CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044227	Flintibacter sp. KGMB00164 chromosome, complete genome	1 crisprs	RT,csa3,WYL,DEDDh	0	1	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044227_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044227_1

1421616-1421696

Orphan

Consensus_repeat	Method
GAGAAGCCCAAGCGTACCCGCAAGAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044227_1

>merge|NZ_CP044227|1|1421616-1421696|CRISPRCasFinder
GAGAAGCCCAAGCGTACCCGCAAGAAGGCTGCCGAGGAGAGCGCCGAGGGCGAGGAGAAGCCCAAGCGCACCCGCAAGAAG

>NZ_CP044227|1|1|1421616-1421696|CRISPRCasFinder
GAGAAGCCCAAGCGTACCCGCAAGAAG	GCTGCCGAGGAGAGCGCCGAGGGCGAG
GAGAAGCCCAAGCGCACCCGCAAGAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044227.1\|WP_008980585.1\|1429876_1430299_+\|sporulation-protein-YtfJ	unknown	unknown	gnl\|CDD\|131921
NZ_CP044227.1\|WP_151075762.1\|1427109_1427796_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100079
NZ_CP044227.1\|WP_151075752.1\|1412031_1413216_-\|cell-division-protein-FtsW	unknown	unknown	gnl\|CDD\|274033
NZ_CP044227.1\|WP_151075764.1\|1429233_1429899_+\|DUF2953-domain-containing-protein	unknown	unknown	gnl\|CDD\|378578
NZ_CP044227.1\|WP_151075761.1\|1426416_1427052_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	unknown	unknown	gnl\|CDD\|234770
NZ_CP044227.1\|WP_008980571.1\|1414527_1415163_+\|uracil-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|234653
NZ_CP044227.1\|WP_151075754.1\|1413797_1414514_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	unknown	unknown	gnl\|CDD\|274750
NZ_CP044227.1\|WP_147622185.1\|1427749_1428616_+\|chromosome-segregation-protein-ScpA	unknown	unknown	gnl\|CDD\|234635
NZ_CP044227.1\|WP_008980577.1\|1421907_1422489_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	unknown	unknown	gnl\|CDD\|178955
NZ_CP044227.1\|WP_151075760.1\|1423984_1426405_+\|endopeptidase-La	unknown	unknown	gnl\|CDD\|223542
NZ_CP044227.1\|WP_151075763.1\|1428628_1429237_+\|SMC-Scp-complex-subunit-ScpB	unknown	unknown	gnl\|CDD\|377219
NZ_CP044227.1\|WP_151075756.1\|1416867_1417473_+\|ribonuclease-HII	unknown	unknown	gnl\|CDD\|260003
NZ_CP044227.1\|WP_151075757.1\|1417469_1417838_+\|YraN-family-protein	unknown	unknown	gnl\|CDD\|237119
NZ_CP044227.1\|WP_008980575.1\|1419479_1420166_+\|ser/threonine-protein-phosphatase	unknown	unknown	gnl\|CDD\|224682
NZ_CP044227.1\|WP_008980572.1\|1415536_1415878_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|376502
NZ_CP044227.1\|WP_151075755.1\|1415947_1416826_+\|ribosome-biogenesis-GTPase-YlqF	unknown	unknown	gnl\|CDD\|274669
NZ_CP044227.1\|WP_008980578.1\|1422555_1423872_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	unknown	unknown	gnl\|CDD\|235422
NZ_CP044227.1\|WP_151075758.1\|1417976_1419461_+\|threonine-synthase	unknown	unknown	gnl\|CDD\|236418
NZ_CP044227.1\|WP_151075765.1\|1430375_1431479_+\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP044227.1\|WP_151075753.1\|1413342_1413777_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	unknown	unknown	gnl\|CDD\|376771

Protein	Function_ID	Function_description	E-value
NZ_CP044227.1\|WP_008980585.1\|1429876_1430299_+\|sporulation-protein-YtfJ	gnl\|CDD\|131921	TIGR02874, conserved_hypothetical_protein, sporulation protein YtfJ. Members of this protein family, exemplified by YtfJ of Bacillus subtilis, are encoded by bacterial genomes if and only if the species is capable of endospore formation. YtfJ was confirmed in spores of Bacillus subtilis; it appears to be expressed in the forespore under control of SigF (see ). [Cellular processes, Sporulation and germination].	3.04161e-30
NZ_CP044227.1\|WP_151075762.1\|1427109_1427796_+\|site-2-protease-family-protein	gnl\|CDD\|100079	cd06158, S2P-M50_like_1, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.	7.18618e-59
NZ_CP044227.1\|WP_151075752.1\|1412031_1413216_-\|cell-division-protein-FtsW	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	3.32121e-75
NZ_CP044227.1\|WP_151075764.1\|1429233_1429899_+\|DUF2953-domain-containing-protein	gnl\|CDD\|378578	pfam11167, DUF2953, Protein of unknown function (DUF2953). This family of proteins has no known function.	9.93616e-06
NZ_CP044227.1\|WP_151075761.1\|1426416_1427052_+\|YihA-family-ribosome-biogenesis-GTP-binding-protein	gnl\|CDD\|234770	PRK00454, engB, GTP-binding protein YsxC; Reviewed.	9.80545e-87
NZ_CP044227.1\|WP_008980571.1\|1414527_1415163_+\|uracil-phosphoribosyltransferase	gnl\|CDD\|234653	PRK00129, upp, uracil phosphoribosyltransferase; Reviewed.	2.98232e-136
NZ_CP044227.1\|WP_151075754.1\|1413797_1414514_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB	gnl\|CDD\|274750	TIGR03725, T6A_YeaZ, tRNA threonylcarbamoyl adenosine modification protein YeaZ. This family describes a protein family, YeaZ, now associated with the threonylcarbamoyl adenosine (t6A) tRNA modification. Members of this family may occur as fusions with ygjD (previously gcp) or the ribosomal protein N-acetyltransferase rimI, and is frequently encoded next to rimI. [Protein synthesis, tRNA and rRNA base modification].	6.28767e-54
NZ_CP044227.1\|WP_147622185.1\|1427749_1428616_+\|chromosome-segregation-protein-ScpA	gnl\|CDD\|234635	PRK00104, scpA, segregation and condensation protein A; Reviewed.	2.91885e-36
NZ_CP044227.1\|WP_008980577.1\|1421907_1422489_+\|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP	gnl\|CDD\|178955	PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed.	1.16519e-142
NZ_CP044227.1\|WP_151075760.1\|1423984_1426405_+\|endopeptidase-La	gnl\|CDD\|223542	COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones].	0
NZ_CP044227.1\|WP_151075763.1\|1428628_1429237_+\|SMC-Scp-complex-subunit-ScpB	gnl\|CDD\|377219	pfam04079, SMC_ScpB, Segregation and condensation complex subunit ScpB. This is a family of prokaryotic proteins that form one of the subunits, ScpB, of the segregation and condensation complex, condensin, that plays a key role in the maintenance of the chromosome. In prokaryotes the complex consists of three proteins, SMC, ScpA (kleisin) and ScpB. ScpB dimerizes and binds to ScpA. As originally predicted, ScpB is structurally a winged-helix at both its N- and C-terminal halves. IN Bacillus subtilis,one Smc dimer is bridged by a single ScpAB to generate asymmetric tripartite rings analogous to eukaryotic SMC complex ring-shaped assemblies.	4.90561e-62
NZ_CP044227.1\|WP_151075756.1\|1416867_1417473_+\|ribonuclease-HII	gnl\|CDD\|260003	cd07182, RNase_HII_bacteria_HII_like, Bacterial Ribonuclease HII-like. This family includes mostly bacterial type 2 RNases H, with some eukaryotic members. Bacterial RNase HII has a role in primer removal based on its involvement in ribonucleotide-specific catalytic activity in the presence of RNA/DNA hybrid substrates. Several bacteria, such as Bacillus subtilis, have two different type II RNases H, RNases HII and HIII; double deletion of these leads to cellular lethality. It appears that type I and type II RNases H also have overlapping functions in cells, as over-expression of Escherichia coli RNase HII can complement an RNase HI deletion phenotype. In Leishmania mitochondria, of the four distinct RNase H genes (H1, HIIA, HIIB, HIIC), HIIC is essential for the survival of the parasite and thus can be a potential target for anti-leishmanial chemotherapy. Ribonuclease H (RNase H) is classified into two families, type I (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type II (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). RNase H endonucleolytically hydrolyzes an RNA strand when it is annealed to a complementary DNA strand in the presence of divalent cations, in DNA replication and repair.	7.97819e-100
NZ_CP044227.1\|WP_151075757.1\|1417469_1417838_+\|YraN-family-protein	gnl\|CDD\|237119	PRK12497, PRK12497, YraN family protein.	3.30225e-47
NZ_CP044227.1\|WP_008980575.1\|1419479_1420166_+\|ser/threonine-protein-phosphatase	gnl\|CDD\|224682	COG1768, COG1768, Predicted phosphohydrolase [General function prediction only].	1.02559e-70
NZ_CP044227.1\|WP_008980572.1\|1415536_1415878_+\|50S-ribosomal-protein-L19	gnl\|CDD\|376502	pfam01245, Ribosomal_L19, Ribosomal protein L19.	2.41372e-66
NZ_CP044227.1\|WP_151075755.1\|1415947_1416826_+\|ribosome-biogenesis-GTPase-YlqF	gnl\|CDD\|274669	TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members. [Protein synthesis, Other].	1.17082e-141
NZ_CP044227.1\|WP_008980578.1\|1422555_1423872_+\|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX	gnl\|CDD\|235422	PRK05342, clpX, ATP-dependent Clp protease ATP-binding subunit ClpX.	0
NZ_CP044227.1\|WP_151075758.1\|1417976_1419461_+\|threonine-synthase	gnl\|CDD\|236418	PRK09225, PRK09225, threonine synthase; Validated.	0
NZ_CP044227.1\|WP_151075765.1\|1430375_1431479_+\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	1.14875e-113
NZ_CP044227.1\|WP_151075753.1\|1413342_1413777_+\|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE	gnl\|CDD\|376771	pfam02367, TsaE, Threonylcarbamoyl adenosine biosynthesis protein TsaE. This family of proteins is involved in the synthesis of threonylcarbamoyl adenosine (t(6)A).	4.07917e-68

