002784666.1\|1030150_1031908_-	radical SAM protein	NA	NA	NA	NA
1030630:1030650	attL	NA	NA	NA	NA
WP_002784668.1\|1031907_1032543_-	hypothetical protein	NA	NA	NA	NA
WP_151014818.1\|1032552_1033575_-\|tail	phage tail protein	A7YGA7	Campylobacter_phage	2.6e-78	88.8
WP_002784479.1\|1033574_1034195_-\|tail	phage tail protein I	A7YGG0	Campylobacter_phage	2.2e-56	94.0
WP_057037189.1\|1034191_1035358_-\|plate	baseplate assembly protein	Q8H9N3	Vibrio_phage	2.0e-13	24.1
WP_057037190.1\|1035354_1035645_-\|plate	baseplate assembly protein	Q8H9N4	Vibrio_phage	6.1e-09	39.0
WP_038840900.1\|1035641_1035854_-	hypothetical protein	NA	NA	NA	NA
WP_057037191.1\|1035853_1036351_-\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	4.3e-10	35.8
WP_038840904.1\|1036350_1036665_-	hypothetical protein	NA	NA	NA	NA
WP_057037192.1\|1036776_1037010_-	hypothetical protein	NA	NA	NA	NA
WP_057037193.1\|1037006_1037342_-	hypothetical protein	NA	NA	NA	NA
WP_057037194.1\|1037351_1037741_-	DUF882 domain-containing protein	A0A1X9Q0V8	Human_gokushovirus	1.2e-23	49.6
WP_057037195.1\|1037890_1038325_+	hypothetical protein	NA	NA	NA	NA
WP_057037196.1\|1038328_1039153_+	hypothetical protein	A0A2H4JAW3	uncultured_Caudovirales_phage	3.0e-24	45.9
WP_057037290.1\|1039154_1039652_+	hypothetical protein	NA	NA	NA	NA
WP_057037199.1\|1039655_1040633_+	hypothetical protein	R9TRN2	Rhizobium_phage	6.2e-05	23.9
WP_002784509.1\|1040747_1041206_+	DUF1320 domain-containing protein	NA	NA	NA	NA
WP_057037200.1\|1041198_1041681_+	DUF1804 family protein	NA	NA	NA	NA
WP_057037201.1\|1041680_1043351_+\|terminase	phage terminase large subunit	A0A0A1IW02	Pseudomonas_phage	2.0e-91	41.5
WP_057037202.1\|1043360_1044731_+	DUF935 family protein	A0A2H4JHL1	uncultured_Caudovirales_phage	1.3e-16	26.1
WP_057037203.1\|1044732_1045974_+	hypothetical protein	M4M9M5	Vibrio_phage	7.4e-19	29.3
WP_057037204.1\|1046105_1046480_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002791401.1\|1046472_1046664_+\|tail	tail protein	NA	NA	NA	NA
WP_057037206.1\|1047611_1048148_-	hypothetical protein	NA	NA	NA	NA
WP_032685771.1\|1048140_1048371_-	hypothetical protein	NA	NA	NA	NA
WP_032592001.1\|1048537_1048822_-	DNA-binding protein	NA	NA	NA	NA
WP_151014821.1\|1049268_1049718_-	DUF1018 domain-containing protein	NA	NA	NA	NA
WP_002784531.1\|1050405_1050675_-	hypothetical protein	NA	NA	NA	NA
WP_057037207.1\|1050671_1051634_-	hypothetical protein	NA	NA	NA	NA
WP_038840058.1\|1051694_1052180_-	host-nuclease inhibitor protein Gam	A0A2K9VGT9	Faecalibacterium_phage	2.7e-17	33.3
WP_057037208.1\|1052180_1052378_-	hypothetical protein	NA	NA	NA	NA
WP_057037209.1\|1052374_1052713_-	hypothetical protein	NA	NA	NA	NA
WP_002784541.1\|1052914_1053100_-	hypothetical protein	NA	NA	NA	NA
WP_002793918.1\|1053096_1053288_-	DNA-directed RNA polymerase sigma-70 factor	NA	NA	NA	NA
WP_057037210.1\|1053291_1054215_-	AAA family ATPase	A0A2H4JAW1	uncultured_Caudovirales_phage	7.9e-10	24.8
WP_057037211.1\|1054297_1056370_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_002784549.1\|1056370_1056571_-	hypothetical protein	NA	NA	NA	NA
WP_002784551.1\|1056722_1057370_+	transcriptional regulator	M5A9D2	Nitratiruptor_phage	2.0e-23	45.2
WP_057037212.1\|1057385_1058093_+	hypothetical protein	NA	NA	NA	NA
WP_151014825.1\|1058151_1058751_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_002777832.1\|1060485_1061808_+\|tRNA	L-seryl-tRNA(Sec) selenium transferase	NA	NA	NA	NA
1062264:1062284	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage