CRISPRimmunity

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044171	Campylobacter jejuni strain AR-0413 chromosome, complete genome	2 crisprs	cas1,csa3,DEDDh,WYL	0	13	0	0
NZ_CP044172	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-2	0 crisprs	NA	0	0	0	0
NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	2 crisprs	NA	0	3	0	1

1. NZ_CP044171

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044171_1

• CRISPR_ID: NZ_CP044171_1
• CRISPR_location: 284397-284476
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NZ_CP044171_1

Consensus_repeat	Method
TCTTTTTGTTCTTTTAAAGCTTC	CRISPRCasFinder

spacers of NZ_CP044171_1

>1.1|284420|34|NZ_CP044171|CRISPRCasFinder
TTTTTTAGCTTTATACTCAGCCTTACTCATATAA

CRISPR arrays and Neighbor proteins around NZ_CP044171_1

CRISPR arrays

The CRISPR arrays of NZ_CP044171_1

>merge|NZ_CP044171|1|284397-284476|CRISPRCasFinder
TCTTTTTGTTCTTTTAAAGCTTCTTTTTTAGCTTTATACTCAGCCTTACTCATATAATCTTTTTGTTCTTTTAAAGCATC

>NZ_CP044171|1|1|284397-284476|CRISPRCasFinder
TCTTTTTGTTCTTTTAAAGCTTC	TTTTTTAGCTTTATACTCAGCCTTACTCATATAA
TCTTTTTGTTCTTTTAAAGCATC

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044171.1|WP_014517095.1|290123_291308_-|capsule-polysaccharide-modification-protein-KpsS	unknown	unknown	gnl|CDD|226092
NZ_CP044171.1|WP_014517089.1|278167_279661_-|hydrogenase-small-subunit	unknown	unknown	gnl|CDD|224654
NZ_CP044171.1|WP_002880391.1|287155_287575_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044171.1|WP_014517094.1|288929_290051_-|membrane-protein	unknown	unknown	unknown
NZ_CP044171.1|WP_057098379.1|284778_286149_-|phosphoglucosamine-mutase-PgmL	unknown	unknown	gnl|CDD|100091
NZ_CP044171.1|WP_002783833.1|281160_282363_-|phosphoglycerate-kinase	unknown	unknown	gnl|CDD|234613
NZ_CP044171.1|WP_002825806.1|286807_287155_+|holo-ACP-synthase	unknown	unknown	gnl|CDD|223807
NZ_CP044171.1|WP_002877378.1|282365_283364_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl|CDD|223135
NZ_CP044171.1|WP_002877376.1|279664_280489_-|enoyl-ACP-reductase-FabI	unknown	unknown	gnl|CDD|181416
NZ_CP044171.1|WP_014517098.1|292622_293114_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044171.1|WP_002855429.1|286271_286808_+|flagellar-basal-body-associated-protein-FliL	unknown	unknown	gnl|CDD|181433
NZ_CP044171.1|WP_014517097.1|292434_292665_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044171.1|WP_014517090.1|280492_281164_-|triose-phosphate-isomerase	unknown	unknown	gnl|CDD|234589
NZ_CP044171.1|WP_002877372.1|276329_278171_+|ferrous-iron-transport-protein-B	unknown	unknown	gnl|CDD|223447
NZ_CP044171.1|WP_002779147.1|276108_276333_+|ferrous-iron-transport-protein-A	unknown	unknown	gnl|CDD|224830
NZ_CP044171.1|WP_139865077.1|291304_292420_-|capsular-polysaccharide-biosynthesis-protein	unknown	unknown	gnl|CDD|226093
NZ_CP044171.1|WP_014517093.1|287571_288933_-|cytochrome-P450	unknown	unknown	gnl|CDD|225035
NZ_CP044171.1|WP_002855339.1|283996_284323_+|ribosome-silencing-factor	unknown	unknown	gnl|CDD|223870
NZ_CP044171.1|WP_002866694.1|274686_276027_+|MmgE/PrpD-family-protein	unknown	unknown	gnl|CDD|377179
NZ_CP044171.1|WP_014517091.1|283423_283969_+|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	unknown	unknown	gnl|CDD|223985

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP044171.1|WP_014517095.1|290123_291308_-|capsule-polysaccharide-modification-protein-KpsS	gnl|CDD|226092	COG3562, KpsS, Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane].	0
NZ_CP044171.1|WP_014517089.1|278167_279661_-|hydrogenase-small-subunit	gnl|CDD|224654	COG1740, HyaA, Ni,Fe-hydrogenase I small subunit [Energy production and conversion].	7.23056e-155
NZ_CP044171.1|WP_057098379.1|284778_286149_-|phosphoglucosamine-mutase-PgmL	gnl|CDD|100091	cd03089, PMM_PGM, The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a bisphosphorylated sugar intermediate. The reaction involves two phosphoryl transfers, with an intervening 180 degree reorientation of the reaction intermediate during catalysis. Reorientation of the intermediate occurs without dissociation from the active site of the enzyme and is thus, a simple example of processivity, as defined by multiple rounds of catalysis without release of substrate. Glucose-6-phosphate and glucose-1-phosphate are known to be utilized for energy metabolism and cell surface construction, respectively. PMM/PGM belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the phosphoglucomutases (PGM1 and PGM2). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP044171.1|WP_002783833.1|281160_282363_-|phosphoglycerate-kinase	gnl|CDD|234613	PRK00073, pgk, phosphoglycerate kinase; Provisional.	0
NZ_CP044171.1|WP_002825806.1|286807_287155_+|holo-ACP-synthase	gnl|CDD|223807	COG0736, AcpS, Phosphopantetheinyl transferase (holo-ACP synthase) [Lipid metabolism].	3.71491e-40
NZ_CP044171.1|WP_002877378.1|282365_283364_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase	gnl|CDD|223135	COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism].	3.35917e-168
NZ_CP044171.1|WP_002877376.1|279664_280489_-|enoyl-ACP-reductase-FabI	gnl|CDD|181416	PRK08415, PRK08415, enoyl-[acyl-carrier-protein] reductase FabI.	0
NZ_CP044171.1|WP_002855429.1|286271_286808_+|flagellar-basal-body-associated-protein-FliL	gnl|CDD|181433	PRK08455, fliL, flagellar basal body-associated protein FliL; Reviewed.	2.19231e-91
NZ_CP044171.1|WP_014517090.1|280492_281164_-|triose-phosphate-isomerase	gnl|CDD|234589	PRK00042, tpiA, triosephosphate isomerase; Provisional.	9.337e-86
NZ_CP044171.1|WP_002877372.1|276329_278171_+|ferrous-iron-transport-protein-B	gnl|CDD|223447	COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism].	0
NZ_CP044171.1|WP_002779147.1|276108_276333_+|ferrous-iron-transport-protein-A	gnl|CDD|224830	COG1918, FeoA, Fe2+ transport system protein A [Inorganic ion transport and metabolism].	1.69416e-22
NZ_CP044171.1|WP_139865077.1|291304_292420_-|capsular-polysaccharide-biosynthesis-protein	gnl|CDD|226093	COG3563, KpsC, Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane].	4.31995e-177
NZ_CP044171.1|WP_014517093.1|287571_288933_-|cytochrome-P450	gnl|CDD|225035	COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism].	1.78086e-78
NZ_CP044171.1|WP_002855339.1|283996_284323_+|ribosome-silencing-factor	gnl|CDD|223870	COG0799, COG0799, Uncharacterized homolog of plant Iojap protein [Function unknown].	8.97235e-38
NZ_CP044171.1|WP_002866694.1|274686_276027_+|MmgE/PrpD-family-protein	gnl|CDD|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	1.58203e-117
NZ_CP044171.1|WP_014517091.1|283423_283969_+|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase	gnl|CDD|223985	COG1057, NadD, Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism].	5.6485e-57

Protein sequences

>NZ_CP044171.1|WP_002855339.1|283996_284323_+|ribosome-silencing-factor
MQERIDLIVKILDEKKAEDIKTIDMSEQEYFVKYVIIAATLGERHALSLIDELKTQLKAKGEEFLNIDSSEEWSVIDLGDILIHLLTPEHRGIYNIEELLENLKKGRV
>NZ_CP044171.1|WP_014517091.1|283423_283969_+|nicotinate-(nicotinamide)-nucleotide-adenylyltransferase
MKIALFGGSFDPPHNGHNSVVLEALEKLDIDKLIIMPTYINPFKQNFSADEKQRFLWVKKLWGHFPKVEICDFETKQKRPVPSIESVKYLYKLYNPSKFYLLIGADHLEKLHLWHDFEKLNSLVEFVIANRNDIEIPKNFKDLKTDKKIASSFIRNTLNINEVCEEIKDEVKKYYEKLQKN
>NZ_CP044171.1|WP_002877378.1|282365_283364_-|type-I-glyceraldehyde-3-phosphate-dehydrogenase
MAVKVAINGFGRIGRCVARIILERNDIELVAINDTTDIELTKYLFKYDTVHGEFKGSVDSEGDDLVVNGKKIKVFKSRNVKDLDFAKHGAQIVLECTGAHLTMAKCQEFIDMGVQKVIMSAPAKDDTPTYVLGVNSELYKGESIISNASCTTNCLGPVCRVLQDNFGIEKGLMTTIHAYTNGQSIIDAKAKDKRRSRAAAQNIIPTSTGAAKAMKLVMPELNGKLHGQSMRVPVIDVSSVDLTAQLSRKVSKDEINEAFRKAATTNLKGILMVDDEERVSSDFITCSYGAIVASDLTQVIADDFIKVIAWYDNEWGYSSRLVDMAVYIANKA
>NZ_CP044171.1|WP_002783833.1|281160_282363_-|phosphoglycerate-kinase
MSDIISIKDIDLAKKKVFIRCDFNVPQDDFLNITDDRRIRSAIPTIRYCLDNGCSVILASHLGRPKEISSKYSLEPVAKRLARLLDKEIIMAKDVIGEDAKTKAMNLKAGEILLLENLRFEKGETKNDENLAKELASMVQVYINDAFGVCHRAHSSVEAITKFFDEKHKGAGFLLQKEIDFASNLIKHPARPFVAVVGGSKVSGKLQALTNLLPKVDKLIIGGGMAFTFLKALGYDIGNSLLEEELLEEANKILTKGKNLGVKIYLPVDVVAAPACSQDAPMKFVPAQEIPNGWMGLDIGPASVRLFKEVISDAQTIWWNGPMGVFEIDKFSKGSIKMSHYISEGHATSVVGGGDTADVVARAGDADEMTFISTGGGASLELIEGKELPGVKALRSKENE
>NZ_CP044171.1|WP_014517090.1|280492_281164_-|triose-phosphate-isomerase
MIFAANLKCNHTRASFKIYAEILNKTMGAKCDDIIVFPPSVAFLENENNFIQGAQNFYPCVNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENLDTKNSGKTLEFLKKQLEVIDLNYEKLIIAYEPIYSIGTGVSAQATDIAKVLEFLASLTKAPLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
>NZ_CP044171.1|WP_002877376.1|279664_280489_-|enoyl-ACP-reductase-FabI
MIMKGKKGLIVGVANNKSIAYGIAKACFDQGAELAFTFLNDALKKRVEPIAQEFNSNFVYELDVNNNEHLDSIAEKIKKDLGEIDFVVHAVAFAPKEALENSFLETSKEAFDIAMQTSVYSLLSLTRAVLPILKDKGSILTLSYLGGVKYVPHYNVMGVAKAALESSVRYLARDLGVKGIRVNAISAGPIKTLAASGIGDFRMILKYNEINSPLKRNVSIEDVGNSAMYLLSDLANGVTGEVHYVDAGYNIMGMGDVEKNEEGQTVLCWDNQKG
>NZ_CP044171.1|WP_014517089.1|278167_279661_-|hydrogenase-small-subunit
MTKLSNEELKNILEGRIKKLENSILKEDKVVNEESVKILAKHLSLGNEIPALAQRFFQIAPKTKLVWLHLCECTGCSESLLRSELPSFDELIFDFFSLEYHETLMAANGTKAEELLEHVLEEDFILAVEGGVAAIDTFFLTIGAQGESGYEILEKLAAKAKAIFAVGTCSSYGGIQAAYPNPSKTCGISEVLSQKVVNIPGCPPSDINIIATLSFFALFGVLPELDEQNRPVWAYGKCLHDMCERKAKFESGIFAEHFDDEAAKNGACLFKVGCKGPYTYNNCPKVKFNAKTSWPVAAGHGCIACSEKNFWDEFGNYEKPMANIFSYAKLCNEELKQEFFLEEQIKILEQIDFEFESNIKLILQNIAKNKLGALLVENYKKSFEKNYAFIEQNFDENPMPSKDFWKYLEISFILVKGAFLKDKNDFLIAAKNYAFKHASPYDFKLNMNAEKPKLDVSKSFRMTLIYLCGGLDFEGVAYSILKAFEDNIAKISSLKAS
>NZ_CP044171.1|WP_002877372.1|276329_278171_+|ferrous-iron-transport-protein-B
MKKIKIALVGQPNVGKSLLINALCKANMKVGNFSGVTIEKASAKTFYKNYEFEVIDLPGTYSLDGYSEEEKITRHFLNQNDYDVIVNVLDATNLERNLILSAELLSLNKKMLLALNMCDEAKKEGIELDTSVLSQEFQSQVVEISAKTKENLELLLQKIIILFESKFIPRSQFYTPLCEKSPEKEDLLYFINELSKKIITHKKEERNLTKKIDALLIHKFFGLPIFLFLMWLLFQLTFSLGQIPMDYIESGFNTLGEFVKNNISNTFIASALADGIIAGVGAVILFLPNIMILFLGIALLETTGYMSRVAFLLDGILHKFGLHGKSFIPLITGFGCSVPAFMATRTLKNKRDRLLTLFVINFMSCGARLPVYVLFIGAFFPSEKAGNYLFGIYILGAILGLCAAKFLRMTAFRGLDEPFVMEMPKYRMPNWHLVWFMVYNKAKMYLKKAGTFILLASLLIWFASNFPKSEENLNDFNAQERAIEQSYLGQFGKGIEPIFKPLELDWKLSVSLISGLAAKEVMISTMGVLYSLGKDVDETNNDLKGIIAKNIPIPSAVAFILFVMIYNPCFAATIVFSKESGKLKYTLFLFLFTCTSAYIVAFIGLYIAKILLN
>NZ_CP044171.1|WP_002779147.1|276108_276333_+|ferrous-iron-transport-protein-A
MTLNELKDGQKAIIVNLNAHKELKNRLLSFGFIKNKNLKKIHSSLKNATIMVELDTSCVILRSDEAKTIEVNLI
>NZ_CP044171.1|WP_002866694.1|274686_276027_+|MmgE/PrpD-family-protein
MFYSEILADFIFNLKYENIPNTVVQRAKELMLDSLGTAIAASKEECVLNAFKAFENLSTDKNTPIWVNDQKLVPIYAAMLDGIASHALDFDDTHTEAILHASAILTPLCLSYGFHVNKDAKKIIKAFIVGWEIAARVGIASKGTFHKRGFHTTAIAGIFGSVSASAILLDLNKEQIINALGLAGSFASGVNEFLSNGSNSKVLHIANAIKNGIMVAHFAKNNMSGPLSIFEGRDNIFKCFGIEEECDKTELSKALGEIWQTMQVSIKPYPSCHFAHGLIDCAIALKNDGLKADEIKSIHCFVDEVPISFICDPLEAKYTPNSAYEAKFSMPFLMALGFFDGKITLDSYENLKREEVLEFAKKISYEKRKSQGFPKYFPGHLEASLQDGRIIQKDVFINKGNFDNPLSFEELKAKFLANAQIYLDNAKANKILDQIINLENLNHFSF
>NZ_CP044171.1|WP_057098379.1|284778_286149_-|phosphoglucosamine-mutase-PgmL
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYLVSGLNKAGIKIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFFGEELKEFSKEVYKHLDDEIEENLEVEKYDILSLYVKFMCEQFSFLKDFNYKFGVDCTNGAAGVVIKPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFDGDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGHSNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIKALPKLYTTPEIKIHVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNTSPYLITRFEATSLERAKELESMVFSLFNEIKARLKN
>NZ_CP044171.1|WP_002855429.1|286271_286808_+|flagellar-basal-body-associated-protein-FliL
MDEELENEETKKKKGGSLVIIIVILLFVLLLSIMGVIAWLISSSSSDESEVKEAPKEEAKADKPKVSAPTQRGSDFANIGPMYPLDPFTLNLLSDSGSRYVKCTIELEQNSELLKPELDKKVPVIRDIIIRTLTAKTFEEVSTQKGKERLKDELVGKINEILTDGFIKNVYFTDFVVS
>NZ_CP044171.1|WP_002825806.1|286807_287155_+|holo-ACP-synthase
MRVGCDIIAISRIEKIHSRHGKNFLDKFLSPKEQILIKNPATLAGLWAAKEAASKALGVGICELCSFFDIEISKDEKNAPKLKYSQKITKDFNITQTSLSISHDNGFAIAIVAIV
>NZ_CP044171.1|WP_002880391.1|287155_287575_-|hypothetical-protein
MKRVRVKIRANFRRRVKRTLKGSLKEKLAGTILLCAIVPLAVLGYLFIVIIGTFFNTARARQGVRALDHFVNASLFNGYAWESVSSHAWRERNRKKWARIVIKITDFFQKDHCKRANKREQPVVDFILSRNLDKQTIGK
>NZ_CP044171.1|WP_014517093.1|287571_288933_-|cytochrome-P450
MSECPFFPKPYKNKASTLLTFLLKRRSWLDGLYERSYKMQTGYVKMPNFDLYVINDTKEVKRMMVDEVREFPKSAFLHELLSPLLGESIFTTNGEVWKKQRELLRPSFEMTRINKVFNLMSEAVADMMDRFSKYPNHAVIEVDEAMTFITADVIFRTIMSSKLDEGKGKKILNAFVTFQEQSVHTAMRRMFRFPKWLSYVLGDRKRTKAGDVIRQVLSDIIKPRYDMADNAEFEDILGSLLLVVDADTNKRFSFEEILDQVAMLFLAGHETTASSLTWTLYLLSLYPKEQEKAYEEITQVLQGGAIEISHLRQFKYLTNIFKESLRLYPPVGFFAREAKKDTQVRDKLIKKGSGVVIAPWLIHRHEEFWTNPHGFNPSRFEGEYKKDAYLPFGVGERICIGQGFAMQEAILILANILKTYKLELEEGFVPDVVGRLTVRSANGMRIKFSKRKL
>NZ_CP044171.1|WP_014517094.1|288929_290051_-|membrane-protein
MDREVFYIAGYDPKSYRFYYDLFKKNLKDYSHAFNIKTDLSKIEKNEQFPFFQISCEGVQTKYHFLTWNDIVKKNWSENYKDALADCYSFFRIYTITGLFIKFGKESIYQLITGYYPFFYVLFSLLFSLVLAFGSFAFLQNYMHFSLAIIIGCFLGFLLNHFLFKLGKKLAVFWIARICAFCATWQDKKIGTMQERIKLFANVIVEKLKQNESKQDYELILVAHSVGTIVCIEVLEYILRQHLDLSLLCKLKILTLGECIPLVSYQKKADEFRKKLEFVSRFDLKWYDYTSIIDGACFPQVDFFRTSGVNAKFTPPFLSAKFHTLYEKHEYKKIKRDKNKAHFLYLYSISVKGDYDFFSFIIMPKFLEEKVKI
>NZ_CP044171.1|WP_014517095.1|290123_291308_-|capsule-polysaccharide-modification-protein-KpsS
MRFSTKIKKEFSGKNVLLLQGPVGNFFHHLSMKMKKNQTKVFKLNFNGGDFFFYPSGTRCKCDEKDLENFYKDFFQSKKIDAILMYNDCRIIHAKAIKVAKELGIEVWIFEEGYLRPYCITLEKDGVNANSSLPRDKNFYLSQSIFTKESIKEIPGGFKFMAFDAFLYWLFAFILAPFFNNKLHHRTLYPFEFLFWFRSLYRKYLYKITEKKLNEKIYNLEKKYFLAILQVYSDTQIKYHYKKSIEHFIEETILSFANHARAKSYLVFKHHPMDRGYKNYSKLINDLSQKYHVEGRVLYVHDTHLPVLLRKALGCITINSTVGLSAILEGCPTKVCGNAFYDFEGLSYPKKLQFFWREAHAYKPNPVLVCNFKKYLLQTNQFNGNFYKNFFLDK
>NZ_CP044171.1|WP_139865077.1|291304_292420_-|capsular-polysaccharide-biosynthesis-protein
MQKERFFMLGFTLWKRHFIKPFFKTKDNEIIFLNSLKSLAGYKLKENDKFFIWGKRIDYNAFKTTLIKKAQDENLLHFTPKVSLVEDGFIRSISLGSDLTRPFSLIVDDKGLYIDPNKVSKLEELLQNEIFDENMLNRAKNIIKILLENRFSKYNGLKHKNLKINAKIGQKIILIPAQVEDDASMILGGFGLSTLDLLKEVRSKNQDAYIIFKPHPDVLSGNRVGLKDETLILEFCDEIVKDCSIDSAIKIADEIHTITSTSGFDALLRAKKVFTYGMPFYAGWGLTKDKHRCERRTRKLSLEELVAGALITYPRYINPKTKTLCEIEVCLDIMLNLQKDYFSKKHIKLAIDFKTFMLRKIRRFYEFLAKK
>NZ_CP044171.1|WP_014517097.1|292434_292665_-|hypothetical-protein
MRSYKPDSEDYNKLKLSFKEIFDEKKVKLTHEFEEKKQKVQGLKFSDKIERNIRYNVIKTLDNHVLINRINKYFNG
>NZ_CP044171.1|WP_014517098.1|292622_293114_-|hypothetical-protein
MNFKTLSILLFFVNFFVACSDDSMLSCDDTQVLDFLEQEEKGQIYQDIMQNLKYTNRVNLDYFSIEPELSKATQEALQEFVNSVDISYSFFIAESIDEKTKKSVCSAVETLRFPRESEKLFKLSIQDLENAFNSKMKLQEENDAIYQAKFCVAISLIQKIIIN

Crispr_ID: NZ_CP044171_2

• CRISPR_ID: NZ_CP044171_2
• CRISPR_location: 386279-386578
• CRISPR_type: Unclear
• Repeat_type: NA
• Spacer_info: 4 spacers
• Cas_protein_info: cas2,cas1

Consensus repeat of NZ_CP044171_2

Consensus_repeat	Method
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	CRT
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	PILER-CR
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	CRISPRCasFinder

spacers of NZ_CP044171_2

>2.1|386315|30|NZ_CP044171|CRT
TGATTTATTAGTAACCCATCAAGTTGGCTT
>2.2|386381|30|NZ_CP044171|CRT
GCACCTGTTTTTGATTGAACAAAACAACCA
>2.3|386447|30|NZ_CP044171|CRT
TGCACTGAAATAAATGAGTTTATAGCAAAT
>2.4|386513|30|NZ_CP044171|CRT
AATAATGATATCGAAGTTATTAATCTAATT
>2.5|386316|30|NZ_CP044171|PILER-CR
TGATTTATTAGTAACCCATCAAGTTGGCTT
>2.6|386382|30|NZ_CP044171|PILER-CR
GCACCTGTTTTTGATTGAACAAAACAACCA
>2.7|386448|30|NZ_CP044171|PILER-CR
TGCACTGAAATAAATGAGTTTATAGCAAAT
>2.8|386514|30|NZ_CP044171|PILER-CR
AATAATGATATCGAAGTTATTAATCTAATT
>2.9|386315|31|NZ_CP044171|CRISPRCasFinder
TGATTTATTAGTAACCCATCAAGTTGGCTTG
>2.10|386381|31|NZ_CP044171|CRISPRCasFinder
GCACCTGTTTTTGATTGAACAAAACAACCAG
>2.11|386447|31|NZ_CP044171|CRISPRCasFinder
TGCACTGAAATAAATGAGTTTATAGCAAATG
>2.12|386513|31|NZ_CP044171|CRISPRCasFinder
AATAATGATATCGAAGTTATTAATCTAATTG

CRISPR arrays and Neighbor proteins around NZ_CP044171_2

CRISPR arrays

The CRISPR arrays of NZ_CP044171_2

>merge|NZ_CP044171|2|386279-386578|CRT,PILER-CR,CRISPRCasFinder
TTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATTGATTTATTAGTAACCCATCAAGTTGGCTTGTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATGCACCTGTTTTTGATTGAACAAAACAACCAGTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATTGCACTGAAATAAATGAGTTTATAGCAAATGTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATAATAATGATATCGAAGTTATTAATCTAATTGTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT

>NZ_CP044171|2|1|386279-386578|CRT
TTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	TGATTTATTAGTAACCCATCAAGTTGGCTT
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	GCACCTGTTTTTGATTGAACAAAACAACCA
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	TGCACTGAAATAAATGAGTTTATAGCAAAT
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	AATAATGATATCGAAGTTATTAATCTAATT
GTTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT

>NZ_CP044171|2|1|386280-386578|PILER-CR
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATT	GATTTATTAGTAACCCATCAAGTTGGCTTG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATG	CACCTGTTTTTGATTGAACAAAACAACCAG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATT	GCACTGAAATAAATGAGTTTATAGCAAATG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAATA	ATAATGATATCGAAGTTATTAATCTAATTG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT

>NZ_CP044171|2|2|386280-386578|CRISPRCasFinder
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	TGATTTATTAGTAACCCATCAAGTTGGCTTG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	GCACCTGTTTTTGATTGAACAAAACAACCAG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	TGCACTGAAATAAATGAGTTTATAGCAAATG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT	AATAATGATATCGAAGTTATTAATCTAATTG
TTTTAGTCCCTTTTTAAATTTCTTTATGGTAAAAT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044171.1|WP_038813573.1|381483_382632_-|carboxynorspermidine-decarboxylase	unknown	unknown	gnl|CDD|273414
NZ_CP044171.1|WP_002867063.1|384972_386163_+|molybdopterin-molybdotransferase-MoeA	unknown	unknown	gnl|CDD|223380
NZ_CP044171.1|WP_002779495.1|392677_393655_-|hypothetical-protein	unknown	unknown	gnl|CDD|340821
NZ_CP044171.1|WP_012006787.1|391195_392653_+|anaerobic-C4-dicarboxylate-transporter-DcuC	unknown	unknown	gnl|CDD|225611
NZ_CP044171.1|WP_002867070.1|393714_394704_-|phosphoribosylformylglycinamidine-cyclo-ligase	unknown	unknown	gnl|CDD|235439
NZ_CP044171.1|WP_002867072.1|395366_396116_+|diaminopimelate-epimerase	unknown	unknown	gnl|CDD|234768
NZ_CP044171.1|WP_002855371.1|384522_384969_+|molybdenum-cofactor-biosynthesis-protein-MoaE	unknown	unknown	gnl|CDD|223391
NZ_CP044171.1|WP_002877301.1|396090_396825_+|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase	unknown	unknown	gnl|CDD|225539
NZ_CP044171.1|WP_079744521.1|377496_380301_-|formate-dehydrogenase-subunit-alpha	unknown	unknown	gnl|CDD|239153
NZ_CP044171.1|WP_002780988.1|386723_387155_-|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|226043
NZ_CP044171.1|WP_002851264.1|376858_377500_-|4Fe-4S-dicluster-domain-containing-protein	unknown	unknown	gnl|CDD|319893
NZ_CP044171.1|WP_002932392.1|384300_384522_+|MoaD/ThiS-family-protein	unknown	unknown	gnl|CDD|224888
NZ_CP044171.1|WP_079744369.1|380466_381180_-|hypothetical-protein	unknown	unknown	gnl|CDD|225916
NZ_CP044171.1|WP_002867071.1|394764_395370_+|dephospho-CoA-kinase	unknown	unknown	gnl|CDD|234620
NZ_CP044171.1|WP_002851537.1|380300_380492_-|twin-arginine-translocation-signal-domain-containing-protein	unknown	unknown	gnl|CDD|236534
NZ_CP044171.1|WP_002867064.1|387147_388038_-|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl|CDD|274694
NZ_CP044171.1|WP_002855824.1|375929_376862_-|formate-dehydrogenase-subunit-gamma	unknown	unknown	gnl|CDD|130645
NZ_CP044171.1|WP_002867076.1|397925_398375_-|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl|CDD|223854
NZ_CP044171.1|WP_052801460.1|382757_384299_+|multicopper-oxidase-CueO	unknown	unknown	gnl|CDD|225043
NZ_CP044171.1|WP_002867075.1|396821_397859_-|ATP-binding-protein	unknown	unknown	gnl|CDD|224292

HMMScan for Signature genes

Protein	Cas_name	Cas_description	E-value	Identity	Coverage
NZ_CP044171.1|WP_002867064.1|387147_388038_-|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	4.5e-98	322.5	8.6
NZ_CP044171.1|WP_002780988.1|386723_387155_-|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	5e-59	192.3	1.5

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP044171.1|WP_038813573.1|381483_382632_-|carboxynorspermidine-decarboxylase	gnl|CDD|273414	TIGR01047, carboxynorspermidine_decarboxylase, carboxynorspermidine decarboxylase. This protein is related to diaminopimelate decarboxylase. It is the last enzyme in norspermidine biosynthesis by an unusual pathway shown in Vibrio alginolyticus. [Central intermediary metabolism, Polyamine biosynthesis].	0
NZ_CP044171.1|WP_002867063.1|384972_386163_+|molybdopterin-molybdotransferase-MoeA	gnl|CDD|223380	COG0303, MoeA, Molybdopterin biosynthesis enzyme [Coenzyme metabolism].	1.19384e-142
NZ_CP044171.1|WP_002779495.1|392677_393655_-|hypothetical-protein	gnl|CDD|340821	cd03789, GT9_LPS_heptosyltransferase, lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.	1.05794e-09
NZ_CP044171.1|WP_012006787.1|391195_392653_+|anaerobic-C4-dicarboxylate-transporter-DcuC	gnl|CDD|225611	COG3069, DcuC, C4-dicarboxylate transporter [Energy production and conversion].	2.86452e-71
NZ_CP044171.1|WP_002867070.1|393714_394704_-|phosphoribosylformylglycinamidine-cyclo-ligase	gnl|CDD|235439	PRK05385, PRK05385, phosphoribosylaminoimidazole synthetase; Provisional.	0
NZ_CP044171.1|WP_002867072.1|395366_396116_+|diaminopimelate-epimerase	gnl|CDD|234768	PRK00450, dapF, diaminopimelate epimerase; Provisional.	4.20349e-93
NZ_CP044171.1|WP_002855371.1|384522_384969_+|molybdenum-cofactor-biosynthesis-protein-MoaE	gnl|CDD|223391	COG0314, MoaE, Molybdopterin converting factor, large subunit [Coenzyme metabolism].	1.29857e-42
NZ_CP044171.1|WP_002877301.1|396090_396825_+|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase	gnl|CDD|225539	COG2992, Bax, Uncharacterized FlgJ-related protein [General function prediction only].	2.2203e-99
NZ_CP044171.1|WP_079744521.1|377496_380301_-|formate-dehydrogenase-subunit-alpha	gnl|CDD|239153	cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E. coli formate dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that is a complex of three different subunits and is the major electron donor to the nitrate respiratory chain. Also included in this CD is the Desulfovibrio gigas tungsten formate dehydrogenase, DgW-FDH. In contrast to Fdh-N, which is a functional heterotrimer, DgW-FDH is a heterodimer. The DgW-FDH complex is composed of a large subunit carrying the W active site and one [4Fe-4S] center, and a small subunit that harbors a series of three [4Fe-4S] clusters as well as a putative vacant binding site for a fourth cluster. The smaller subunit is not included in this alignment. Members of the MopB_Formate-Dh-Na-like CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP044171.1|WP_002780988.1|386723_387155_-|CRISPR-associated-endonuclease-Cas2	gnl|CDD|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	6.96465e-59
NZ_CP044171.1|WP_002851264.1|376858_377500_-|4Fe-4S-dicluster-domain-containing-protein	gnl|CDD|319893	cd16371, DMSOR_beta_like, uncharacterized subfamily of DMSO Reductase beta subunit family. This family consists of the small beta iron-sulfur (FeS) subunit of the DMSO Reductase (DMSOR) family. Members of this family also contain a large, periplasmic molybdenum-containing alpha subunit and may have a small gamma subunit as well. Examples of heterodimeric members with alpha and beta subunits include arsenite oxidase, and tungsten-containing formate dehydrogenase (FDH-T) while heterotrimeric members containing alpha, beta, and gamma subunits include formate dehydrogenase-N (FDH-N), and nitrate reductase (NarGHI). The beta subunit contains four Fe4/S4 and/or Fe3/S4 clusters which transfer the electrons from the alpha subunit to a hydrophobic integral membrane protein, presumably a cytochrome containing two b-type heme groups. The reducing equivalents are then transferred to menaquinone, which finally reduces the electron-accepting enzyme system.	6.18245e-57
NZ_CP044171.1|WP_002932392.1|384300_384522_+|MoaD/ThiS-family-protein	gnl|CDD|224888	COG1977, MoaD, Molybdopterin converting factor, small subunit [Coenzyme metabolism].	4.36918e-12
NZ_CP044171.1|WP_079744369.1|380466_381180_-|hypothetical-protein	gnl|CDD|225916	COG3381, TorD, Uncharacterized component of anaerobic dehydrogenases [General function prediction only].	0.000292146
NZ_CP044171.1|WP_002867071.1|394764_395370_+|dephospho-CoA-kinase	gnl|CDD|234620	PRK00081, coaE, dephospho-CoA kinase; Reviewed.	7.80993e-71
NZ_CP044171.1|WP_002851537.1|380300_380492_-|twin-arginine-translocation-signal-domain-containing-protein	gnl|CDD|236534	PRK09476, napG, quinol dehydrogenase periplasmic component; Provisional.	0.00441722
NZ_CP044171.1|WP_002867064.1|387147_388038_-|type-II-CRISPR-associated-endonuclease-Cas1	gnl|CDD|274694	TIGR03639, cas1_NMENI, CRISPR-associated endonuclease Cas1, subtype II/NMENI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is a prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 variant of the NMENI subtype of CRISPR/Cas system.	2.27175e-120
NZ_CP044171.1|WP_002855824.1|375929_376862_-|formate-dehydrogenase-subunit-gamma	gnl|CDD|130645	TIGR01583, Formate_dehydrogenase_cytochrome_b556_subunit, formate dehydrogenase, gamma subunit. This model represents the gamma chain of the gamma proteobacteria (and Aquifex aolicus) formate dehydrogenase. This subunit is integral to the cytoplasmic membrane, consisting of 4 transmembrane helices, and receives electrons from the beta subunit. The entire E. coli formate dehydrogenase N (nitrate-inducible form) has been crystallized. The gamma subunit contains two cytochromes, heme b(P) and heme b(C) near the periplasmic and cytoplasmic sides of the membrane respectively. The electron acceptor quinone binds at the cytoplasmic heme histidine ligand. NiFe-hydrogenase and thiosulfate reductase contain homologous gamma subunits, and these can be found scoring in the noise of this model. [Energy metabolism, Anaerobic, Energy metabolism, Electron transport].	4.52433e-86
NZ_CP044171.1|WP_002867076.1|397925_398375_-|DNA-starvation/stationary-phase-protection-protein	gnl|CDD|223854	COG0783, Dps, DNA-binding ferritin-like protein (oxidative damage protectant) [Inorganic ion transport and metabolism].	2.50412e-50
NZ_CP044171.1|WP_052801460.1|382757_384299_+|multicopper-oxidase-CueO	gnl|CDD|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	8.51451e-120
NZ_CP044171.1|WP_002867075.1|396821_397859_-|ATP-binding-protein	gnl|CDD|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	1.51502e-33

Protein sequences

>NZ_CP044171.1|WP_002867063.1|384972_386163_+|molybdopterin-molybdotransferase-MoeA
MLMSYEESLKILHSHIKTYEKIEKIALTECLGRILAQDIKAPKNQPEFPTSAMDGYAIKFEDQDKPLKILGLTPAGTMPQFSVQNGTCVKTFTGSLMSEGSDTLVPVENVRVENDTLFIEKKVPQAFAVRAVGENYKKDEILLKKGTKLNYSEIALLAELGFFHISVFIKPIVGVLSSGSEIKDLGEALENPAQIRSSNHIAIANLAKNLNCDTRVFPLLKDDEKATFSTLESALQSCDILITTGGVSMGDFDFLKKAVKEYEIIIDKADIKPGRHIKIAKANEKFIIALPGFPYSAMVMFNLYAREILNSWLLQPKDYICKAFLQGSYKKKTPYLEFVACNVEFKNGRILANLEGKKEGSSAIINNLNNKAALMVVPKECEILENESLVDIIFMP
>NZ_CP044171.1|WP_002855371.1|384522_384969_+|molybdenum-cofactor-biosynthesis-protein-MoaE
MEHFTLYQGSLDIPKIYSQWYEFAKDKNCGALLTFCGIVREEGGIEALSFDIYEPLLKKWFDEWQKRVDFDGISLLFAHSIGDVAVHESSYFAGILSKQRKLGLKLLNEFVEDFKASAPIWKYDVINKERIYAKERSTKLCGAGLLKG
>NZ_CP044171.1|WP_002932392.1|384300_384522_+|MoaD/ThiS-family-protein
MVKVEFLGPINKDNLEFEVKNLKELKEILQKDESLKEWLELCAVSLNDEIIFDENTKLKDGDKIALLPPVCGG
>NZ_CP044171.1|WP_052801460.1|382757_384299_+|multicopper-oxidase-CueO
MNRRNFLKFNALTLASMGVAYANPMHDMHSMHKNHSINHDLDTSFINFAPKNLKLLDPKQFPQGEILKALPLLKNESKEKNIFRATLEIKENHIELIKGKKTLFYTYNGLVPAPKIEVFEGDKLEILVKNKLKEATTIHWHGVPVPPDQDGSPHDPILAGEERIYRFEIPQDSAGTYWYHPHPHYTASKQVFMGLAGAFVIKAKKDALSHLKEKDLMISDLRLDENAQIPNNNLNDWLNGREGEFVLINGQFKPKIKLATNERIRIYNATAARYLNLRIQGAKFILVGTDGGLIEKAIYKEELFLSPASRVEVLIDAPKDGNFKLESAYYDRDKMMVKEEPNTLFLANISLKKENVELPKNLKIFKPSEEPKEFKEIIMSEDHMQMHGMMGKIESELKIALASMFLINGKSYDLKRIDLSSKLGVVEDWIVINKSHMDHPFHIHGTQFELISSKLNGKVQKAEFRALRDTINVRPNEELRLRMKQDFKGLRMYHCHILEHEDLGMMGNLEVKE
>NZ_CP044171.1|WP_038813573.1|381483_382632_-|carboxynorspermidine-decarboxylase
MFYEKIQTPAYILEEDKLRKNCELLASIGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQSKTQKNSLGLRCNVEFSLAPKELYNPCGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESADALEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQTGNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN
>NZ_CP044171.1|WP_079744369.1|380466_381180_-|hypothetical-protein
MGALMDLEKLRLARSLYYQCLGELFVFSFSEERLSKLQEYLKTMQECLFDENLKSNFDILLKHLDDENSIQAFFKEYDLLFLSLKNSTPTTFSYIEEGFENSNPLLCVRQILVKSKIRRNENFFKESEDSVGFCLLLMSEFLRQNEDDLAKELFEKVINKSIDEFLGDVFMNKNANLYKEIASIASAFMEFERLCFEVEKPAKINSKKVQNDLSRSEFLRREANKQRRTREKSQGIS
>NZ_CP044171.1|WP_002851537.1|380300_380492_-|twin-arginine-translocation-signal-domain-containing-protein
MKNRREFLKKSAFALGAAGVLGSTTLALAKDEERKDLVKGKSKKKEVLFQRSANWENYYIKAE
>NZ_CP044171.1|WP_079744521.1|377496_380301_-|formate-dehydrogenase-subunit-alpha
MSSVGENIKLTRRSFLKMAALSSLATPLLARSETLREASADELKEAYEGSKKVKTVCTACSVGCGIIAEVQNGVWVRQEIAQDHPVSSGGHCCKGSDMIDMVRSHVRLKYPMKKENGEWKRISYEQALSEIGEKLAAYRKENPESVMFLGSAKLNNEQAYYIRKFAAFFGTNNVDHQARIUHSATVAGVANTFGYGAMTNHLGDIQRSKCIIIIGANPAVNHPVGFRHFLKAKEKGAKLIVVDPRFTKSAAKADIYARIRPGTDIAFMYGMLKIIFDEGLEDTKYLDERVFGIDKIREEAAKWTAEEVENVTGISKELLVQITHEVAKNKPTTLIWAMGLTQHTVGTSNTRLAPIVQMVLGNIGKFGGGVNILRGHDNVQGASDMACLSENLPGYYPLNEATWRYYAKIWGVDYEWLLGNFVSKDWMHKTGLSLARWWAAALNGKDGNDAIDNAGTPLKALVVMGNGITSTAQQVKVKEGLEALELLVLADPFVNEAGIIAERKDGIYLLPAATQFETSGSVTATNRSGQWRFKVVDPLYESMEDQEILFELAKKLGFYEDFTKTLRDEKGEIVWPENATREIAKAVRSIGLNGWSPERLKKHTLYWDKFDEVTLEGKDEVAGEYYGLPWPCWSDKHPGSPVLYNTDIEVAKGGMGFRNNFGLEYEGESLLAKNAPLNSPIDTGYPQITKDNIEKVLGITLSAQEKEKMGSTWSYDDSNIIATKCIEKGIVPYGNAKARAVVWTFKDKIPLHREPLHSPRNDLVQKYPSFEDQKALYRVDTKFVSVQQAKDYSKEFPLNLVTARLVNLNGAGMENRASMYLTRLTPEMFCEINPELAKEQDIKAGDMIWVHSPEGTKIHVRVKVNPGVAKDMIFLPFHFTGVMQGVDLTHNFPKGTKPYASGESANTVTNYGYDIMCQIPETKGGLCRISKDGK
>NZ_CP044171.1|WP_002851264.1|376858_377500_-|4Fe-4S-dicluster-domain-containing-protein
MSKVNFANLEKERLKFFCDNERCIDCNGCAVACDEAHELPIHIRRRRVITLNEGIQGKEVSTSISCMHCDDAPCSIVCPVDCFYIRADGIVLHDKEICIGCGYCLYACPFGAPQFPKDSVFGNKGIMDKCTMCAGGPEATNSEKERELYGQNRIAEGKVPVCAAMCSTKALLVGESSKIEEIYHNRLMNRNYGIPNPSESLEWKIAYTGKERL
>NZ_CP044171.1|WP_002855824.1|375929_376862_-|formate-dehydrogenase-subunit-gamma
MRKVFVTLLLSVASLFAYGSERMGQDTQIWDFHRITNIPNYDTFGKLWTTLQGEYIATIALIAVIAVLSAFALHYMVIGPKQFSHDGKKIYAFTLFERLFHFIAAISWVILVPTGFVMMFGATFGGGLFVRVCKNLHAFATVLFIISIIPMFLWWIKRMLPASYDIRWMMIVGGYLSKVKRPVPAGKFNFGQKSWYYIAVFGGFLMIITGGFMYFLDFNSTAIQGLFGLTQIELLRISAIVHNFLGIVCAVFFGVHIYMAVFAIKGSIHSMISGYKEEEEVYILHSYWYKELSNKKQIEPSFSYDPNVKI
>NZ_CP044171.1|WP_002780988.1|386723_387155_-|CRISPR-associated-endonuclease-Cas2
MIEDKFMRVLLMFDVPTKSKKEQKLASKFRNNLIKLGYFMLQFSVYMRICKGLSSAKSSIENVKKILPPYGNVRALIITEKQFDKMELLLGGIVFNEKVNNETNLTLFDIDSHGEFKYKNSNNEEIQLNKKQEKYHQQNLFEF
>NZ_CP044171.1|WP_002867064.1|387147_388038_-|type-II-CRISPR-associated-endonuclease-Cas1
MSYDEAFKTLLISSNAKLNLELNHLVIKQDENIAKLFLKDINIIVLESLQVSLSSALFNAFARHKIILLTCDETHSINGVFTPFLGHFQSAKIAKEQMNVSAQKKAILWQKIIKNKILNQAFVLKKHNKIGQSNELINLAKKVSLNDSKNIEAVAAALYFKTLFGVSFSRDELCFENSALNYGYAIIRACIIRAVCISGLLPWLGIKHDNIYNSFALCDDLIEVFRASVDDCVLKLKGESEFLSKDDKRALIGNLQSKINFDGQNYPLNRAINHYVANFKNALLYEDELKIVKFDD
>NZ_CP044171.1|WP_012006787.1|391195_392653_+|anaerobic-C4-dicarboxylate-transporter-DcuC
MPIFMICSTLLAVIVVAYYILKKYNPIFVFFLSGIILLIFAFYITGTPIPKAPSREHASFLNVLLDSYAFITATFKSQLSGVGLIIMSVAGFAAYMKHINASAKLAFLANKPLGKIKNKYLILSGTFVVGMALKIVISSYAGLLLLLLACIYPVLISLKIRPITAVCVLSLIALDYGPKDGNSINMADMVGQSDNVVGLFLNYQIYSVIAYVVVIAILIPFYFAWIDKRDKEKGVLNDEVEIPQIIDPRCPTFYILFPWLPVVFLFTAYFFTIKLDVVTANFVSISLVFLVEFARHRNARKLGEDMMVILKAMAEIFISVVSIIIAAGVFAEGIKALGGVNILANAVSNLGTGNFAWFGILLSIAILSFLVYFATVIMGSGIAAFNAFGKLAPDIATKLGVAPITLVLPIEIASCLGRAASPIAGGIIALAGFAKVAPMDIIKRTTPLLLIAMLVNVLVAFYLAQTNPLPKEQNTTKIAVSLNNK
>NZ_CP044171.1|WP_002779495.1|392677_393655_-|hypothetical-protein
MKNIVFHSDGFGDLLVCFKALYAIKQLYPEYKLFLLTNGLMESDFLEKIPFIDEVLIYKDDFLEKIQSKNPVIFITTRRQGLYFKKLKFLNVQKCIVFPHLISIISKNLTTPLPFFRAKKHMSEIVLKLVRMINTRHFDKNFNQIDFSKIKNLLPYDARLSDNFFKQIDTKYEKIIGINAFSNNSEYRGFNFFIKDWIGLARQLSLKYPKFLFILLNFSTNSIQYNIDQNANLKVFCNNKNIASLVSISQKLDFLITVDTGNLHLCDILQIPTLAFTSSLAAYRFGGGSYGGRFDKLIVKPAWQKEYRKIYEIFTKKAENNLENL
>NZ_CP044171.1|WP_002867070.1|393714_394704_-|phosphoribosylformylglycinamidine-cyclo-ligase
MKISYEDAGVSIDNGNAFVEAIKPLVKETFNDNVVGGIGSFAGAFRMPSGFKKPVILGATDGVGTKLRLAIDAKKYDTIGQDLVAMCVNDLICNFATPLFFLDYYATVKLEVEVAKAVVSGIAKGCKMANCALIGGETAEMPGMYAKDDFDLAGFAVGMAEEDEIDRSKFVKNGDILLALPSSGLHSNGYSLARKVLFESLKLKFDDKIEGKNLIDILLEPTRIYVRDFLTLKPYISALAHITGGGLVENLPRVLPSGMGATIRKHHLKTPEIFYTIGQAVEESEMYRSFNMGVGLVMVVDPSNVSKVLENSDAFIIGEICINEGIVLE
>NZ_CP044171.1|WP_002867071.1|394764_395370_+|dephospho-CoA-kinase
MKNAFFVTASIACGKSTFIEIANSLGFKSISADKIAHEILDENALELEKIFSPFSLKNLLTKEKKIDRKILGEIVFNNKEAKKILENFTHPKIRAKILEQMQILDKENKAFFVEIPLFFESGAYENLGKVIVIYTPKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADFIIKNTNSYADFRQECVKVIQEISKGKM
>NZ_CP044171.1|WP_002867072.1|395366_396116_+|diaminopimelate-epimerase
MKFYKYCASGNDFVITNADRKEDRSALAKELCNRYEGIGADGFIVILPHEKYDFEWEFYNNDGSRAAMCGNGSRAAAHFVHHINKINPNMSFLTGAGVIKAKVNQDKVEVSLGKIKSVQNTFEELGKTWQLCNTGVPHLVHFCQNLDEFDTMLCQKMRQKYNANVNFVKILDENHLKVRTYERGVEDETLACGTGMGACFYLAFLNKKVQNKVKITPKSGEEVGFAYKNEELFFEGKVKYCFEANYNFS
>NZ_CP044171.1|WP_002877301.1|396090_396825_+|mannosyl-glycoprotein-endo-beta-N-acetylglucosamidase
MKPIIIFLSLFLIPLFAADDLKSGFGEEYYKLDIDQKRQIFFTKMNEMFDQSFKKIEQERAFIEAFFKDAYKTGFRTSNQINLEKLITIKNKYRIENLYDFAEYKKRIQKIPKSMGIAQALVESATGTSRFAREANNLFGEWTWGEKGLIPDLRHPDKKHKIKIFDSLQDSVDSYVLNLNRHFAYEKFRDARAKFESEGKEITGLEAIKTLDSYSERKGYYINLITKIIKRYNLEKYDTNSNNT
>NZ_CP044171.1|WP_002867075.1|396821_397859_-|ATP-binding-protein
MKVLNFFYENHPKFEVSYERKNQISKPNIIIKGPRFCGKKTLIFNFLSQFKASEILFLDLYDTRFEKQSLERLADFLNENLQIKILCLYNLDFIPNLEKIKIPIILSTNIKDLNINGFEELELDYFDFEEFISVSKKNLPINNLVGLFLQSGRSKFGEKNILLRQSFTLLELEILKYLALNLGQQISISKIFIELKKRLKTSKDSVYQAIKKLENTYVIYTLKHDEKKLQKIYFKDFGLRNNLCISKDFSHLFENLVLSELFKFKEEFFYNKYFNFYSQISKIAYISSPTLDIDLIKLRAKKILPKALELGIFHVIFITLSSEDNFFEQGVKFEVISFDKFSLGF
>NZ_CP044171.1|WP_002867076.1|397925_398375_-|DNA-starvation/stationary-phase-protection-protein
MSVTKQLLQMQADAHHLWVKFHNYHWNVKGLQFFSIHEYTEKAYEEMAELFDSCAERVLQLGEKAITCQKVLMENAKSPKVAKDCFTPLEVIELIKQDYEYLLAEFKKLNEEAEKESDTTTAAFAQENIAKYEKSLWMIGATLQGACKM

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	NZ_CP014746	Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence	12710-12739	0	1.0
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	5197-5226	0	1.0
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	MN530981	Campylobacter phage DA10, complete genome	2932-2961	0	1.0
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	NZ_CP014746	Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence	12710-12739	0	1.0
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	5197-5226	0	1.0
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	MN530981	Campylobacter phage DA10, complete genome	2932-2961	0	1.0
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	NZ_CP014746	Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence	12709-12739	0	1.0
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	13127-13156	1	0.967
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	13127-13156	1	0.967
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	CP013734	Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence	5197-5227	1	0.968
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	MN530981	Campylobacter phage DA10, complete genome	2931-2961	1	0.968
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	4559-4588	2	0.933
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	10105-10134	2	0.933
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	MN530981	Campylobacter phage DA10, complete genome	13943-13972	2	0.933
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	4559-4588	2	0.933
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	10105-10134	2	0.933
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	MN530981	Campylobacter phage DA10, complete genome	13943-13972	2	0.933
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	NZ_CP007184	Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence	13126-13156	2	0.935
NZ_CP044171_2	2.1|386315|30|NZ_CP044171|CRT	386315-386344	30	NC_017284	Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence	4556-4585	3	0.9
NZ_CP044171_2	2.5|386316|30|NZ_CP044171|PILER-CR	386316-386345	30	NC_017284	Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence	4556-4585	3	0.9
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	NC_008770	Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence	4559-4589	3	0.903
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	NZ_CP010074	Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence	10105-10135	3	0.903
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	MN530981	Campylobacter phage DA10, complete genome	13943-13973	3	0.903
NZ_CP044171_2	2.9|386315|31|NZ_CP044171|CRISPRCasFinder	386315-386345	31	NC_017284	Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence	4556-4586	4	0.871
NZ_CP044171_2	2.4|386513|30|NZ_CP044171|CRT	386513-386542	30	MK284526	Bacillus phage DK1, complete genome	4801-4830	6	0.8
NZ_CP044171_2	2.4|386513|30|NZ_CP044171|CRT	386513-386542	30	NZ_CP016375	Elizabethkingia anophelis strain F3201 plasmid unnamed, complete sequence	20797-20826	6	0.8
NZ_CP044171_2	2.8|386514|30|NZ_CP044171|PILER-CR	386514-386543	30	MK284526	Bacillus phage DK1, complete genome	4801-4830	6	0.8
NZ_CP044171_2	2.8|386514|30|NZ_CP044171|PILER-CR	386514-386543	30	NZ_CP016375	Elizabethkingia anophelis strain F3201 plasmid unnamed, complete sequence	20797-20826	6	0.8
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP039703	Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence	643083-643113	6	0.806
NZ_CP044171_2	2.12|386513|31|NZ_CP044171|CRISPRCasFinder	386513-386543	31	MK284526	Bacillus phage DK1, complete genome	4800-4830	6	0.806
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_AP018539	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence	3952-3981	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP030044	Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence	64076-64105	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	96022-96051	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_MK993385	Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence	3951-3980	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	MN693504	Marine virus AFVG_25M410, complete genome	30096-30125	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	MW117965	Synechococcus phage S-H38, complete genome	9860-9889	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	39238-39267	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	36587-36616	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	183446-183475	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	9095-9124	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	39548-39577	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	47614-47643	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	251283-251312	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	64883-64912	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	218268-218297	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	35947-35976	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	11753-11782	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	134326-134355	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	33918-33947	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	36765-36794	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	43260-43289	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	252805-252834	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	320435-320464	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	86538-86567	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	118527-118556	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	38232-38261	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	187658-187687	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	38697-38726	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	7928-7957	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	36825-36854	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	33918-33947	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	36595-36624	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	7997-8026	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135334	Enterococcus faecium isolate E7471 plasmid 4	24971-25000	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	207966-207995	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	30807-30836	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	43145-43174	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	134091-134120	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	190376-190405	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	36547-36576	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	36594-36623	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	28580-28609	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	7609-7638	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	30327-30356	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	7609-7638	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	15242-15271	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	32830-32859	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	42867-42896	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	29159-29188	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	34440-34469	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	41906-41935	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	7997-8026	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	28585-28614	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	122065-122094	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	39191-39220	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	78426-78455	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	241970-241999	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	39238-39267	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	35969-35998	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	40226-40255	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	37061-37090	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	40078-40107	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	188531-188560	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	35573-35602	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	35410-35439	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	7997-8026	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	39552-39581	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	37152-37181	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	89596-89625	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	17617-17646	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	114351-114380	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	39193-39222	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	38232-38261	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	206813-206842	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	38232-38261	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	60193-60222	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	71217-71246	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	38835-38864	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	45227-45256	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	35809-35838	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	39193-39222	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	11115-11144	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	40294-40323	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	34440-34469	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	34245-34274	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	21823-21852	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	33864-33893	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	61453-61482	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	34237-34266	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	19798-19827	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	72283-72312	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	41455-41484	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	13912-13941	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	3474-3503	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	38667-38696	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	43719-43748	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	40474-40503	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	29747-29776	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	258088-258117	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	36764-36793	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	106639-106668	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	42844-42873	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	36085-36114	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	39211-39240	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	7424-7453	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	190127-190156	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	4852-4881	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	183789-183818	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	183675-183704	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	40079-40108	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	190163-190192	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	31503-31532	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	7758-7787	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	35752-35781	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	40823-40852	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	33917-33946	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP019973	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence	46764-46793	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	12402-12431	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	33916-33945	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	30023-30052	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	39186-39215	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	84511-84540	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	28933-28962	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	203898-203927	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018130	Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence	6725-6754	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	62431-62460	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	124510-124539	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	7997-8026	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	93130-93159	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	36727-36756	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	14184-14213	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	47614-47643	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	251283-251312	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	38651-38680	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	17073-17102	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	184965-184994	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	10648-10677	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	15364-15393	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	62431-62460	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	132178-132207	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	39198-39227	7	0.767
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	MG765277	Lactobacillus phage Bacchae, complete genome	63193-63222	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	MF448564	Lactococcus phage 62601, complete genome	19126-19155	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_049480	Lactococcus phage CHPC129, complete genome	18164-18193	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	MN689522	Lactococcus phage CHPC958, complete genome	19100-19129	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_049408	Lactococcus phage 62605, complete genome	18922-18951	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	MF448567	Lactococcus phage 66901, complete genome	18015-18044	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_021860	Lactococcus phage jm2, complete genome	18891-18920	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_018992	Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence	9409-9438	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_011782	Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence	11153-11182	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_017417	Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence	14311-14340	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP031400	Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence	9154-9183	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_004988	Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence	10795-10824	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP017211	Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence	9315-9344	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_001849	Borreliella burgdorferi B31 plasmid lp17, complete sequence	10765-10794	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	MK893987	Staphylococcus phage PMBT8, complete genome	54848-54877	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP019922	Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence	6007-6036	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP019851	Borreliella burgdorferi plasmid lp17, complete sequence	6027-6056	7	0.767
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP019761	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence	6028-6057	7	0.767
NZ_CP044171_2	2.4|386513|30|NZ_CP044171|CRT	386513-386542	30	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	16680-16709	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_AP018539	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence	3952-3981	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP030044	Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence	64076-64105	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	96022-96051	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_MK993385	Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence	3951-3980	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	MN693504	Marine virus AFVG_25M410, complete genome	30096-30125	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	MW117965	Synechococcus phage S-H38, complete genome	9860-9889	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	39238-39267	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	36587-36616	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	183446-183475	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	9095-9124	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	39548-39577	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	47614-47643	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	251283-251312	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	64883-64912	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	218268-218297	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	35947-35976	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	11753-11782	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	134326-134355	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	33918-33947	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	36765-36794	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	43260-43289	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	252805-252834	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	320435-320464	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	86538-86567	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	118527-118556	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	38232-38261	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	187658-187687	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	38697-38726	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	7928-7957	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	36825-36854	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	33918-33947	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	36595-36624	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	7997-8026	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135334	Enterococcus faecium isolate E7471 plasmid 4	24971-25000	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	207966-207995	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	30807-30836	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	43145-43174	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	134091-134120	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	190376-190405	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	36547-36576	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	36594-36623	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	28580-28609	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	7609-7638	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	30327-30356	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	7609-7638	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	15242-15271	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	32830-32859	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	42867-42896	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	29159-29188	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	34440-34469	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	41906-41935	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	7997-8026	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	28585-28614	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	122065-122094	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	39191-39220	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	78426-78455	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	241970-241999	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	39238-39267	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	35969-35998	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	40226-40255	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	37061-37090	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	40078-40107	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	188531-188560	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	35573-35602	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	35410-35439	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	7997-8026	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	39552-39581	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	37152-37181	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	89596-89625	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	17617-17646	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	114351-114380	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	39193-39222	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	38232-38261	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	206813-206842	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	38232-38261	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	60193-60222	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	71217-71246	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	38835-38864	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	45227-45256	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	35809-35838	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	39193-39222	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	11115-11144	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	40294-40323	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	34440-34469	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	34245-34274	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	21823-21852	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	33864-33893	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	61453-61482	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	34237-34266	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	19798-19827	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	72283-72312	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	41455-41484	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	13912-13941	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	3474-3503	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	38667-38696	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	43719-43748	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	40474-40503	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	29747-29776	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	258088-258117	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	36764-36793	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	106639-106668	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	42844-42873	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	36085-36114	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	39211-39240	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	7424-7453	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	190127-190156	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	4852-4881	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	183789-183818	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	40077-40106	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	183675-183704	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	40079-40108	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	190163-190192	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	31503-31532	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	7758-7787	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	35752-35781	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	40823-40852	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	33917-33946	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP019973	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence	46764-46793	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	12402-12431	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	33916-33945	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	30023-30052	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	39186-39215	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	84511-84540	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	28933-28962	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	203898-203927	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018130	Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence	6725-6754	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	62431-62460	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	124510-124539	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	7997-8026	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	93130-93159	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	36727-36756	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	14184-14213	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	47614-47643	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	251283-251312	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	38651-38680	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	17073-17102	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	184965-184994	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	10648-10677	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	15364-15393	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	62431-62460	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	7610-7639	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	62432-62461	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	132178-132207	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	39198-39227	7	0.767
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	MG765277	Lactobacillus phage Bacchae, complete genome	63193-63222	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	MF448564	Lactococcus phage 62601, complete genome	19126-19155	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_049480	Lactococcus phage CHPC129, complete genome	18164-18193	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	MN689522	Lactococcus phage CHPC958, complete genome	19100-19129	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_049408	Lactococcus phage 62605, complete genome	18922-18951	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	MF448567	Lactococcus phage 66901, complete genome	18015-18044	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_021860	Lactococcus phage jm2, complete genome	18891-18920	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_018992	Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence	9409-9438	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_011782	Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence	11153-11182	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_017417	Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence	14311-14340	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP031400	Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence	9154-9183	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_004988	Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence	10795-10824	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP017211	Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence	9315-9344	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_001849	Borreliella burgdorferi B31 plasmid lp17, complete sequence	10765-10794	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	MK893987	Staphylococcus phage PMBT8, complete genome	54848-54877	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP019922	Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence	6007-6036	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP019851	Borreliella burgdorferi plasmid lp17, complete sequence	6027-6056	7	0.767
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP019761	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence	6028-6057	7	0.767
NZ_CP044171_2	2.8|386514|30|NZ_CP044171|PILER-CR	386514-386543	30	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	16680-16709	7	0.767
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	MN693504	Marine virus AFVG_25M410, complete genome	30095-30125	7	0.774
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	181952-181981	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	32788-32817	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	38527-38556	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	148899-148928	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	33340-33369	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	43320-43349	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	33340-33369	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	32788-32817	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	68052-68081	8	0.733
NZ_CP044171_2	2.2|386381|30|NZ_CP044171|CRT	386381-386410	30	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	33314-33343	8	0.733
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	25970-25999	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	181952-181981	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	32788-32817	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	38527-38556	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	148899-148928	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	33340-33369	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	43320-43349	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	33340-33369	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	32788-32817	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	68052-68081	8	0.733
NZ_CP044171_2	2.6|386382|30|NZ_CP044171|PILER-CR	386382-386411	30	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	33314-33343	8	0.733
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP028874	Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence	25970-25999	8	0.733
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_AP018539	Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence	3951-3981	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_MK993385	Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence	3950-3980	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP030044	Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence	64076-64106	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_MK140641	Enterococcus faecalis strain E035 plasmid pE035, complete sequence	96022-96052	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	MW117965	Synechococcus phage S-H38, complete genome	9859-9889	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	183445-183475	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP025426	Enterococcus faecium strain SC4 plasmid p1, complete sequence	36587-36617	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	218267-218297	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040369	Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence	64883-64913	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040906	Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence	11752-11782	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	252804-252834	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	320434-320464	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP013995	Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence	43260-43290	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP014450	Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence	86537-86567	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	187657-187687	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027518	Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence	38232-38262	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	207965-207995	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018070	Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence	43144-43174	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135246	Enterococcus faecium isolate E6988 plasmid 4	30326-30356	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135280	Enterococcus faecium isolate E6975 plasmid 3	15241-15271	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135237	Enterococcus faecium isolate E7067 plasmid 3	29158-29188	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041256	Enterococcus faecium strain 515 plasmid p26, complete sequence	122064-122094	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP019989	Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence	241969-241999	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	188530-188560	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135476	Enterococcus faecium isolate E8423 plasmid 2	40078-40108	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135222	Enterococcus faecium isolate E7040 plasmid 4	17616-17646	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	206812-206842	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135358	Enterococcus faecium isolate E7948 plasmid 2	38232-38262	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP050649	Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE	60192-60222	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP050651	Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT	71216-71246	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR134108	Enterococcus faecium isolate E6043 plasmid 4	11114-11144	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP011829	Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence	21822-21852	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LN999988	Enterococcus faecium isolate EFE11651 plasmid II, complete sequence	61452-61482	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP033042	Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence	19797-19827	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP025687	Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence	72282-72312	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	29746-29776	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP032307	Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence	258087-258117	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP019993	Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence	7423-7453	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	190126-190156	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035655	Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence	40077-40107	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	183788-183818	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035661	Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence	40077-40107	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	183674-183704	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035667	Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence	40077-40107	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	190162-190192	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035649	Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence	40079-40109	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040851	Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence	31502-31532	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP042840	Enterococcus sp. DA9 plasmid unnamed4	7757-7787	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP019973	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence	46763-46793	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP019974	Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence	12401-12431	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP033207	Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence	84510-84540	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018129	Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence	203897-203927	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018130	Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence	6724-6754	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP042833	Enterococcus faecium strain FA3 plasmid unnamed1	17072-17102	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP012461	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence	184964-184994	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP012463	Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence	10647-10677	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LT598664	Enterococcus faecium isolate Ef_aus00233 plasmid 2	132177-132207	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP011282	Enterococcus faecium strain E39 plasmid p1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP015123	Enterococcus faecium strain E39 plasmid p3, complete sequence	39238-39268	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	LT603679	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2	9095-9125	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	LT603680	Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3	39548-39578	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	47614-47644	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018832	Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence	251283-251313	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	CP003352	Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence	35947-35977	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP020485	Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence	134326-134356	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041262	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence	33918-33948	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041264	Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence	36765-36795	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018073	Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence	118527-118557	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027498	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027499	Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence	38697-38727	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027507	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence	7928-7958	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027508	Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence	36825-36855	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027502	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence	33918-33948	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027503	Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence	36595-36625	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135288	Enterococcus faecium isolate E7199 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135333	Enterococcus faecium isolate E7471 plasmid 3	7997-8027	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135334	Enterococcus faecium isolate E7471 plasmid 4	24971-25001	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	30807-30837	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	134091-134121	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP025756	Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence	190376-190406	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027513	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence	36547-36577	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP027514	Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence	36594-36624	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP013010	Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence	28580-28610	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135244	Enterococcus faecium isolate E6988 plasmid 2	7609-7639	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	7609-7639	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135294	Enterococcus faecium isolate E7237 plasmid 2	32830-32860	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135255	Enterococcus faecium isolate E7098 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135257	Enterococcus faecium isolate E7098 plasmid 4	42867-42897	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135236	Enterococcus faecium isolate E7067 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135199	Enterococcus faecium isolate E6055 plasmid 3	34440-34470	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135259	Enterococcus faecium isolate E4457 plasmid 2	41906-41936	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	7997-8027	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041254	Enterococcus faecium strain 515 plasmid p169, complete sequence	28585-28615	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NC_021995	Enterococcus faecium Aus0085 plasmid p2, complete sequence	39191-39221	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP019209	Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence	78426-78456	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP017798	Enterococcus faecium strain E243 plasmid unnamed1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP017799	Enterococcus faecium strain E243 plasmid unnamed2, complete sequence	39238-39268	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135429	Enterococcus faecium isolate E8927 plasmid 2	35969-35999	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135436	Enterococcus faecium isolate E8691 plasmid 2	40226-40256	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135483	Enterococcus faecium isolate E4456 plasmid 2	37061-37091	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135204	Enterococcus faecium isolate E7171 plasmid 2	35573-35603	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135175	Enterococcus faecium isolate E4402 plasmid 2	35410-35440	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135227	Enterococcus faecium isolate E7025 plasmid 2	7997-8027	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135228	Enterococcus faecium isolate E7025 plasmid 3	39552-39582	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	37152-37182	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135220	Enterococcus faecium isolate E7040 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135221	Enterococcus faecium isolate E7040 plasmid 3	89596-89626	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NC_021987	Enterococcus faecium Aus0085 plasmid p1, complete sequence	114351-114381	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135325	Enterococcus faecium isolate E7654 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135326	Enterococcus faecium isolate E7654 plasmid 3	39193-39223	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135352	Enterococcus faecium isolate E8014 plasmid 2	38232-38262	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	38835-38865	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135386	Enterococcus faecium isolate E7933 plasmid 3	45227-45257	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP044265	Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence	35809-35839	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135318	Enterococcus faecium isolate E7663 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135319	Enterococcus faecium isolate E7663 plasmid 3	39193-39223	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR134106	Enterococcus faecium isolate E6043 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135373	Enterococcus faecium isolate E8172 plasmid 2	40294-40324	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135374	Enterococcus faecium isolate E8172 plasmid 3	34440-34470	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP006031	Enterococcus faecium T110 plasmid pEFT110, complete sequence	34245-34275	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_AP019395	Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence	33864-33894	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	34237-34267	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040741	Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence	41455-41485	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP014530	Enterococcus faecium strain E745 plasmid pl1, complete sequence	13912-13942	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP014534	Enterococcus faecium strain E745 plasmid pl5, complete sequence	3474-3504	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023424	Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence	38667-38697	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023425	Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence	43719-43749	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_AP022342	Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence	40474-40504	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041273	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence	36764-36794	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	106639-106669	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040876	Enterococcus faecium strain DB-1 plasmid punnamed2	42844-42874	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	36085-36115	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP017793	Enterococcus faecium strain E240 plasmid unnamed1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP017794	Enterococcus faecium strain E240 plasmid unnamed2, complete sequence	39211-39241	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023790	Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence	62432-62462	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023800	Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence	62432-62462	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035137	Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence	4852-4882	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135192	Enterococcus faecium isolate E4438 plasmid 2	35752-35782	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135193	Enterococcus faecium isolate E4438 plasmid 3	40823-40853	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP041271	Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence	33917-33947	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135308	Enterococcus faecium isolate E7240 plasmid 2	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040237	Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence	33916-33946	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	30023-30053	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023809	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence	62432-62462	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023812	Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence	39186-39216	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP033208	Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence	28933-28963	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023805	Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence	62431-62461	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP035221	Enterococcus faecium strain SRCM103470 plasmid unnamed1	124510-124540	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	7997-8027	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	93130-93160	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP034948	Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence	36727-36757	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP016164	Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence	14184-14214	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	47614-47644	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP018827	Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence	251283-251313	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	LR135186	Enterococcus faecium isolate E4413 genome assembly, plasmid: 2	38651-38681	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP012432	Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence	15364-15394	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023795	Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence	62431-62461	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	7610-7640	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP023781	Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence	62432-62462	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LT598666	Enterococcus faecium isolate Ef_aus00233 plasmid 4	39198-39228	8	0.742
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	MG765277	Lactobacillus phage Bacchae, complete genome	63193-63223	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	MF448564	Lactococcus phage 62601, complete genome	19125-19155	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_049480	Lactococcus phage CHPC129, complete genome	18163-18193	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	MN689522	Lactococcus phage CHPC958, complete genome	19099-19129	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_049408	Lactococcus phage 62605, complete genome	18921-18951	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	MF448567	Lactococcus phage 66901, complete genome	18014-18044	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_021860	Lactococcus phage jm2, complete genome	18890-18920	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP019922	Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence	6007-6037	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP019851	Borreliella burgdorferi plasmid lp17, complete sequence	6027-6057	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP019761	Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence	6028-6058	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_018992	Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence	9408-9438	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_011782	Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence	11152-11182	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_017417	Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence	14310-14340	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP031400	Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence	9153-9183	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_004988	Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence	10794-10824	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP017211	Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence	9314-9344	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_001849	Borreliella burgdorferi B31 plasmid lp17, complete sequence	10764-10794	8	0.742
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	MK893987	Staphylococcus phage PMBT8, complete genome	54847-54877	8	0.742
NZ_CP044171_2	2.12|386513|31|NZ_CP044171|CRISPRCasFinder	386513-386543	31	MT497068	Flavobacterium phage vB_Fsp_elemo14-3B, partial genome	16679-16709	8	0.742
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	154158-154187	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	88354-88383	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	276290-276319	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	184503-184532	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	170225-170254	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.3|386447|30|NZ_CP044171|CRT	386447-386476	30	NZ_CP028567	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence	206090-206119	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	154158-154187	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	88354-88383	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	276290-276319	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	184503-184532	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	170225-170254	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	53224-53253	9	0.7
NZ_CP044171_2	2.7|386448|30|NZ_CP044171|PILER-CR	386448-386477	30	NZ_CP028567	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence	206090-206119	9	0.7
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP046076	Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence	181951-181981	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP040905	Enterococcus faecium strain N56454 plasmid unnamed, complete sequence	148898-148928	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP015517	Enterococcus hirae strain R17 plasmid, complete sequence	43319-43349	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135783	Enterococcus faecium isolate E4239 plasmid 2	32788-32818	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	38527-38557	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135180	Enterococcus faecium isolate E0595 plasmid 2	33340-33370	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR132068	Enterococcus faecium isolate E0139 plasmid 2	33340-33370	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_LR135171	Enterococcus faecium isolate E4227 plasmid 2	32788-32818	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_CP037956	Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence	68052-68082	9	0.71
NZ_CP044171_2	2.10|386381|31|NZ_CP044171|CRISPRCasFinder	386381-386411	31	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	33314-33344	9	0.71
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP028567	Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence	206089-206119	9	0.71
NZ_CP044171_1	1.1|284420|34|NZ_CP044171|CRISPRCasFinder	284420-284453	34	MH752385	Bacillus phage Ray17, complete genome	8509-8542	10	0.706
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP053970	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence	276290-276320	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP053979	Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence	184503-184533	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP013277	Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence	53224-53254	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP039723	Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence	170225-170255	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP009348	Bacillus thuringiensis HD1002 plasmid 2, complete sequence	53224-53254	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP045024	Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence	53224-53254	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NC_018516	Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence	154157-154187	10	0.677
NZ_CP044171_2	2.11|386447|31|NZ_CP044171|CRISPRCasFinder	386447-386477	31	NZ_CP009334	Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence	88353-88383	10	0.677

1. spacer 2.1|386315|30|NZ_CP044171|CRT matches to NZ_CP014746 (Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence) position: , mismatch: 0, identity: 1.0

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacccatcaagttggctt	Protospacer
******************************

2. spacer 2.1|386315|30|NZ_CP044171|CRT matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 0, identity: 1.0

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacccatcaagttggctt	Protospacer
******************************

3. spacer 2.3|386447|30|NZ_CP044171|CRT matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 0, identity: 1.0

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
tgcactgaaataaatgagtttatagcaaat	Protospacer
******************************

4. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to NZ_CP014746 (Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence) position: , mismatch: 0, identity: 1.0

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacccatcaagttggctt	Protospacer
******************************

5. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 0, identity: 1.0

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacccatcaagttggctt	Protospacer
******************************

6. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 0, identity: 1.0

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
tgcactgaaataaatgagtttatagcaaat	Protospacer
******************************

7. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP014746 (Campylobacter jejuni strain OD267 plasmid pCJDM67 S, complete sequence) position: , mismatch: 0, identity: 1.0

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacccatcaagttggcttg	Protospacer
*******************************

8. spacer 2.1|386315|30|NZ_CP044171|CRT matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 1, identity: 0.967

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttggctt	Protospacer
*************** **************

9. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 1, identity: 0.967

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttggctt	Protospacer
*************** **************

10. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to CP013734 (Campylobacter coli strain OR12 plasmid pOR12Vir, complete sequence) position: , mismatch: 1, identity: 0.968

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacccatcaagttggctta	Protospacer
******************************.

11. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 1, identity: 0.968

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
tgcactgaaataaatgagtttatagcaaatc	Protospacer
****************************** 

12. spacer 2.1|386315|30|NZ_CP044171|CRT matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 2, identity: 0.933

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggtt	Protospacer
*************** *********** **

13. spacer 2.1|386315|30|NZ_CP044171|CRT matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 2, identity: 0.933

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggtt	Protospacer
*************** *********** **

14. spacer 2.2|386381|30|NZ_CP044171|CRT matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 2, identity: 0.933

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
gcacctgtttttgattgaacgaagcaacca	Protospacer
********************.**.******

15. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 2, identity: 0.933

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggtt	Protospacer
*************** *********** **

16. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 2, identity: 0.933

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggtt	Protospacer
*************** *********** **

17. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 2, identity: 0.933

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
gcacctgtttttgattgaacgaagcaacca	Protospacer
********************.**.******

18. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP007184 (Campylobacter coli RM1875 plasmid pRM1875_35kb, complete sequence) position: , mismatch: 2, identity: 0.935

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacacatcaagttggctta	Protospacer
*************** **************.

19. spacer 2.1|386315|30|NZ_CP044171|CRT matches to NC_017284 (Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence) position: , mismatch: 3, identity: 0.9

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggct	Protospacer
*************** *********** .*

20. spacer 2.5|386316|30|NZ_CP044171|PILER-CR matches to NC_017284 (Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence) position: , mismatch: 3, identity: 0.9

tgatttattagtaacccatcaagttggctt	CRISPR spacer
tgatttattagtaacacatcaagttgggct	Protospacer
*************** *********** .*

21. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to NC_008770 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pVir, complete sequence) position: , mismatch: 3, identity: 0.903

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacacatcaagttgggtta	Protospacer
*************** *********** **.

22. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP010074 (Campylobacter jejuni subsp. jejuni strain 01-1512 plasmid pCj2, complete sequence) position: , mismatch: 3, identity: 0.903

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacacatcaagttgggtta	Protospacer
*************** *********** **.

23. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to MN530981 (Campylobacter phage DA10, complete genome) position: , mismatch: 3, identity: 0.903

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
gcacctgtttttgattgaacgaagcaaccaa	Protospacer
********************.**.******.

24. spacer 2.9|386315|31|NZ_CP044171|CRISPRCasFinder matches to NC_017284 (Campylobacter jejuni subsp. jejuni IA3902 plasmid pVir, complete sequence) position: , mismatch: 4, identity: 0.871

tgatttattagtaacccatcaagttggcttg	CRISPR spacer
tgatttattagtaacacatcaagttgggcta	Protospacer
*************** *********** .*.

25. spacer 2.4|386513|30|NZ_CP044171|CRT matches to MK284526 (Bacillus phage DK1, complete genome) position: , mismatch: 6, identity: 0.8

aataatgatatcgaagttattaatctaatt--	CRISPR spacer
aaaaatgatattgaagttattaatt--atcaa	Protospacer
** ********.************.  **.  

26. spacer 2.4|386513|30|NZ_CP044171|CRT matches to NZ_CP016375 (Elizabethkingia anophelis strain F3201 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

aataatgatatcgaagttattaatctaatt----	CRISPR spacer
aattatgatatcgaagttatt----tcatttgaa	Protospacer
*** *****************    * ***    

27. spacer 2.8|386514|30|NZ_CP044171|PILER-CR matches to MK284526 (Bacillus phage DK1, complete genome) position: , mismatch: 6, identity: 0.8

aataatgatatcgaagttattaatctaatt--	CRISPR spacer
aaaaatgatattgaagttattaatt--atcaa	Protospacer
** ********.************.  **.  

28. spacer 2.8|386514|30|NZ_CP044171|PILER-CR matches to NZ_CP016375 (Elizabethkingia anophelis strain F3201 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.8

aataatgatatcgaagttattaatctaatt----	CRISPR spacer
aattatgatatcgaagttatt----tcatttgaa	Protospacer
*** *****************    * ***    

29. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP039703 (Clostridium butyricum strain 29-1 plasmid p-butyl_plas_29-1, complete sequence) position: , mismatch: 6, identity: 0.806

--tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
cctggatt--aataaatgagattataggaaatg	Protospacer
  ** *.*  ********** ****** *****

30. spacer 2.12|386513|31|NZ_CP044171|CRISPRCasFinder matches to MK284526 (Bacillus phage DK1, complete genome) position: , mismatch: 6, identity: 0.806

aataatgatatcgaagttattaat--ctaattg	CRISPR spacer
aaaaatgatattgaagttattaattatcaat--	Protospacer
** ********.************  ..***  

31. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_AP018539 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

32. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP030044 (Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

33. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

34. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_MK993385 (Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

35. spacer 2.2|386381|30|NZ_CP044171|CRT matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
gcacctgtttgtgcttgaacaaaatcagat	Protospacer
********** ** **********. *   

36. spacer 2.2|386381|30|NZ_CP044171|CRT matches to MW117965 (Synechococcus phage S-H38, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
atagaagtttttgattgaaggaaacaacca	Protospacer
..*   ************* .*********

37. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

38. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

39. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

40. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

41. spacer 2.2|386381|30|NZ_CP044171|CRT matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

42. spacer 2.2|386381|30|NZ_CP044171|CRT matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

43. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

44. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

45. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

46. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

47. spacer 2.2|386381|30|NZ_CP044171|CRT matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

48. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

49. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

50. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

51. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

52. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

53. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

54. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

55. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

56. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

57. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

58. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

59. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

60. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

61. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

62. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

63. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

64. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

65. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

66. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

67. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

68. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135334 (Enterococcus faecium isolate E7471 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

69. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

70. spacer 2.2|386381|30|NZ_CP044171|CRT matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

71. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

72. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

73. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

74. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

75. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

76. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

77. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

78. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

79. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

80. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

81. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

82. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

83. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

84. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

85. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

86. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

87. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

88. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

89. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

90. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

91. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

92. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

93. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

94. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

95. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

96. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

97. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

98. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

99. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

100. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

101. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

102. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

103. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

104. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

105. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

106. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

107. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

108. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

109. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

110. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

111. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

112. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

113. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

114. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

115. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

116. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

117. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

118. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

119. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

120. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

121. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

122. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

123. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

124. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

125. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

126. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

127. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

128. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

129. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

130. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

131. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

132. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

133. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

134. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

135. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

136. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

137. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

138. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

139. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

140. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

141. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

142. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

143. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

144. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

145. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

146. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

147. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

148. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

149. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

150. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

151. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

152. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

153. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

154. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

155. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

156. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

157. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

158. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

159. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

160. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

161. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

162. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

163. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

164. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

165. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

166. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

167. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

168. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

169. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

170. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

171. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP019973 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

172. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

173. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

174. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

175. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

176. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

177. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

178. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

179. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

180. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

181. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

182. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018130 (Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

183. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

184. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

185. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

186. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

187. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

188. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

189. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

190. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

191. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

192. spacer 2.2|386381|30|NZ_CP044171|CRT matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

193. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

194. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

195. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

196. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

197. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

198. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

199. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

200. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

201. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

202. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

203. spacer 2.2|386381|30|NZ_CP044171|CRT matches to MG765277 (Lactobacillus phage Bacchae, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ggtaatgtttttgagtcaacaaaacaacaa	Protospacer
*    ********* * *********** *

204. spacer 2.3|386447|30|NZ_CP044171|CRT matches to MF448564 (Lactococcus phage 62601, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

205. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_049480 (Lactococcus phage CHPC129, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

206. spacer 2.3|386447|30|NZ_CP044171|CRT matches to MN689522 (Lactococcus phage CHPC958, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

207. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_049408 (Lactococcus phage 62605, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

208. spacer 2.3|386447|30|NZ_CP044171|CRT matches to MF448567 (Lactococcus phage 66901, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

209. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_021860 (Lactococcus phage jm2, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

210. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_018992 (Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

211. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_011782 (Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

212. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_017417 (Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

213. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP031400 (Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

214. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_004988 (Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

215. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP017211 (Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

216. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_001849 (Borreliella burgdorferi B31 plasmid lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

217. spacer 2.3|386447|30|NZ_CP044171|CRT matches to MK893987 (Staphylococcus phage PMBT8, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
agaaaagaaataaaagagtttatagaaaaa	Protospacer
 * *  ******** ********** *** 

218. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP019922 (Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

219. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP019851 (Borreliella burgdorferi plasmid lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

220. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP019761 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

221. spacer 2.4|386513|30|NZ_CP044171|CRT matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 7, identity: 0.767

aataatgatatcgaagttattaatctaatt	CRISPR spacer
ttgtatgatatcgaagtaactaatctaatc	Protospacer
    ************* *.*********.

222. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_AP018539 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

223. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP030044 (Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

224. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

225. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_MK993385 (Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ttacttgtttttgattgaacaaaaaaatag	Protospacer
 .**.******************* **. .

226. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
gcacctgtttgtgcttgaacaaaatcagat	Protospacer
********** ** **********. *   

227. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to MW117965 (Synechococcus phage S-H38, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
atagaagtttttgattgaaggaaacaacca	Protospacer
..*   ************* .*********

228. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

229. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

230. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

231. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

232. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

233. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

234. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

235. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

236. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

237. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

238. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

239. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

240. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

241. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

242. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

243. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

244. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

245. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

246. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

247. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

248. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

249. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

250. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

251. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

252. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

253. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

254. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

255. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

256. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

257. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

258. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

259. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135334 (Enterococcus faecium isolate E7471 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

260. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

261. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

262. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

263. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

264. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

265. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

266. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

267. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

268. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

269. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

270. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

271. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

272. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

273. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

274. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

275. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

276. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

277. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

278. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

279. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

280. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

281. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

282. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

283. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

284. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

285. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

286. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

287. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

288. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

289. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

290. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

291. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

292. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

293. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

294. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

295. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

296. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

297. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

298. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

299. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

300. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

301. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

302. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

303. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

304. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

305. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

306. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

307. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

308. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

309. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

310. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

311. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

312. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

313. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

314. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

315. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

316. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

317. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

318. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

319. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

320. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

321. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

322. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

323. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

324. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

325. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

326. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

327. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

328. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

329. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

330. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

331. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

332. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

333. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

334. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

335. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

336. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

337. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

338. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

339. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

340. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

341. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

342. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

343. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

344. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

345. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

346. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

347. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

348. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

349. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

350. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

351. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

352. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

353. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

354. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

355. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

356. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

357. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

358. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

359. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

360. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

361. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

362. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP019973 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

363. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

364. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

365. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

366. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

367. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

368. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

369. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

370. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

371. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

372. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

373. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018130 (Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

374. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

375. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

376. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

377. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

378. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

379. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

380. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

381. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

382. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

383. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

384. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

385. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

386. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

387. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

388. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

389. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

390. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

391. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

392. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

393. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgt	Protospacer
 **..**********.*** ********  

394. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to MG765277 (Lactobacillus phage Bacchae, complete genome) position: , mismatch: 7, identity: 0.767

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
ggtaatgtttttgagtcaacaaaacaacaa	Protospacer
*    ********* * *********** *

395. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to MF448564 (Lactococcus phage 62601, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

396. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_049480 (Lactococcus phage CHPC129, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

397. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to MN689522 (Lactococcus phage CHPC958, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

398. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_049408 (Lactococcus phage 62605, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

399. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to MF448567 (Lactococcus phage 66901, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

400. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_021860 (Lactococcus phage jm2, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ataactgaaataacggagtttatagcataa	Protospacer
   **********  ************ * 

401. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_018992 (Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

402. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_011782 (Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

403. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_017417 (Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

404. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP031400 (Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

405. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_004988 (Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

406. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP017211 (Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

407. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_001849 (Borreliella burgdorferi B31 plasmid lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

408. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to MK893987 (Staphylococcus phage PMBT8, complete genome) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
agaaaagaaataaaagagtttatagaaaaa	Protospacer
 * *  ******** ********** *** 

409. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP019922 (Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

410. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP019851 (Borreliella burgdorferi plasmid lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

411. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP019761 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence) position: , mismatch: 7, identity: 0.767

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ggtgcctaaattaataagtttatagcaaat	Protospacer
 *..*. **** ***.**************

412. spacer 2.8|386514|30|NZ_CP044171|PILER-CR matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 7, identity: 0.767

aataatgatatcgaagttattaatctaatt	CRISPR spacer
ttgtatgatatcgaagtaactaatctaatc	Protospacer
    ************* *.*********.

413. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.774

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
gcacctgtttgtgcttgaacaaaatcagatg	Protospacer
********** ** **********. *   *

414. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

415. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

416. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

417. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

418. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

419. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

420. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

421. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

422. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

423. spacer 2.2|386381|30|NZ_CP044171|CRT matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

424. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ttttttaggataaatgagtttatagtaaat	Protospacer
* . .*...****************.****

425. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

426. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

427. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

428. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

429. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

430. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

431. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

432. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

433. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

434. spacer 2.6|386382|30|NZ_CP044171|PILER-CR matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 8, identity: 0.733

gcacctgtttttgattgaacaaaacaacca	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgt	Protospacer
 * ..**********.*** ********  

435. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP028874 (Borreliella bavariensis PBi plasmid lp25_cp32-3, complete sequence) position: , mismatch: 8, identity: 0.733

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
ttttttaggataaatgagtttatagtaaat	Protospacer
* . .*...****************.****

436. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_AP018539 (Enterococcus faecalis strain KUB3006 plasmid pKUB3006-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
ttacttgtttttgattgaacaaaaaaataga	Protospacer
 .**.******************* **. ..

437. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_MK993385 (Enterococcus faecalis strain P010748 plasmid pEF10748, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
ttacttgtttttgattgaacaaaaaaataga	Protospacer
 .**.******************* **. ..

438. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP030044 (Enterococcus faecalis strain C25 plasmid pC25-2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
ttacttgtttttgattgaacaaaaaaataga	Protospacer
 .**.******************* **. ..

439. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_MK140641 (Enterococcus faecalis strain E035 plasmid pE035, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
ttacttgtttttgattgaacaaaaaaataga	Protospacer
 .**.******************* **. ..

440. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to MW117965 (Synechococcus phage S-H38, complete genome) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
atagaagtttttgattgaaggaaacaaccac	Protospacer
..*   ************* .********* 

441. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

442. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP025426 (Enterococcus faecium strain SC4 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

443. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

444. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040369 (Enterococcus faecium strain VB3240 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

445. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040906 (Enterococcus faecium strain FB-1 plasmid punnamed, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

446. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

447. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

448. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP013995 (Enterococcus faecium strain 6E6 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

449. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP014450 (Enterococcus faecium strain ATCC 700221 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

450. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

451. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027518 (Enterococcus faecium strain AUSMDU00004024 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

452. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

453. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018070 (Enterococcus faecium strain VRE001 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

454. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135246 (Enterococcus faecium isolate E6988 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

455. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135280 (Enterococcus faecium isolate E6975 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

456. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135237 (Enterococcus faecium isolate E7067 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

457. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041256 (Enterococcus faecium strain 515 plasmid p26, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

458. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019989 (Enterococcus faecium isolate 2014-VREF-63 plasmid p63-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

459. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

460. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135476 (Enterococcus faecium isolate E8423 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

461. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135222 (Enterococcus faecium isolate E7040 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

462. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

463. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135358 (Enterococcus faecium isolate E7948 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

464. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP050649 (Enterococcus faecium strain BIOPOP-3 ALE plasmid pBIOPOP-3_ALE) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

465. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP050651 (Enterococcus faecium strain BIOPOP-3 WT plasmid pBIOPOP-3_WT) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

466. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR134108 (Enterococcus faecium isolate E6043 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

467. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP011829 (Enterococcus faecium strain UW8175 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

468. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LN999988 (Enterococcus faecium isolate EFE11651 plasmid II, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

469. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP033042 (Enterococcus faecium strain Enterococcus faecium JE1 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

470. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP025687 (Enterococcus faecium strain CBA7134 plasmid pCBA710401, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

471. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

472. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP032307 (Enterococcus faecium strain HY07 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

473. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019993 (Enterococcus faecium isolate 2014-VREF-268 plasmid p268-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

474. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

475. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035655 (Enterococcus faecium strain UAMSEF_08 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

476. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

477. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035661 (Enterococcus faecium strain UAMSEF_09 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

478. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

479. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035667 (Enterococcus faecium strain UAMSEF_20 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

480. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

481. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035649 (Enterococcus faecium strain UAMSEF_01 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

482. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040851 (Enterococcus faecium strain F17E0263 plasmid p_unnamned2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

483. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP042840 (Enterococcus sp. DA9 plasmid unnamed4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

484. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019973 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-3 sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

485. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019974 (Enterococcus faecium isolate 2014-VREF-114 plasmid p114-4 sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

486. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP033207 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

487. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018129 (Enterococcus faecium strain A_020709_82 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

488. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018130 (Enterococcus faecium strain A_020709_82 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

489. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP042833 (Enterococcus faecium strain FA3 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

490. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP012461 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

491. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP012463 (Enterococcus faecium strain ISMMS_VRE_7 plasmid ISMMS_VRE7_p3, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

492. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LT598664 (Enterococcus faecium isolate Ef_aus00233 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

493. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP011282 (Enterococcus faecium strain E39 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

494. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP015123 (Enterococcus faecium strain E39 plasmid p3, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

495. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to LT603679 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

496. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to LT603680 (Enterococcus faecium isolate Ef_DMG1500501 genome assembly, plasmid: 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

497. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

498. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018832 (Enterococcus faecium strain ISMMS_VRE_9 plasmid p1_ISMMS_VRE9, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

499. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to CP003352 (Enterococcus faecium Aus0004 plasmid AUS0004_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

500. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP020485 (Enterococcus faecium strain CFSAN059070 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

501. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041262 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

502. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041264 (Enterococcus faecium strain VVEswe-R plasmid pVVEswe-R3, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

503. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018073 (Enterococcus faecium strain VRE001 plasmid unnamed3, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

504. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027498 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

505. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027499 (Enterococcus faecium strain AUSMDU00004167 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

506. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027507 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

507. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027508 (Enterococcus faecium strain AUSMDU00004055 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

508. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027502 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

509. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027503 (Enterococcus faecium strain AUSMDU00004142 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

510. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

511. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135288 (Enterococcus faecium isolate E7199 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

512. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135333 (Enterococcus faecium isolate E7471 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

513. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135334 (Enterococcus faecium isolate E7471 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

514. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

515. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

516. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP025756 (Enterococcus faecium strain AALTL plasmid pEFA-99d7, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

517. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027513 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

518. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP027514 (Enterococcus faecium strain AUSMDU00004028 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

519. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP013010 (Enterococcus faecium strain UW7606x64/3 TC1 plasmid pWCF-TC1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

520. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135244 (Enterococcus faecium isolate E6988 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

521. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

522. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135294 (Enterococcus faecium isolate E7237 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

523. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135255 (Enterococcus faecium isolate E7098 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

524. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135257 (Enterococcus faecium isolate E7098 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

525. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135236 (Enterococcus faecium isolate E7067 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

526. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135199 (Enterococcus faecium isolate E6055 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

527. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135259 (Enterococcus faecium isolate E4457 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

528. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

529. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041254 (Enterococcus faecium strain 515 plasmid p169, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

530. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NC_021995 (Enterococcus faecium Aus0085 plasmid p2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

531. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019209 (Enterococcus faecium strain 2014-VREF-41 plasmid p41-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

532. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP017798 (Enterococcus faecium strain E243 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

533. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP017799 (Enterococcus faecium strain E243 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

534. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135429 (Enterococcus faecium isolate E8927 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

535. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135436 (Enterococcus faecium isolate E8691 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

536. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135483 (Enterococcus faecium isolate E4456 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

537. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135204 (Enterococcus faecium isolate E7171 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

538. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135175 (Enterococcus faecium isolate E4402 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

539. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135227 (Enterococcus faecium isolate E7025 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

540. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135228 (Enterococcus faecium isolate E7025 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

541. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

542. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

543. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135220 (Enterococcus faecium isolate E7040 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

544. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135221 (Enterococcus faecium isolate E7040 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

545. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

546. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

547. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NC_021987 (Enterococcus faecium Aus0085 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

548. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

549. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135325 (Enterococcus faecium isolate E7654 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

550. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135326 (Enterococcus faecium isolate E7654 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

551. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

552. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135352 (Enterococcus faecium isolate E8014 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

553. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

554. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135386 (Enterococcus faecium isolate E7933 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

555. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP044265 (Enterococcus faecium strain V1836 plasmid pHVH-V1836-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

556. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135318 (Enterococcus faecium isolate E7663 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

557. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135319 (Enterococcus faecium isolate E7663 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

558. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR134106 (Enterococcus faecium isolate E6043 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

559. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135373 (Enterococcus faecium isolate E8172 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

560. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135374 (Enterococcus faecium isolate E8172 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

561. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP006031 (Enterococcus faecium T110 plasmid pEFT110, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

562. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_AP019395 (Enterococcus faecium strain QU 50 plasmid pQL50, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

563. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP045013 (Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

564. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040741 (Enterococcus faecium strain VRE1 plasmid pVRE1-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

565. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP014530 (Enterococcus faecium strain E745 plasmid pl1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

566. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP014534 (Enterococcus faecium strain E745 plasmid pl5, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

567. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023424 (Enterococcus faecium strain K60-39 plasmid pTT39_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

568. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023425 (Enterococcus faecium strain K60-39 plasmid pTT39_p2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

569. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_AP022342 (Enterococcus faecium strain KUHS13 plasmid pKO1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

570. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041273 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S3, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

571. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

572. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040876 (Enterococcus faecium strain DB-1 plasmid punnamed2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

573. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

574. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP017793 (Enterococcus faecium strain E240 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

575. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP017794 (Enterococcus faecium strain E240 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

576. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

577. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023790 (Enterococcus faecium strain Efaecium_ER04462.3A plasmid pER04462.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

578. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

579. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023800 (Enterococcus faecium strain Efaecium_ER04526.5A plasmid pER04526.5A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

580. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035137 (Enterococcus faecium strain SRCM103341 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

581. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135192 (Enterococcus faecium isolate E4438 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

582. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135193 (Enterococcus faecium isolate E4438 plasmid 3) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

583. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP041271 (Enterococcus faecium strain VVEswe-S plasmid pVVEswe-S1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

584. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135308 (Enterococcus faecium isolate E7240 plasmid 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

585. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040237 (Enterococcus faecium strain VB3025 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

586. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

587. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

588. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023809 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

589. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023812 (Enterococcus faecium strain Efaecium_ER04526.3A plasmid pER04562.3A.5, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

590. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP033208 (Enterococcus faecium strain RBWH1 plasmid pRBWH1.2, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

591. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

592. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023805 (Enterococcus faecium strain Efaecium_ER04619.3A isolate isolate plasmid pER04619.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

593. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP035221 (Enterococcus faecium strain SRCM103470 plasmid unnamed1) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

594. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

595. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

596. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP034948 (Enterococcus faecium strain NM213 plasmid unnamed5, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

597. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP016164 (Enterococcus faecium strain ISMMS_VRE_11 plasmid ISMMS_VRE11_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

598. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

599. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP018827 (Enterococcus faecium strain ISMMS_VRE_12 plasmid p1_ISMMS_VRE12, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

600. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to LR135186 (Enterococcus faecium isolate E4413 genome assembly, plasmid: 2) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

601. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP012432 (Enterococcus faecium strain ISMMS_VRE_1 plasmid ISMMS_VRE_p1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

602. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

603. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023795 (Enterococcus faecium strain Efaecium_ER04484.3A plasmid pER04484.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

604. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

605. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP023781 (Enterococcus faecium strain Efaecium_ER03933.3A isolate isolate plasmid pER93933.3A.1, complete sequence) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

606. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LT598666 (Enterococcus faecium isolate Ef_aus00233 plasmid 4) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcatttgtttttgatcgaagaaaacaacgtt	Protospacer
 **..**********.*** ********   

607. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to MG765277 (Lactobacillus phage Bacchae, complete genome) position: , mismatch: 8, identity: 0.742

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
ggtaatgtttttgagtcaacaaaacaacaac	Protospacer
*    ********* * *********** * 

608. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to MF448564 (Lactococcus phage 62601, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

609. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_049480 (Lactococcus phage CHPC129, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

610. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to MN689522 (Lactococcus phage CHPC958, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

611. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_049408 (Lactococcus phage 62605, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

612. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to MF448567 (Lactococcus phage 66901, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

613. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_021860 (Lactococcus phage jm2, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ataactgaaataacggagtttatagcataat	Protospacer
   **********  ************ *  

614. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019922 (Borreliella burgdorferi strain PAbe plasmid p_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

615. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019851 (Borreliella burgdorferi plasmid lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

616. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP019761 (Borreliella burgdorferi strain B31_NRZ isolate B31 plasmid p_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

617. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_018992 (Borrelia burgdorferi 297 plasmid 297_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

618. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_011782 (Borreliella burgdorferi ZS7 plasmid ZS7_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

619. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_017417 (Borreliella burgdorferi N40 plasmid N40_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

620. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP031400 (Borreliella burgdorferi strain MM1 plasmid plsm_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

621. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_004988 (Borrelia burgdorferi ATCC 35210 plasmid lp16.9, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

622. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP017211 (Borreliella burgdorferi strain B331 plasmid B331_lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

623. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_001849 (Borreliella burgdorferi B31 plasmid lp17, complete sequence) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
ggtgcctaaattaataagtttatagcaaata	Protospacer
 *..*. **** ***.**************.

624. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to MK893987 (Staphylococcus phage PMBT8, complete genome) position: , mismatch: 8, identity: 0.742

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
agaaaagaaataaaagagtttatagaaaaac	Protospacer
 * *  ******** ********** ***  

625. spacer 2.12|386513|31|NZ_CP044171|CRISPRCasFinder matches to MT497068 (Flavobacterium phage vB_Fsp_elemo14-3B, partial genome) position: , mismatch: 8, identity: 0.742

aataatgatatcgaagttattaatctaattg	CRISPR spacer
ttgtatgatatcgaagtaactaatctaatca	Protospacer
    ************* *.*********..

626. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

627. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

628. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

629. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

630. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

631. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

632. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

633. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

634. spacer 2.3|386447|30|NZ_CP044171|CRT matches to NZ_CP028567 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
aattctgaaataaaggagtttagagcatga	Protospacer
 .. ********** ******* **** . 

635. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

636. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

637. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

638. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

639. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

640. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

641. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

642. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaac	Protospacer
 ....  **************** *****.

643. spacer 2.7|386448|30|NZ_CP044171|PILER-CR matches to NZ_CP028567 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence) position: , mismatch: 9, identity: 0.7

tgcactgaaataaatgagtttatagcaaat	CRISPR spacer
aattctgaaataaaggagtttagagcatga	Protospacer
 .. ********** ******* **** . 

644. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP046076 (Enterococcus faecium strain VRE plasmid p5_03A17012, complete sequence) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

645. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP040905 (Enterococcus faecium strain N56454 plasmid unnamed, complete sequence) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

646. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP015517 (Enterococcus hirae strain R17 plasmid, complete sequence) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

647. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135783 (Enterococcus faecium isolate E4239 plasmid 2) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

648. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

649. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135180 (Enterococcus faecium isolate E0595 plasmid 2) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

650. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR132068 (Enterococcus faecium isolate E0139 plasmid 2) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

651. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_LR135171 (Enterococcus faecium isolate E4227 plasmid 2) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

652. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP037956 (Enterococcus hirae strain CQP3-9 plasmid pCQP3-9_1, complete sequence) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

653. spacer 2.10|386381|31|NZ_CP044171|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 9, identity: 0.71

gcacctgtttttgattgaacaaaacaaccag	CRISPR spacer
tcttttgtttttgatcgaagaaaacaacgtt	Protospacer
 * ..**********.*** ********   

654. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP028567 (Aeromonas hydrophila subsp. hydrophila strain WCHAH045096 plasmid pMCR5_045096, complete sequence) position: , mismatch: 9, identity: 0.71

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
aattctgaaataaaggagtttagagcatgag	Protospacer
 .. ********** ******* **** . *

655. spacer 1.1|284420|34|NZ_CP044171|CRISPRCasFinder matches to MH752385 (Bacillus phage Ray17, complete genome) position: , mismatch: 10, identity: 0.706

ttttttagctttatactcagccttactcatataa	CRISPR spacer
cttacaagctttatactcagccttattgatcgtt	Protospacer
.** . *******************.* **    

656. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP053970 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed2, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

657. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP053979 (Bacillus thuringiensis strain FDAARGOS_795 plasmid unnamed3, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

658. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP013277 (Bacillus thuringiensis serovar israelensis strain AM65-52 plasmid pAM65-52-2-350K, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

659. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP039723 (Bacillus thuringiensis strain BT-59 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

660. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP009348 (Bacillus thuringiensis HD1002 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

661. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP045024 (Bacillus thuringiensis strain JW-1 plasmid p2, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

662. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NC_018516 (Bacillus thuringiensis HD-789 plasmid pBTHD789-1, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

663. spacer 2.11|386447|31|NZ_CP044171|CRISPRCasFinder matches to NZ_CP009334 (Bacillus thuringiensis strain HD1011 plasmid 2, complete sequence) position: , mismatch: 10, identity: 0.677

tgcactgaaataaatgagtttatagcaaatg	CRISPR spacer
gatgtgcaaataaatgagtttatcgcaaaca	Protospacer
 ....  **************** *****..

2. NZ_CP044170

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044170_1

• CRISPR_ID: NZ_CP044170_1
• CRISPR_location: 18983-19173
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 2 spacers

Consensus repeat of NZ_CP044170_1

Consensus_repeat	Method
ATTGACATAAATAGAATAGTTT	PILER-CR

spacers of NZ_CP044170_1

>1.1|19005|53|NZ_CP044170|PILER-CR
ATTATATTTATGTCAGCAAAATCAGCATACAATCACTCATAAGTTATTAAAAA
>1.2|19080|72|NZ_CP044170|PILER-CR
TTGACATAAATAGAATAGTTTTTGACATTTTTTCGGAAACCCCATATGGAAAATAGGGACTTTAAAAGATAC

CRISPR arrays and Neighbor proteins around NZ_CP044170_1

CRISPR arrays

The CRISPR arrays of NZ_CP044170_1

>merge|NZ_CP044170|1|18983-19173|PILER-CR
ATTGACATAAATAGAATAGTTTATTATATTTATGTCAGCAAAATCAGCATACAATCACTCATAAGTTATTAAAAAATTGACATAAATAGAATAGTTTTTGACATAAATAGAATAGTTTTTGACATTTTTTCGGAAACCCCATATGGAAAATAGGGACTTTAAAAGATACATTGACATAAATAGAATAGTTA

>NZ_CP044170|1|1|18983-19173|PILER-CR
ATTGACATAAATAGAATAGTTT	ATTATATTTATGTCAGCAAAATCAGCATACAATCACTCATAAGTTATTAAAAA
ATTGACATAAATAGAATAGTTT	TTGACATAAATAGAATAGTTTTTGACATTTTTTCGGAAACCCCATATGGAAAATAGGGACTTTAAAAGATAC
ATTGACATAAATAGAATAGTTA

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044170.1|WP_057098296.1|10508_10832_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002809051.1|10822_11200_+|hypothetical-protein	unknown	unknown	gnl|CDD|225846
NZ_CP044170.1|WP_057098290.1|24672_25224_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002779713.1|26707_27562_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_025006608.1|25223_26612_+|relaxase/mobilisation-nuclease-domain-containing-protein	unknown	unknown	gnl|CDD|367497
NZ_CP044170.1|WP_057098295.1|12063_14274_+|sensor-histidine-kinase	unknown	unknown	gnl|CDD|372641
NZ_CP044170.1|WP_021358079.1|11196_11811_+|resolvase	unknown	unknown	gnl|CDD|184041
NZ_CP044170.1|WP_002869705.1|10076_10340_-|TrbC/VirB2-family-protein	unknown	unknown	gnl|CDD|368210
NZ_CP044170.1|WP_002808969.1|19511_20684_+|protein-kinase-family-protein	unknown	unknown	gnl|CDD|270622
NZ_CP044170.1|WP_002809302.1|20833_21043_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002809200.1|16680_18474_-|AAA-family-ATPase	unknown	unknown	gnl|CDD|316042
NZ_CP044170.1|WP_019109225.1|21202_21466_-|EexN-family-lipoprotein	unknown	unknown	unknown
NZ_CP044170.1|WP_002809196.1|18564_18783_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin	unknown	unknown	gnl|CDD|224514
NZ_CP044170.1|WP_002809140.1|24197_24479_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_004311642.1|7289_10058_-|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase	unknown	unknown	gnl|CDD|273346
NZ_CP044170.1|WP_057098291.1|22894_23554_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_151036950.1|14215_15280_+|response-regulator	unknown	unknown	gnl|CDD|381122
NZ_CP044170.1|WP_057098293.1|15272_16529_-|DNA-cytosine-methyltransferase	unknown	unknown	gnl|CDD|365904
NZ_CP044170.1|WP_002826068.1|23557_24169_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_057098292.1|21580_22813_-|hypothetical-protein	unknown	unknown	gnl|CDD|226990

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP044170.1|WP_002809051.1|10822_11200_+|hypothetical-protein	gnl|CDD|225846	COG3309, VapD, Uncharacterized virulence-associated protein D [Function unknown].	6.64868e-09
NZ_CP044170.1|WP_025006608.1|25223_26612_+|relaxase/mobilisation-nuclease-domain-containing-protein	gnl|CDD|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	5.41596e-05
NZ_CP044170.1|WP_057098295.1|12063_14274_+|sensor-histidine-kinase	gnl|CDD|372641	pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.	2.02613e-18
NZ_CP044170.1|WP_021358079.1|11196_11811_+|resolvase	gnl|CDD|184041	PRK13413, mpi, master DNA invertase Mpi family serine-type recombinase.	3.57995e-39
NZ_CP044170.1|WP_002869705.1|10076_10340_-|TrbC/VirB2-family-protein	gnl|CDD|368210	pfam04956, TrbC, TrbC/VIRB2 family. Conjugal transfer protein, TrbC has been identified as a subunit of the pilus precursor in bacteria. The protein undergoes three processing steps before gaining its mature cyclic structure. This family also contains several VIRB2 type IV secretion proteins. The virB2 gene encodes a putative type IV secretion system and is known to be a pathogenicity factor in Bartonella species.	8.40975e-06
NZ_CP044170.1|WP_002808969.1|19511_20684_+|protein-kinase-family-protein	gnl|CDD|270622	cd00180, PKc, Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.	4.4139e-39
NZ_CP044170.1|WP_002809200.1|16680_18474_-|AAA-family-ATPase	gnl|CDD|316042	pfam13481, AAA_25, AAA domain. This AAA domain is found in a wide variety of presumed DNA repair proteins.	3.82726e-15
NZ_CP044170.1|WP_002809196.1|18564_18783_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin	gnl|CDD|224514	COG1598, COG1598, Predicted nuclease of the RNAse H fold, HicB family [General function prediction only].	2.70969e-11
NZ_CP044170.1|WP_004311642.1|7289_10058_-|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase	gnl|CDD|273346	TIGR00929, CAG_pathogenicity_island_protein_23, type IV secretion/conjugal transfer ATPase, VirB4 family. Type IV secretion systems are found in Gram-negative pathogens. They export proteins, DNA, or complexes in different systems and are related to plasmid conjugation systems. This model represents related ATPases that include VirB4 in Agrobacterium tumefaciens (DNA export) CagE in Helicobacter pylori (protein export) and plasmid TraB (conjugation).	0
NZ_CP044170.1|WP_151036950.1|14215_15280_+|response-regulator	gnl|CDD|381122	cd17586, REC_PFxFATGY, phosphoacceptor receiver (REC) domain of PFxFATGY motif single-domain (stand-alone) response regulators. This subfamily is composed of stand-alone response regulators (RRs) containing the PFxFATG[G/Y] motif; RRs with such a motif are also called ''FAT GUY'' response regulators. Included in this subfamily are Sphingomonas melonis SdrG, Sinorhizobium meliloti Sma0114, and Erythrobacter litoralis EL_LovR. SdrG is involved in the control of the general stress response. Sma0114 is part of the Sma0113/Sma0114 two-component system (TCS) that is involved in catabolite repression and polyhydroxy butyrate synthesis. EL_LovR is involved in a light-regulated TCS. PFxFATG[G/Y] RRs are typically associated with histidine-tryptophan-glutamate (HWE) histidine kinases that constitute a subclass of the larger histidine kinase superfamily characterized by an altered ATP binding site, which lacks the F-box that is normally an integral component of the ATP lid. The PFxFATG[G/Y] motif is involved in conformational changes after phosphorylation that results in the activation of the RR. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.	3.20599e-06
NZ_CP044170.1|WP_057098293.1|15272_16529_-|DNA-cytosine-methyltransferase	gnl|CDD|365904	pfam00145, DNA_methylase, C-5 cytosine-specific DNA methylase.	1.38477e-64
NZ_CP044170.1|WP_057098292.1|21580_22813_-|hypothetical-protein	gnl|CDD|226990	COG4643, COG4643, Uncharacterized protein conserved in bacteria [Function unknown].	2.71877e-27

Protein sequences

>NZ_CP044170.1|WP_002809196.1|18564_18783_-|type-II-toxin-antitoxin-system-HicB-family-antitoxin
MLLNIIIEKDRDRYFARILELEGCVSQGNTYEEALANIKEAGELYLESLANEEKRIIENKTTSIIPMVLANA
>NZ_CP044170.1|WP_002809200.1|16680_18474_-|AAA-family-ATPase
MPKRNTINTITLGIFSDENVSVICEDTIKLERGSVAVLSGNSEVGKSFLALKVCANAINDGLKPFFWSIEDKNKAILERIKNIENFYPFNSLEFEFSNELPKIDKEPMDSLKEELNELADCDLIVLDTFSAFFSILGFKDQNNQNDVQNFFNILTDVAKSNNQAILLLHHLDKKGESLMGSSVIINAPRLVYKLSFQKGEDKSSTTYRLLEVLKDNNNINAGEFQKTIKVLQNSSIDEPLIKDVKVENIDNHTLEIINKKDISAVSVNDLAEGYVTMNENRGVFYLSSRKLADSNFYKYFKENDNKIEFGMLGANGSSYAITLKNSLLTQTHRSILDALFLYIKKNVDTSVIKKYQENFWDMEVRLEPYKFLKQYLNKAPSNYSWLKQKFTEISRFAYDLAFTQNIEDKDKKTITQRDKGILMFDSVERITKENGVIVSVFVLTVRREYIKRLETESTLSYDDDLSKILIDLNSLVAQDLIRFLTSFPDKKILSYSEFCEIKAYRLYKESSIISKQKKEIVKLKDKLIEFGINVYGKGVEFANYDDEFFYNQYKNENDLFFIYQSNNRVKRYIKRSDPMNQLNTKSNKFLLQKSLFD
>NZ_CP044170.1|WP_057098293.1|15272_16529_-|DNA-cytosine-methyltransferase
MVVLDLFSGAGGLSEGFFRANSTFVAHIESDKYACETLKTRTSYWKLKKNNNLNIYYDYLLKKITKEQLWELTNTSDSEEVICKEISEHNFDSLVSKIKNNLKKTLSKNIDVIIGGPPCQAYSIIGRARMKNSIENDHRNYLYKYYVKFLNIFKPKIFVFENVPGIKSAGNGKYFDDLKKSIEDIGYSIQIKELIASDFGVLQNRKRIIIVGFKIKKNKKYSYPIFEKIENKNYFVKDVLSDLPKINPGEKIEGLNKYTKKTNSYLKMANIRDANFNILTQHETRPHNDRDREIYKEAILVWNTKRERLCYKKLALTRPELISHKNTNSFTNRFNVIKENTNASHTILAHMAMDGHYYIHPDITQLRSLSIREAARLQSFPDDFYFEGPRTSIFRQIGNAVPPKMAEQIAKKIKELII
>NZ_CP044170.1|WP_151036950.1|14215_15280_+|response-regulator
MKGFILKYVLRILRMNKQVETIRILFVDDNQETLDSYEESIKVENDSLQEESMQYKAYKALTYEKALDILDENRIDIAVIDLDLGSEFTGEDITKYILKRYSIPIFIATGKPADFDSKLIGPMVKVLNRDDMSLLNEIKKQMQSKLVRFFSKNNGFLERQIVEFFWEHMSKNLPYWEQYAIDEIDLILLRHTTACLNEKLYVNNSGEKYFNKYHPGEMYIYPFIKGRHHTGDIVKKNDDFFIILTPSCDIVNDKNDYYILARIINYDKNNNSNRIPERFYFIKNFAKIFEVDNKDKEILKPSICFQGLISVKKEEISDYARVASISYPFLKDIIAKFSRYYARQGSPEIIEELK
>NZ_CP044170.1|WP_057098295.1|12063_14274_+|sensor-histidine-kinase
MKKELKIRPEARLIKTIGEDLIKNPYAAVVELIKNSYDADSEKVTISIELTNEYVYDKKQKFLKFTIEDDGEGMSLETIKNTWMVPATSYKVNKQYSSKKKRVVQGKKGIGRYASAILGDFLRITTTDLNGMTSIIEIDWKQFDDGKFLDEINIPYECNRTNLKSGTKIEIYSSIEVYYDVSNQQYKDSINWNKNQNNLLFKELRKLLVPVDKSNEIFEIRFSTNGLIEFEIEDKNEKIEPFPLLNSYEYRIKGKISSNGKGLLFYENKNFENSNEKIELDLRDTCGNICGNIEVDLMVFDLDPDVIQNLVNKQKDKEEKQLGKSEFKALIKQYSGVGIYRNLFRIRPYGDYDFDWLGLNARRVNNPTMSISNNQIAGFVSIESENKSNLIEKSDREGLKENENYNNLKNILLQVLSEVEKRRCEFRKNTKRGRVVANNIKDTIRDVFSFDDVNNKISVILHKANIDAHIIEKVQFELKQEEIKKNNDLKNIEEVLAMYEAHAALGKLVLYVLHEGRKPMQIIGLKLNNLKKSLQRFIKTKDESIEQNIKKYNEDSLSQLEKLSNLFKRLDPLMITRSSRRKEVNLYQNALNNYELFKEILKRENIDFEIQCENKELFIYGRDEDLYIIYSNLIENSLYWFQATKQMQKKITISIYRDSNYFYIDYKDNGIGVKKEHANLIFDPGFSTKPEGGTGIGLTIVGQAVSRNDGEIKYIRADEGVYFKICFKDTQNEQTS
>NZ_CP044170.1|WP_021358079.1|11196_11811_+|resolvase
MNIAYIRVSTNKQELDSQKLEIMEYCHKNNIHLDEILEVKISSTKSQEKRKIKDLKQKLKAGDLLIATELSRLGRSMLEIINLVLEFNSNNIKFLFLRQMELSNFNNPASKLILSVYAYLAENERDLISQRTKAGLENARASGKKLGRPKGSLNSIYDKDIDKIQTLLDKDLSIKSIWKLLYKDDGKSYDGLLWFIKKRKLKGN
>NZ_CP044170.1|WP_002809051.1|10822_11200_+|hypothetical-protein
MGINRKAINFDLSTKSLEKYFKDTREPYSLIKKFMLENGFEHRQYSGYTSKEPINERRVIRIVNKLTKKFTWLGECVKEFDITEIGEQYSLKETIQDLCAKDFHQKLKEFTEKTPKNQKLKDLER
>NZ_CP044170.1|WP_057098296.1|10508_10832_+|hypothetical-protein
MAYPLLGTKIVLDEEKILKEGKYNLEDMYKMIDEYAKESGMIKINKETYHCKGDKYDLGCMTLFIYKYLIDSEWFTKNAKEWIWISEKEGNSDLISASKAEGEGIWE
>NZ_CP044170.1|WP_002869705.1|10076_10340_-|TrbC/VirB2-family-protein
MKKRLLSLILISPIFAFGAGGIDKVNTFMQNLSIALYALGGVLLTIALMWCASRIMYQGQTLREVAPVFIGGVIFGSASAIAGYIIT
>NZ_CP044170.1|WP_004311642.1|7289_10058_-|VirB4-family-type-IV-secretion/conjugal-transfer-ATPase
MEKNPLFKGLTRPPMIFGVPMTPFVIAMGCIILIAFYSQNIFLVGFSIPVFFIMKAMTKRDDFIFRLMFLKMRFFSNPASKNYHKVKTYSTNSYRQMPPNSNFPKISVFGLNAEPNFEKLIPFSSLINDSVVITKDYLLMTTWEIGGISFEAEDDDELDIKNDLLNMLFKSFANEPVSFYFHNCRYSIEDKLTSKFNNAFLEEIDRKYYESFKQGTLRKNSLYLTLIFNPLKVKIEKTTFMKSSFENKRKTISVFLAKFSEFADRLEANIKDFNPKRLKTYSKDDKTYSKQLEFYNYLLGGKFNPIRVLSSPIDQYLNGNLQNIQFGHDTIQFNQNDSTKKFARCIEIKDYTNETFAGILDILMYLDVEYTITQSFSPIPRVDAKSAISKQKKQLIATEDDGFSQVEQIDEALDQLTNGEISFGKYHFSILVYGNTIKECKDNTNEVVTKMNELGFGVTLATIALPATFFSQLPSNFAIRPRINLISSINYSSLIALHNFSMGKRDKNCWGDAVSILKTPNKQPYYFNFHQSSGANKNDFGELFLANTLILGQSGGGKTVFMNFIVDQMMKYASKDTFPDDIPEENRKFTAIYLDKDKGALGNILCAGGRYISIENGKPTGFNPFMVESTQENIRQLQSLMKLLVTRNNEILTTREEEMLNNAVNSLMKGFEKEERKYPISLLLENLTENVDDDNSLKSRLALFKKGKQFGWVFDNEYDNLDFPDDINLFGIDGTEFLDDKDVSGILSYYILWRVMSLADGRRLCIDIDEAWKWLENEIVQEEVKNKFKTIRKQNGFLRLATQSVEDFLKLKNATTLIEQSATMVFLPNPKAKEEEYVNGIGLSYDEYMIIKSFKPSKRQFLIKRQDEKVICTLDLSSLGNENLKILSTGTAHIDTIEKIFSQENKSLDEKVLELKEFYKNS
>NZ_CP044170.1|WP_002808969.1|19511_20684_+|protein-kinase-family-protein
MDPIVNNHLINAYKDLESSLSQAYTDLYFCFENGKLKLVLSTLHNNIIECFKKMNSRLPSTENSNNHYWADDSRKLKFNIELALYLQKEFKDSELSFWIDEYYYNVFKQCLNFLKSSEGSEIPLGMQKITIYEAIPIFVKLNSISNPEVNKNYSLDLIGDGSYAKVYKYYDEFYKHYFALKKLNKKVNDKEIQRFIKEFNIMKQINNPYILKVYSLDENKKEYIMEYVDFTLKEYIHKNNSKLSSDERISLGIQIIKGIKTLWNKNILHRDISLKNILIKQYDDIVVIKISDFGLVKELNSELTSENTEIKGSLNEISRLQKKGFNNYDKSDEIYALSRVLYFIATGRTNLINTKCDFLEKGINDNVKNRYNNLDDLMRDFKHYIKKIYN
>NZ_CP044170.1|WP_002809302.1|20833_21043_+|hypothetical-protein
MARDKSKDDNLFNCSQDYEHDHVVRQYPKEYQDKIRDFLKKACQNKKIYHSKHKEVYDLIEKELGYFTD
>NZ_CP044170.1|WP_019109225.1|21202_21466_-|EexN-family-lipoprotein
MKNTIKLALLGAVITGVFSACSSEPKTVQYYEDPKNATELEAKIKECDKNANSAQTDTECANAYKANYSKSLQKPRESAMEFFKNNK
>NZ_CP044170.1|WP_057098292.1|21580_22813_-|hypothetical-protein
MPQKRIYLYVPFKDKEKVKSLGAMWDDKEKKWFAPKSLDKNIFSQWLYPHQNKEFSFDENEVLTTFKSALENQGLIVDGLPIMDGKIHRVKTTTDKGREMSGAYSGFLDEYPAGFIQNFKTGIKENWKMPLENAKQNIVSYQTPSQKRLHNSTRNNTKQDILELQQKTALKIEEEYNQANWAHSNHPYLKKKGFSENFYLKQDNKGSLLIPLKDENGKLWSVQRIFPNGDKIIGVIKTKEEKEQGIEYSAKKSGCFHLIGAKNLEYCKEFIIAEGFATAATIYKALNKPVIMGIDAGNLSKIVETLKNKFQNTPITLIADNDKKRELKGLSNVGVETAKEIQQKFSDIKVIIPKISNQEAEQGISDFNDIFLNKGLDEVKKQLNFIDFHNKLKAFKSMEKTQPEKEITRQ
>NZ_CP044170.1|WP_057098291.1|22894_23554_-|hypothetical-protein
MNNTINFNKLFSQIRLSSYDNNIVKHYDNLKLVGKITPKIATLEIILRNKLDNKLSEQDSNWIKNSNDENIKKAKDEIEKREKNRILSHHQYLSRISLGTIIYLIKENRMQDSIMNLKNINFRNYNQYNRNFFLKNGKKRNFGNIYKVDIVLSLLQNLRNRSYHWENILKTTEKNGKHYPRLTTKIENVYIGINPQKIELFLDDLIKTFDERILKYCQD
>NZ_CP044170.1|WP_002826068.1|23557_24169_-|hypothetical-protein
MEKDYKIKVTDVSELNEQYKEAIQEGTYEGEDVNKFFNTIKTFDVAESLLKKDFSNQYIKFDIITDKEKIPLNIRLGDKNFQKGIEHLINIGSSKLIKENINPEIKKDLNNRLGIYKPKIYDEMLDGTFKAIKNLSEVANKDVGVMILEFANSYSETREKFEKKQINKSSFFKEKMNEFFKKKLNKILPDREISNEKTYSRSR
>NZ_CP044170.1|WP_002809140.1|24197_24479_-|hypothetical-protein
MFKESKLIEELKREYDEKLKKLRQKEKENKERIYKKFSSALFKDFEINEDFKNEFNLLVEKFDCKNTKNILDKINNLYDFNHRNDKIDTAKKQ
>NZ_CP044170.1|WP_057098290.1|24672_25224_+|hypothetical-protein
MNKNNNCVIKVSKDDKIILEYIKSKTNASYSKIISILLKKFNSCDADEKNKINNEISKNKFYTSDENKIIKLKLTENEVNILKEISKNTGFSSITKQAKFLLLNSIKNEKLFTNIEIDKFIKTRTEINAIGKNIYQLLKILRSGNSVKINENNLNKTMDNIRDKIDILSDQLGAIIEKNNERI
>NZ_CP044170.1|WP_025006608.1|25223_26612_+|relaxase/mobilisation-nuclease-domain-containing-protein
MSRSIRIFDDEIIAKKVFTKIENASKLPLNYINKNRDKYAKDIKTGKLVSKNMFRKNTEVVVKITSGSKNSQALSKHLDYISRDGNVELITNDFDRYAGEDEILEVKRIFKNEGSPIPLYKEGAKEKRHTINMVFSMKEHSTTPKEKLQQAVITTLKRMYPNNFFVVAFHNDTDNPHCHVCLKVADKNGKRINPKKADLANLRAEFAKALNELGVEAKATNKKQREVEINQEISVKLNTNNEINQAPKIKMHYYQVMDFGEANYQFSTDKNAKKSYYVSYKTKKGITTIWGQDLERVVRENKVLRGEYARFKIVGQEKYEIKRKAKINNKWQEVVKTLKKPIWEVSVIGREKDLKQINKAKTTKKYKIIQDKGVNNERDYTKQYRQRVLQELGNKSTIRRETAQERNSMRILSKQPMVHNTKRTQMLLHINALNQLQQGERGRSDNILRWTSARNNEIERDG
>NZ_CP044170.1|WP_002779713.1|26707_27562_+|hypothetical-protein
MKKIILILAVLSGCLFASDELNIDSLFKKQIGLRSITSLSLLSTGNPHSYYIYPNIGVNGDLNVWNDTKQLYLNQTFIYTLTPNFDLLISGGGNYARQEYNNIISGAFTSKNTLNFDSLWIGFIYTGESIADFVPQIKFQTAIIQREKTVLQTKNFYFQSQNLEASLRGYSDPVVYSIYTGFGYNAQRKFKIAKIDYGNSIYFGGNLSIILSPKITLDLGAEQRFQTEQKINGVKNSEIRSIPTISGGSTYSINQDTAVSVSASLGGSSAAPDAIFGINLWKKF

Crispr_ID: NZ_CP044170_2

• CRISPR_ID: NZ_CP044170_2
• CRISPR_location: 42571-42710
• CRISPR_type: Orphan
• Repeat_type: NA
• Spacer_info: 1 spacers

Consensus repeat of NZ_CP044170_2

Consensus_repeat	Method
CACCTCACTCCCTCTCGCCTTGACCGCTAATCTTATCAAT	CRISPRCasFinder

spacers of NZ_CP044170_2

>2.1|42611|60|NZ_CP044170|CRISPRCasFinder
GAGTTTTTTTTACCTTTTTCCGTCAAGTATAAGGGAGTGCCTTTTTGATGTCAATATCTA

CRISPR arrays and Neighbor proteins around NZ_CP044170_2

CRISPR arrays

The CRISPR arrays of NZ_CP044170_2

>merge|NZ_CP044170|2|42571-42710|CRISPRCasFinder
CACCTCACTCCCTCTCGCCTTGACCGCTAATCTTATCAATGAGTTTTTTTTACCTTTTTCCGTCAAGTATAAGGGAGTGCCTTTTTGATGTCAATATCTACACCTCACTCCCTCTCGCCTTGACCGCTAATCTTATCAAT

>NZ_CP044170|2|1|42571-42710|CRISPRCasFinder
CACCTCACTCCCTCTCGCCTTGACCGCTAATCTTATCAAT	GAGTTTTTTTTACCTTTTTCCGTCAAGTATAAGGGAGTGCCTTTTTGATGTCAATATCTA
CACCTCACTCCCTCTCGCCTTGACCGCTAATCTTATCAAT

Neighbor Proteins Overview

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044170.1|WP_002834234.1|40514_40868_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002779703.1|39451_40009_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_008976813.1|43214_43517_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_105100895.1|49106_49292_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_052775856.1|31721_32426_+|GNAT-family-N-acetyltransferase	unknown	unknown	unknown
NZ_CP044170.1|WP_002790440.1|41050_41239_-|hypothetical-protein	unknown	unknown	gnl|CDD|224162
NZ_CP044170.1|WP_057098419.1|48671_49016_-|hypothetical-protein	unknown	unknown	gnl|CDD|227348
NZ_CP044170.1|WP_001255868.1|46027_46894_-|aminoglycoside-6-adenylyltransferase-AadE	unknown	unknown	gnl|CDD|377357
NZ_CP044170.1|WP_002779755.1|44312_44486_-|conjugal-transfer-protein	unknown	unknown	gnl|CDD|379503
NZ_CP044170.1|WP_002779702.1|40005_40518_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_004292786.1|45752_46079_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002834236.1|40827_41061_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_057040316.1|45591_45756_+|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_032587458.1|43470_44109_-|relaxase/mobilisation-nuclease-domain-containing-protein	unknown	unknown	gnl|CDD|367497
NZ_CP044170.1|WP_002779704.1|39180_39447_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002790730.1|38561_39122_-|hypothetical-protein	unknown	unknown	gnl|CDD|349760
NZ_CP044170.1|WP_002801797.1|42753_43176_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_002897918.1|32447_38246_-|helicase	unknown	unknown	gnl|CDD|226993
NZ_CP044170.1|WP_002804244.1|38292_38559_-|hypothetical-protein	unknown	unknown	unknown
NZ_CP044170.1|WP_001096887.1|49399_50194_-|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	unknown	unknown	gnl|CDD|270699

rpsblast for functional proteins

Protein	Function_ID	Function_description	E-value
NZ_CP044170.1|WP_001255868.1|46027_46894_-|aminoglycoside-6-adenylyltransferase-AadE	gnl|CDD|377357	pfam04439, Adenyl_transf, Streptomycin adenylyltransferase. Also known as Aminoglycoside 6- adenylyltransferase (EC:2.7.7.-), this protein confers resistance to aminoglycoside antibiotics.	1.12427e-155
NZ_CP044170.1|WP_032587458.1|43470_44109_-|relaxase/mobilisation-nuclease-domain-containing-protein	gnl|CDD|367497	pfam03432, Relaxase, Relaxase/Mobilisation nuclease domain. Relaxases/mobilisation proteins are required for the horizontal transfer of genetic information contained on plasmids that occurs during bacterial conjugation. The relaxase, in conjunction with several auxiliary proteins, forms the relaxation complex or relaxosome. Relaxases nick duplex DNA in a specific manner by catalyzing trans-esterification.	0.00375661
NZ_CP044170.1|WP_002897918.1|32447_38246_-|helicase	gnl|CDD|226993	COG4646, COG4646, DNA methylase [Transcription / DNA replication, recombination, and repair].	8.3654e-73
NZ_CP044170.1|WP_002790440.1|41050_41239_-|hypothetical-protein	gnl|CDD|224162	COG1241, MCM2, Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair].	0.00786763
NZ_CP044170.1|WP_057098419.1|48671_49016_-|hypothetical-protein	gnl|CDD|227348	COG5015, COG5015, Uncharacterized conserved protein [Function unknown].	3.53757e-07
NZ_CP044170.1|WP_002790730.1|38561_39122_-|hypothetical-protein	gnl|CDD|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	3.28191e-06
NZ_CP044170.1|WP_002779755.1|44312_44486_-|conjugal-transfer-protein	gnl|CDD|379503	pfam14205, Cys_rich_KTR, Cysteine-rich KTR. This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are approximately 60 amino acids in length. There are 4 conserved cysteines and a conserved KTR sequence motif.	5.76382e-28
NZ_CP044170.1|WP_001096887.1|49399_50194_-|aminoglycoside-O-phosphotransferase-APH(3')-IIIa	gnl|CDD|270699	cd05150, APH, Aminoglycoside 3'-phosphotransferase. APH catalyzes the transfer of the gamma-phosphoryl group from ATP to aminoglycoside antibiotics such as kanamycin, streptomycin, neomycin, and gentamicin, among others. The aminoglycoside antibiotics target the 30S ribosome and promote miscoding, leading to the production of defective proteins which insert into the bacterial membrane, resulting in membrane damage and the ultimate demise of the bacterium. Phosphorylation of the aminoglycoside antibiotics results in their inactivation, leading to bacterial antibiotic resistance. The APH gene is found on transposons and plasmids and is thought to have originated as a self-defense mechanism used by microorganisms that produce the antibiotics. The APH subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	7.26961e-101