>NZ_CP044227.1|WP_008980575.1|1419479_1420166_+|ser/threonine-protein-phosphatase
MALYAIGDTHLSLSVDKPMDVFGGGWRGYVDKLREGFSTVKAEDTVVLCGDLSWGMSLEQAEQDFAFLDALPGRKILLKGNHDYWWTTAAKMERFFAEHGFSTLEILHNNCRLYGELALCGTRGWFYEEDRGEHSAKIFNRELMRLEASLKAAGEREKYCFLHYPPLYQGYRCQEILDLLEAYGVRRCFYGHLHGGSHRLAISGQVGSVEYRLIAADYLGFRPEKLLD
>NZ_CP044227.1|WP_151075758.1|1417976_1419461_+|threonine-synthase
MQYISTRDREQQFSASQAIAKGLADDGGLLTPVYLPKLPRRALEELKDMSYQQRAVYVMKLFLDEFTVKELTDFANAAYGPEKFDTPAVAPVRGLDSNTFCLELWHGPTCAFKDMALQMLPHLLTASLRKQEEEKTVCILVATSGDTGKGALEGFKDVDHTRILVFYPKDGVSAIQELQMVTQEGGNVGVCSVVGNFDDAQTGVKKLFSDEKLRQELAQRGFFLSSANSINWGRVLPQIVYYISAYCDLVRDEKIQLGDPINVCVPTGNFGNILAAYYAKDMGVPINKLICASNSNNVLTDFLRTGVYDRNRTFYNTMSPSMDILISSNLERLLYAITGEDQQVREYMDELNRTGRYEVSERVKEKIQRLFVGYCCDDTVTQKVISTIYRSFDYLIDPHTAVGFSALTQYREETGDMTPTVVASTASPFKFCDNVLGALGETSLRDGLDILDQLSEKTGQPVPAPLAGLRGKQPRFQRTEEKEHMVDAVLDMLK
>NZ_CP044227.1|WP_151075757.1|1417469_1417838_+|YraN-family-protein
MSGQESRLLGRWGEALAADFLRQRGYEIVAAGWRCRFGELDLVAQDRSYLCFVEVKLRRSAAFGTAAEFVDSRKQQRLRTTAQLYLQQNPTQLQPRFDVIEVLAPQGMDTRAPKIRHLADAF
>NZ_CP044227.1|WP_151075756.1|1416867_1417473_+|ribonuclease-HII
MAGWDYETQAREQGYTAVCGCDEAGAGPLAGPVYAGAVILPFGVEIPGLDDSKKLTEKRREALFPVIQELALAWAVAKVDAEEIDRTDILSARMKAMQLAIDALEVPADFALVDGNRDHGKSAAVTTPHLCVIKGDSLSMSIAAASILAKVSRDHCMMEMAQVYPEYAFEKHKGYGTKLHYERLRAYGPSPIHRRSFLKNL
>NZ_CP044227.1|WP_151075755.1|1415947_1416826_+|ribosome-biogenesis-GTPase-YlqF
MNIQWYPGHMTKTRRQIEADLKNVDIVVEIIDARIPISSRNPDIDAICAGKPRLVILNRADQADPAQNKAWGEWFRKRGCSVLETDAKTGKGVGQFSAVVQNVLKDQIARWQERGLVGRPVRAMIVGVPNVGKSTFINKVAKRKTAKAGDRPGVTRGKQWVTVDRGLELLDTPGILWPKFEDEEIGLRLAFTGAVKDEIMDVETLGCHLMTFLATYYPDALAAGYKLPAVPQREEEENDVAYGYRLLETCAQKRGMRISGGEFDTERMARVLLDEYRGGKLGRFTLEQAQEN
>NZ_CP044227.1|WP_008980572.1|1415536_1415878_+|50S-ribosomal-protein-L19
MDLMQAFTQKHLKAEAPQVQVGDTIRVHLKVKEGNRERIQVFEGTVIAKKHGGIEETFTVRRISYGIGVEKVFPVHSPAIEKIELVRHGKVRRAKLYYLRGRVGKAAKIKEAL
>NZ_CP044227.1|WP_008980571.1|1414527_1415163_+|uracil-phosphoribosyltransferase
MFDSKVHVLDHPLLQHKLSILRDERTGVKEFREIVSEIAALECYEATRDLPLEDVEIKTPVATGTFKQLAGKKLAIVPILRAGLGMVDGILNLIPSAKVGHIGLYRDPETHQPVEYYCKMPSDIADRDVIVLDPMLATGGSASAAITFLKGYGCKHIKLMNILAAPEGIEVIRRDHPDVEIYVAAVDEKLNEHAYIVPGLGDAGDRIFGTK
>NZ_CP044227.1|WP_151075754.1|1413797_1414514_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-dimerization-subunit-type-1-TsaB
MKILALESSAVACSAALWGEEGLIAQNFQQSGLTHSRTLLPMAHDLLKNCGVSLSQVDVIAVAAGPGSFTGLRIGVATAKGLAWGEDKDCAACSTLESMAWPLAFYPDAVIVCAMDARRKQVYNALFQTDGEKLERLCPDRAIGLEELGEELKKIEKRKIVVGDGAKLCYNTLRSQGIDLELAPEALRQQSAWGVARAAVEQIQAGALVKGKDLVPVYHRLSQAERERLKRQGRSTQK
>NZ_CP044227.1|WP_151075753.1|1413342_1413777_+|tRNA-(adenosine(37)-N6)-threonylcarbamoyltransferase-complex-ATPase-subunit-type-1-TsaE
MEYCSNSERDTEELGRRLGERVAPGTVIAYTGDLGAGKTAFTRGLAQGLGVPGQVTSPTFTIVNEYEGGRLPLFHFDMYRLGSADELFDIGWEDYLARGGVCAVEWSENVEEALEEDTIRVDIRRGDTDQQRRISIQGGPTLEN
>NZ_CP044227.1|WP_151075752.1|1412031_1413216_-|cell-division-protein-FtsW
MKTLFSPLQEFLKKGDMLLLSLCLLASGFGVALIFSATRYNDNNKEVAVQIVAILLGILVYILCTYVDFESFVEKNWKWLLGFSIIFLLLLLTPFGVTRGGNRNWLQFPGFPILIQPNEVVKIPYILLLAMQIHKLQERGHDIGSVFSVAQIGAHAAFMLALIAGICGDMGMCVVYTMIFAIMSWSAGVKLRWFVLVGSAIVIAFVILWFFVLPKTEAWDKLYLIKRFRVLFDHSYDPQGVGFQQTRSVLAIGSGQIFGKGYLQGSMTQSAYESTLPARDTDFIFAVCGEELGMVGCLALLALLSAVVLRCIWVARHASSPFYAYVSMGMAGMLIVQIAANVGMCLFVFPVMGLTLPFISYGGSSIITLYAAMGLVSSAKARALPSWLRDRGAL
>NZ_CP044227.1|WP_008980577.1|1421907_1422489_+|ATP-dependent-Clp-endopeptidase-proteolytic-subunit-ClpP
MSLVPYVVEQTNRGERSYDIFSRLLNDRIIFLSEEVNDTTASLVVAQLLYLESQDPDKDIQFYINSPGGSVTAGMAIYDTMQYVKCDVSTICIGLAASMGAFLLSAGAKGKRLALPNSEIMIHQPSAGTQGQITDMALHLKRLEVVKKRMNRILAENTGKSIEQVTADCERDNFMSAQEALEYGLIDRVIEKR
>NZ_CP044227.1|WP_008980578.1|1422555_1423872_+|ATP-dependent-Clp-protease-ATP-binding-subunit-ClpX
MAKNDEKRSVRCSFCGKHQDQVRRLIAGPGAYICNECVQLCMSILEDEGELTQEALESAIPDAIPTPREIHAVLDQYIIGQEKAKVALSVAVYNHYKRIYFGGAEDVELQKSNILLMGPTGCGKTLFAQTLARVLKVPFAIADATTLTEAGYVGDDVENILLRLVQAADYDIELAERGIIYIDEMDKIARKSENTSITRDVSGEGVQQALLKILEGTVANVPPQGGRKHPHQEFIQIDTKNILFICGGAFDGIDKIIESRLDKRSLGFGAEIQSKKERNVGELMKEIQPQDLLKFGIIPELVGRMPIITTLESLDRDQMMQILTEPKNALVKQYQKLMEYDDVELEYTHDALEAVADRAVERGIGARGLRAILEEVMTQVMYDVPSDPTIAKVTINAACVKDGAEPEILRDPQRTQRPPLGKASLHAERGGLPGTHAG
>NZ_CP044227.1|WP_151075760.1|1423984_1426405_+|endopeptidase-La
MEKDWTTQQVETMPVIALRGLTIFPNVLIHFDVAREISIKALEEAMTAGSPVFLVGQKDLAVEKPEAKDLYTVGTVSKVRQILRMPGDNVRVMVEGLCRGGLDELKRTSPYLEAVVRTIPAEKAGNNSAKTEALIRSTYEMFQQYTELAPKTAPDLLINVLASEDPGYIADFIAQNIAMRNSDKQAVLEELRPVRRLERLYRLLCREVEILGLDMEIQNRAREQMSDNQRDYYLREQLKAIQAELGEGEGGADSELGDYRKKIAQAKLPDDVRERLEKEVSRLAKQPYGSSEATVMRNYLDVCLELPWGKKTKEKISVESARKVLDHDHFGLEKVKERVLEFLAVRQLTPDLKGQVICLVGPPGVGKTSIAMSVARALHRKLGRISLGGVSDEAEIRGHRKTYVGSMPGRIISAINQAGSCNPLLLLDEIDKMGSDHRGDPAAALLEVLDVEQNSTFRDNFLEVPFDLSDVLFITTANTTETIPRPLLDRMEVIELPSYTDEEKLQIAKRHLLPKEMKRHGLNKTQLKVSDGAIRELIASYTRESGVRVLERNLGSLCRKAAMKLVSEDVKQVRITDKDLKNLLGAPKYYPERQVLEERVGVVNGLAWTSVGGELLEVEVNVVPGSGKVELTGNLGDVMKESAHAALSFIRSQADRLGIPADFYKEKDIHVHFPEGAVPKDGPSAGIAITTAMVSALTGAPVRRGIAMTGEVTLRGRVLPIGGLREKTMAALRNGIQTVIIPADNEKDLDEIDQTVRNALNFVLVDQAEQVLAQAILAPGGAAERDKALDAKLPDSQGRGHARLRQ
>NZ_CP044227.1|WP_151075761.1|1426416_1427052_+|YihA-family-ribosome-biogenesis-GTP-binding-protein
MAINLQKAEFILSAVAPKFFLRDGLPQVAFSGRSNVGKSSVINRLLNRKNFARVGAAPGKTTQINYFKIDNAFYLVDLPGYGYAKVSKAERDRWGKLMESYFADLELMTLGVMIVDSRHKPTADDCTMAQWYREAGCPFVVVANKLDKLKKSQVEPNLQVIRETLELGEGDVVIPFSAEKGTGRQELVSAILASVEGRKTPGACQGEQNLV
>NZ_CP044227.1|WP_151075762.1|1427109_1427796_+|site-2-protease-family-protein
MGALTEFSNHMDWQGMLMFLMSAVACLICLTIHELSHGLIARQLGDPTAKVNGRLTLNPLAHIDWVGLFLLLTVGVGWAKPVPVDMRNFRNPKAGMAATALAGPISNFLLALVCICLGGFVLRDGMGRAWSAYVLLFLCQLAVLNVGLGVFNLIPIPPLDGSRVVSAFLPDRAYLWLMKRERFLIVAVVLLAWSGLLGGPLEAAIAWVVKAMCHVAGFPFAIMEFYFF
>NZ_CP044227.1|WP_147622185.1|1427749_1428616_+|chromosome-segregation-protein-ScpA
MWPDSPLPSWNSTSSKGGAGLDSPIYHLQGVVKDRSEDLQDFVGPLDLILHLLSKNKMEIKDIQISLILDQYLAWMNQRKQLDLEVASEFVTMASHLVYIKTRMLLSIHDEEAMSEMEQLIATLEAHQRNENYLKIKEIVPLLDQQFSYGRDFITKTPEAIQPDRAYRYIHPKEDLRKAMGDVLARSDNKLPPPVAAFQGIVGREPYPVAEKAAEIIQRLVHLGVTRFRALFRGNRSRSEVVATFIAVLELCKAHRLRLAGTEEDCTVTCIQGEEAQPLDITADAPEE
>NZ_CP044227.1|WP_151075763.1|1428628_1429237_+|SMC-Scp-complex-subunit-ScpB
MEVKELEAALEGILFAAGEPVGVERLCLSLETDRPTLDAVARQLMDRYRYERRGIRIVRMDASYQMCSAPEYAPYIRKALEGRKPPRLSQPALEVLAIIAYYQPVTRAYVDQIRGVDSAYTVGLLLERELIEESGRLAVPGRPILYRTTKNFLRSFGMASLEELPPLPDGSQEGSQMTMELEQAVERLRAEEAGEAAPEGEK
>NZ_CP044227.1|WP_151075764.1|1429233_1429899_+|DUF2953-domain-containing-protein
MTGWIIAGVVVLLIWLIGRVPLGAGVSRTREEGNRIWLQLGPASITLYPRPKKTLTKPAKEKKSKPAKEKKPKKEGKPRKPFTREQIVTLVRRFLALGLEAAGSFRRKLCIDVLELDLIVGSPDPADAAMDYGKASAALGALWGPLNEAFRVKDGRARVDVDFQQEHWAVWGRLQMTLTIGQLVWLGLRYGAAALNILRETRRDTNDAEKGGRNDGKAASS
>NZ_CP044227.1|WP_008980585.1|1429876_1430299_+|sporulation-protein-YtfJ
MEKQHPLNDLMSVAADKLRALADSNTVVGQPIQAGDVTLIPVSRLSFGIASGGTEYSTKKQAVGGDNAFGGGTGASGKVDPVAFLIVRGDSVKLLPVMPPPATTLDRVIETVPEVVDKVTDFIDKQQAKSAAKAETDLAD
>NZ_CP044227.1|WP_151075765.1|1430375_1431479_+|D-alanyl-D-alanine-carboxypeptidase