Protein sequences

>NZ_CP044170.1|WP_002790440.1|41050_41239_-|hypothetical-protein
MKNTMYSYLLNDKIKNHSMILCTEIECKKCGEKIYVEFQPNEKFIFKCPNCSRKNRKVFYAF
>NZ_CP044170.1|WP_002834236.1|40827_41061_-|hypothetical-protein
MRSSLEKVIKNYNENFSNKRDNDFAQGLIKYLYENAIIGENDKFFLEKNFQYIRIINEKEKRLINVYFCDYRFNLHF
>NZ_CP044170.1|WP_002834234.1|40514_40868_-|hypothetical-protein
MCIFAIIALICIFKNEIWEFVKFIFSNLDFICGNFANFVGEDNIVFFPITTLLIVFTIAICAVWGLSNVLSLSLFIMPIFVAVFYIFNIDISLKNLYGSYFIFLIIINGLSWSVNQR
>NZ_CP044170.1|WP_002779702.1|40005_40518_-|hypothetical-protein
MKKITIVAYAICFLSGLWFLFSSVKDDFGILSFILGIALIYFGVINIKRILNDSNENKTELETLFATANIIFVSISSIFLLMLIAFFTFQNEINIKFFSDQGLVLKNDKKISIYLKGKEIKSFDENKYGFVMAVYGDKHIEVVLQNKENDTFFELRCNEEGCKEILKEDK
>NZ_CP044170.1|WP_002779703.1|39451_40009_-|hypothetical-protein
MRVVNLSKKIVDKILFLRINRVVNILMLIFALFSTIAIALFLSYFIEEENYYAYFVSSFFLVNGFLLTIHLIGEKKCAKEVDYDDNFISKLNNSLRKELEDDLLKLQEYYDGINVLEYKTFALLKCNSYYEKGRINEELIDKIKKYYINLFKKKIAKELEEMQKEKERRNILKTNQELILKKIGE
>NZ_CP044170.1|WP_002779704.1|39180_39447_-|hypothetical-protein
MLEMDNNKEFKILRLNKQEILKIGGYGICDSCNRRLSNDGYMICVLYSCYCEKCYKEWYKVAINHKEDREIEKDVYENIKSKITNIYF
>NZ_CP044170.1|WP_002790730.1|38561_39122_-|hypothetical-protein
MIISVVNKKGGVGKTPFAFSIAKDLEYFLQSNDNSIIEKIYPEKAKILPTPKKIDNCVYDFGGFVEKGVLDIIKESNKIIIPCTSNYNSLLRTLETLNEIGNDDRVCILVTDYRDEKEKRQICETLESNFTDLNLFFFKFSKIIENSMSSGASFTELYNENNLSRLSYTNFFNEYQRLLDFIRKDK
>NZ_CP044170.1|WP_002804244.1|38292_38559_-|hypothetical-protein
MEKKPFTIAEALNSETSSQKTYSKADKKSAGRKTIDQKLRRDNLVVCRLNEQEMEILKKLMDLDLVSEYGTYIRKLILKEARALNINS
>NZ_CP044170.1|WP_002897918.1|32447_38246_-|helicase
MSKKTKRQIEDEKDYGGRSLFDLIELEFSQGEENEQQNRELSEHREVTDNIERTSISSNTPSVDRQENSTIQLDNTREMGRVLSEHNQESRNVRSNDTSIATNTNGISNLGEQRSRQEERTGANRYGDTSRRANKSQSIHSDRTPNLFSFISRNDDERQGTDAARSYNQQSVLETAARNDGYERRSLKSGQKLDFVSDDEIYLGSLKDRFQKNLQAIKLSKTIEQENRYATKQEQEILNKFSGWGGIPQAFDHQNKEWEKEFKELISTLDYAEYEKAKTSTLDAFYTPKIIIDTIYQGLNQLGFNNDDHTKEIFEPSAGIGSFLSYAKNYSDKYHFTCVELDTISANILKHLHPNQTIYNKAFQHHLFDKPYDAFIGNPPFGQKKILDLNDPTLNKTSVHNYFIGNAIKNLKEDGIAAFVVSSYFLDSKNSTIRNFIAEQATFLGAVRLPNNAFKKRANTEVTTDIIFFKKGKDLNIDKSWLESVEYYDDRFDEAEKRGMHPDVFNDFRINEYFKNNPQNILGKMNIKSSQYGYSLECLDDGRDLKIALENFTKTLPKNIYKYQETKIKLSYYRIDRESPEYEKYSKTLSKLKDGNYFEYNNEIYMKIGSDDELVFSKPVLNEHDTRRIKKLIALRDQFNTLIEYEKNESSDLLVENQRKYLNKLYDEFVAKEGYLNRDANKKAFREDVEANKILALEKNYSSGISKSVALKEGIDPIAPSATKADIFFKRTINAQKEIKISTPKEALIASINEYGRIDLKFLETNLNQPLEETLKSLEQDKLIFKDHKNPANYVLAEKYLSGNVKAKHKEVKKLVEDGFNEFVNNLESLEQVLPKDLKAVDISISLGTTWIPIKYYKQFIEETLQITPKDYDLFLMEKTGEWSLKGFGYSLSSYIRSEYATERIGCFDLLEHGLLRKPIRIYDKKLDPSGKEIRELNPKETAIANSKLENLKNEFIEWIYKDYDRRTDLENIYNERFNTNIEPQYNGEHLELPNFNANIKLKKHQKNAIYRAIQENSIIFDHQVGAGKTLVAICSVMEQKRMGLLNKPLIVVPNHLARQWNDEFYHAYTNANILVATNDDLKKDNREKFFSKIATNNFDSIIMTHSQFKLIPAPYEVIKKQYEEDINILEQTLEKKRNDDNVMRYSVKDLEKRIENFKVKLSDLQTTHKKSKAIDFSELGIDALIIDEAHEFKNLLITTSMGDISGLGNLKGSQKAYDLYSKTQYIHEQNKKLYFLTGTPISNSITELYTLQRYIQPNILKEKGIQAFDSWASTFGEVTNAWELDSSGINYKIVARFNKFKNVPELSTMYKSVADIVTNNDIMKYQKDFVPKLYNDKPINIVAPRSKEIAEFIGIQDENGRWNEGSIVWRMEHQQDDITRNNLLACTTDARKAGLDFRLINPHCDDYANSKINKLIENVFNEYNAWNDDKGTQLIFCDLSTPKQHSQKVALNGNIATPNLNKEEFVNINETIEQTEEENSKSLDELLAEQAKFDVYTDILKKLVAKGIPQNEIRFIHDAKTDLQKGQLFADMNSGKARILIGSTQKMGAGTNVQKRIVALHHLDCPWRPSDLEQRSGRVIRQGNELFMRDPQNFRVKEFRYATERTYDARMWQVIESKARSIEQFRKAGADVRTLEDVTSGAADAAEMKAEATGNPLILLQVQLNSDLRQEEMLYSGYKRQIHNNEESLITNLSKIELLKKDIAKMEILNSIIKENNSEHFQGKYYINDDEKDFIVFKNDTSDLNKSRQAELERNFEKIVKTIADDYQKEYKVLEFKGLLISGERTDLNTLNFYVSTTDGKTIIEPENLIYKRDEKTFFKLESYVNFGGFVKRLNNFYNDLEKFTQLNKNKIENLEKEIVELKSITGDNTPKYKRKDYLEALREDNRIIMDEIEKMSKQKNYKSDFLPKSAKILEDLNKNNNIQKEYDIEI
>NZ_CP044170.1|WP_052775856.1|31721_32426_+|GNAT-family-N-acetyltransferase
MKQEVYTSKFYICKKNEKEACFKLDFEIKAFEENQKFYYVEIYAIIDYQYLKNEIAVIPNTNKNRNHWILRYDFNSWNFHSSIMLHSDYRSLGIGTFVINKMLEIALNYIPTARLSGKLSAVDEVKLENHKRRDKLYKNLGFIFNESNTGFNIDSISNLKIRKDFDYIQEVRIFDMCNQLANLKYLKAGDDKLLKIYKEDCYKEKSKNNILRAIVKLVSFVSIALAVWIVFLLK
>NZ_CP044170.1|WP_002801797.1|42753_43176_-|hypothetical-protein
MRTEYKHNPPIPYSLHDMRVKKIIIQDKTIVLEFEDGYEKLTEPFEQVEGNITIEGVDFDCTCVMLQSKWGNYGKFNGEKLELERFIKRYKNYSFEIVDELYGYNQVLYSGYLSILETEDLVQMDISIYFTGKIIYDTKE
>NZ_CP044170.1|WP_008976813.1|43214_43517_-|hypothetical-protein
MLQDAISGEIGSLKDEVKENTVQEVRKALQANIEAIQRATKLLEKQSDTLTSVMKQKIRELEESKNSFFRYEGLKLYLFWGGMVCNILVFLMLLYGMISK
>NZ_CP044170.1|WP_032587458.1|43470_44109_-|relaxase/mobilisation-nuclease-domain-containing-protein
MPEKGKTFAGEVREETVAWSKDTYQLLKQAEQGKVKSYVQDIALAVLDCKETATSRETFIRLMNERGYGVDWQDSHKYITYTDLAREQAGEKACKIRDNKLEKYYNMDFGKESMEHEFERNARTAEAEQSKRAASRVKPTEPDRAGKQSAQRSVGDVERELRGIDEAVKSRTSEGRAEQEAHQRAEAERRAAEEQQRIASRRYIGRDWEPER
>NZ_CP044170.1|WP_002779755.1|44312_44486_-|conjugal-transfer-protein
MMKCEWILCPVCGSKTRNKIRKDTVLENYPLYCPKCRQERLIKVDNLKITVIKEPDA
>NZ_CP044170.1|WP_057040316.1|45591_45756_+|hypothetical-protein
MFSFRSVYKELHADRETGCGASCTPFAPAGKQAEFLRMGMSKKSACFQRTAAGI
>NZ_CP044170.1|WP_004292786.1|45752_46079_+|hypothetical-protein
MKAPVPRPTLRLVDKVSRSCGHTPGKVAGQRATVKAEMNGVTPGLDRRPPPRWMGGQGGQSLKVLVRALSDFEVFSFSKLNNQNKFFRLKKFYLLSSSMPYFFFCRIT
>NZ_CP044170.1|WP_001255868.1|46027_46894_-|aminoglycoside-6-adenylyltransferase-AadE
MRSEKEVYDIVLNFAKTDKRIRMVTLEGSRTNTNIPPDDFQDFDITFFVTDMDSFTSDDKWLDIFGERLILQKPEDMELFPAVEKGFSYLMLFTDDVKIDLTLLPLELIDEYFTWDKLVKLLLDKDNRIVKPPIPTDIDYHLQKPTQRMFDDCCNEFWNTTTYVVKGLCRKEILFAIDHMNDIVRKELLRMISWLIGIKQGFHFSLGKNYKFMKQYVPEELWERLMSTYNMDSYPHMWESFEQCMALFREVSSEVACQLDYQYPLYDEKISNYVIRQKKKYGIEDDNK
>NZ_CP044170.1|WP_057098419.1|48671_49016_-|hypothetical-protein
MTNVEKISEFLTQAKVFTFLTVDNGQPKGRPFGFHLVDGDRNVEVMAVNGDKFMRYDGLAKIVKDDALLAKVHEAMPQLMETYDKNGWEIVLFYLENGHAEIRGLFEVEEEFDV
>NZ_CP044170.1|WP_105100895.1|49106_49292_+|hypothetical-protein
MILSITEDTAPQPMLCRLCGRLVKLAAVSASHCTLVIKAILTNLFTKTLYISNIELYLANF
>NZ_CP044170.1|WP_001096887.1|49399_50194_-|aminoglycoside-O-phosphotransferase-APH(3')-IIIa
MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDTPFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	CP047483	Campylobacter jejuni strain CFSAN096297 plasmid CFSAN096297, complete sequence	46027-46079	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	19005-19057	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_MK541987	Campylobacter coli strain CVM N46788F plasmid pN46788F, complete sequence	22248-22300	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP022078	Campylobacter jejuni strain FDAARGOS_265 plasmid unnamed1, complete sequence	1047-1099	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP045046	Campylobacter jejuni subsp. jejuni strain NADC 20827 plasmid p20827L, complete sequence	18806-18858	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017857	Campylobacter jejuni strain YQ2210 plasmid pCJDM210L, complete sequence	20958-21010	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017854	Campylobacter jejuni strain ZP3204 plasmid pCJDM204L, complete sequence	4053-4105	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP028186	Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence	37888-37940	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	CP013735	Campylobacter coli strain OR12 plasmid pOR12TET, complete sequence	3756-3808	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP045793	Campylobacter coli strain CFSAN032805 plasmid p1CFSAN032805, complete sequence	20583-20642	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NC_006134	Campylobacter coli plasmid pCC31, complete sequence	3801-3860	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NC_006135	Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence	3812-3871	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP023546	Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_1, complete sequence	21154-21213	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP017026	Campylobacter coli plasmid pCC14983A-1, complete sequence	98069-98128	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP017026	Campylobacter coli plasmid pCC14983A-1, complete sequence	98169-98228	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP011017	Campylobacter coli strain FB1 plasmid pFB1TET, complete sequence	42271-42330	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP023544	Campylobacter jejuni strain CFSAN032806 plasmid pCFSAN032806, complete sequence	5-64	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP007750	Campylobacter jejuni subsp. jejuni M129 plasmid pTet-M129, complete sequence	23822-23881	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP017872	Campylobacter coli strain BP3183 plasmid pCCDM183, complete sequence	43234-43293	0	1.0
NZ_CP044170_2	2.1|42611|60|NZ_CP044170|CRISPRCasFinder	42611-42670	60	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	42611-42670	0	1.0
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017026	Campylobacter coli plasmid pCC14983A-1, complete sequence	128999-129051	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017030	Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence	7038-7090	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP014345	Campylobacter jejuni strain RM3194 plasmid unnamed, complete sequence	21862-21914	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017877	Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence	46808-46860	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP044176	Campylobacter coli strain AR-0411 plasmid pAR-0411, complete sequence	32212-32264	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP025282	Campylobacter coli strain YH503 plasmid pCOS503, complete sequence	31894-31946	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP028373	Campylobacter jejuni subsp. jejuni strain huA17 plasmid unnamed1, complete sequence	123262-123314	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP018901	Campylobacter coli strain YH502 plasmid pCOS502, complete sequence	46633-46685	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP040614	Campylobacter sp. CFSAN093246 plasmid unnamed, complete sequence	17750-17802	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP017230	Campylobacter jejuni strain FORC_046 isolate Not reported plasmid pFORC46.1, complete sequence	21625-21677	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP044166	Campylobacter coli strain AR-0416 plasmid pAR-0416	141105-141157	1	0.981
NZ_CP044170_1	1.1|19005|53|NZ_CP044170|PILER-CR	19005-19057	53	NZ_CP048772	Campylobacter jejuni strain ZS007 plasmid pCJ145K, complete sequence	29241-29293	1	0.981
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	CP047483	Campylobacter jejuni strain CFSAN096297 plasmid CFSAN096297, complete sequence	46102-46173	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP044170	Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence	19080-19151	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_MK541987	Campylobacter coli strain CVM N46788F plasmid pN46788F, complete sequence	22323-22394	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP022078	Campylobacter jejuni strain FDAARGOS_265 plasmid unnamed1, complete sequence	953-1024	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP028186	Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence	37794-37865	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	CP013735	Campylobacter coli strain OR12 plasmid pOR12TET, complete sequence	3662-3733	12	0.833
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP045046	Campylobacter jejuni subsp. jejuni strain NADC 20827 plasmid p20827L, complete sequence	18712-18783	13	0.819
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP017857	Campylobacter jejuni strain YQ2210 plasmid pCJDM210L, complete sequence	20864-20935	13	0.819
NZ_CP044170_1	1.2|19080|72|NZ_CP044170|PILER-CR	19080-19151	72	NZ_CP017854	Campylobacter jejuni strain ZP3204 plasmid pCJDM204L, complete sequence	3959-4030	13	0.819

1. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to CP047483 (Campylobacter jejuni strain CFSAN096297 plasmid CFSAN096297, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

2. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

3. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_MK541987 (Campylobacter coli strain CVM N46788F plasmid pN46788F, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

4. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP022078 (Campylobacter jejuni strain FDAARGOS_265 plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

5. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP045046 (Campylobacter jejuni subsp. jejuni strain NADC 20827 plasmid p20827L, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

6. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017857 (Campylobacter jejuni strain YQ2210 plasmid pCJDM210L, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

7. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017854 (Campylobacter jejuni strain ZP3204 plasmid pCJDM204L, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

8. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP028186 (Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

9. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to CP013735 (Campylobacter coli strain OR12 plasmid pOR12TET, complete sequence) position: , mismatch: 0, identity: 1.0

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	Protospacer
*****************************************************

10. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP045793 (Campylobacter coli strain CFSAN032805 plasmid p1CFSAN032805, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

11. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NC_006134 (Campylobacter coli plasmid pCC31, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

12. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NC_006135 (Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

13. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP023546 (Campylobacter coli strain CFSAN032805 plasmid pCFSAN032805_1, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

14. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP017026 (Campylobacter coli plasmid pCC14983A-1, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

15. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP017026 (Campylobacter coli plasmid pCC14983A-1, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

16. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP011017 (Campylobacter coli strain FB1 plasmid pFB1TET, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

17. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP023544 (Campylobacter jejuni strain CFSAN032806 plasmid pCFSAN032806, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

18. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP007750 (Campylobacter jejuni subsp. jejuni M129 plasmid pTet-M129, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

19. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP017872 (Campylobacter coli strain BP3183 plasmid pCCDM183, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

20. spacer 2.1|42611|60|NZ_CP044170|CRISPRCasFinder matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 0, identity: 1.0

gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	CRISPR spacer
gagttttttttacctttttccgtcaagtataagggagtgcctttttgatgtcaatatcta	Protospacer
************************************************************

21. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017026 (Campylobacter coli plasmid pCC14983A-1, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

22. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017030 (Campylobacter jejuni subsp. jejuni strain 14980A plasmid pCJ14980A, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

23. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP014345 (Campylobacter jejuni strain RM3194 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

24. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017877 (Campylobacter coli strain ZV1224 plasmid pCCDM224L, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

25. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP044176 (Campylobacter coli strain AR-0411 plasmid pAR-0411, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

26. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP025282 (Campylobacter coli strain YH503 plasmid pCOS503, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

27. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP028373 (Campylobacter jejuni subsp. jejuni strain huA17 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

28. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP018901 (Campylobacter coli strain YH502 plasmid pCOS502, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

29. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP040614 (Campylobacter sp. CFSAN093246 plasmid unnamed, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

30. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP017230 (Campylobacter jejuni strain FORC_046 isolate Not reported plasmid pFORC46.1, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

31. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP044166 (Campylobacter coli strain AR-0416 plasmid pAR-0416) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

32. spacer 1.1|19005|53|NZ_CP044170|PILER-CR matches to NZ_CP048772 (Campylobacter jejuni strain ZS007 plasmid pCJ145K, complete sequence) position: , mismatch: 1, identity: 0.981

attatatttatgtcagcaaaatcagcatacaatcactcataagttattaaaaa	CRISPR spacer
attatatttatgtcagcaaaatcagcatacaatcacccataagttattaaaaa	Protospacer
************************************.****************

33. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to CP047483 (Campylobacter jejuni strain CFSAN096297 plasmid CFSAN096297, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

34. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP044170 (Campylobacter jejuni strain AR-0413 plasmid pAR-0413-1, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

35. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_MK541987 (Campylobacter coli strain CVM N46788F plasmid pN46788F, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

36. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP022078 (Campylobacter jejuni strain FDAARGOS_265 plasmid unnamed1, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

37. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP028186 (Campylobacter jejuni strain CFSAN054107 plasmid pGMI16-002, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

38. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to CP013735 (Campylobacter coli strain OR12 plasmid pOR12TET, complete sequence) position: , mismatch: 12, identity: 0.833

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
************************************************************

39. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP045046 (Campylobacter jejuni subsp. jejuni strain NADC 20827 plasmid p20827L, complete sequence) position: , mismatch: 13, identity: 0.819

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttaacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
**.*********************************************************

40. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP017857 (Campylobacter jejuni strain YQ2210 plasmid pCJDM210L, complete sequence) position: , mismatch: 13, identity: 0.819

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttaacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
**.*********************************************************

41. spacer 1.2|19080|72|NZ_CP044170|PILER-CR matches to NZ_CP017854 (Campylobacter jejuni strain ZP3204 plasmid pCJDM204L, complete sequence) position: , mismatch: 13, identity: 0.819

ttgacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	CRISPR spacer
ttaacataaatagaatagtttttgacattttttcggaaaccccatatggaaaatagggac	Protospacer
**.*********************************************************

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage
NZ_CP044170.1|WP_057097537.1|57058_57454_+|hypothetical-protein	57058_57454_+	131 aa aa	86	NA	NA	No	NA

Protein sequences of NZ_CP044170.1|WP_057097537.1|57058_57454_+|hypothetical-protein

>NZ_CP044170.1|WP_057097537.1|57058_57454_+|hypothetical-protein
MIKEYYSGWEALNLAKESGAIADWHPLSYWSCKPQKYTFNKDLGDWGISERFISFIGKKDYVANYPRAIADLVLKNEIKELKNCVYDYLDDDETKELYEILKKYKTLDNIKNFLKYELTKYYFLDKENKDV

gnl|BL_ORD_ID|86 information

• hit_Aca_id: gnl|BL_ORD_ID|86
• identity: 0.42424242424242425
• query_coverage: 0.9465648854961832
• hit_coverage: 0.8741721854304636