MGLRRGTGVLLAAALCFALLPRAGAAEVTVSAQSAVLMEAESGRVLYAKDADTPRLIASTTKLMTALVALESGHSLEEDVTIPAEAAGVEGSSLYLKAGETVKLKTLLYGMLLHSGNDAATAVALTCAGSLEAFAQKMNEKAQQLGMTNSHFTNPTGLDGEEHYSSAYDMALLARACLAVPELKEITATRSTTMEGRSFVNHNKLLWRYEGCVGMKTGYTQAAGRTLVSAAERDGMTLIAVTLNAPSDWADHAAMLDYGFEHYHMEEAVTAGQSRCSLPVSGSLVPFVSLKAEETLRWPVGPGESLETRLELGGLTSLEAPVQAGVPVGRVEVLLNGEEVGESDLSCAIAVHRDQQEHTGWLDWLFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP050953	Rhodococcus sp. DMU1 plasmid unnamed	608385-608411	3	0.889
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP038031	Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence	3818-3844	3	0.889
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP045548	Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence	373919-373945	4	0.852
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP027859	Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence	142100-142126	4	0.852
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NC_010510	Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence	253862-253888	4	0.852
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NC_009620	Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence	810378-810404	4	0.852
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP007130	Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence	468121-468147	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP012185	Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence	111228-111254	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_CP012182	Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence	34583-34609	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	CP054917	Streptomyces sp. NA02950 plasmid unnamed, complete sequence	116638-116664	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NC_010905	Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence	9519-9545	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	1668369-1668395	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	2317048-2317074	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	NC_016585	Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence	959793-959819	5	0.815
NZ_CP044227_1	1.1\|1421643\|27\|NZ_CP044227\|CRISPRCasFinder	1421643-1421669	27	JN698994	Mycobacterium phage DS6A, complete genome	2419-2445	6	0.778

1. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP050953 (Rhodococcus sp. DMU1 plasmid unnamed) position: , mismatch: 3, identity: 0.889

gctgccgaggagagcgccgagggcgag	CRISPR spacer
ggtgccgaggacagcgccgacggcgag	Protospacer
* ********* ******** ******

2. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP038031 (Rhodococcus ruber strain R1 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.889

gctgccgaggagagcgccgagggcgag	CRISPR spacer
ggtgccgaggacagcgccgacggcgag	Protospacer
* ********* ******** ******

3. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP045548 (Streptomyces sp. SYP-A7193 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

gctgccgaggagagcgccgagggcgag	CRISPR spacer
accgccgaggagagcgccgagggcggc	Protospacer
.*.**********************.

4. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP027859 (Streptomyces clavuligerus strain ATCC 27064 plasmid pCLA1, complete sequence) position: , mismatch: 4, identity: 0.852

gctgccgaggagagcgccgagggcgag	CRISPR spacer
gctgccgaggagcgcgacgagggcggc	Protospacer
************ *** ********.

5. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NC_010510 (Methylobacterium radiotolerans JCM 2831 plasmid pMRAD01, complete sequence) position: , mismatch: 4, identity: 0.852

gctgccgaggagagcgccgagggcgag	CRISPR spacer
gacgccgaggagatcgccgaggtcgag	Protospacer
* .********** ******** ****

6. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NC_009620 (Sinorhizobium medicae WSM419 plasmid pSMED01, complete sequence) position: , mismatch: 4, identity: 0.852

gctgccgaggagagcgccgagggcgag	CRISPR spacer
cccgccgaggcgagcgccgagcgcgag	Protospacer
 *.******* ********** *****

7. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP007130 (Gemmatirosa kalamazoonesis strain KBS708 plasmid 2, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
cgcgccgaggagcgcggcgagggcgag	Protospacer
  .********* *** **********

8. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP012185 (Pseudonocardia sp. EC080619-01 plasmid pBCI1-2, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
accgccgaggagaccgccgagggcgtc	Protospacer
.*.********** ***********

9. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_CP012182 (Pseudonocardia sp. EC080610-09 plasmid pBCI2-1, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
accgccgaggagaccgccgagggcgtc	Protospacer
.*.********** ***********

10. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to CP054917 (Streptomyces sp. NA02950 plasmid unnamed, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
ccggccgaggagcgcggcgagggcgat	Protospacer
 * ********* *** *********

11. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NC_010905 (Amycolatopsis benzoatilytica strain DSM 43387 plasmid pA387, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
gctgccgaggagaccgccgagaccgcc	Protospacer
************* *******. **

12. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
gacgccgtggagtgcgccgagggcgac	Protospacer
* .**** **** *************

13. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
agtgccgaggagaccgccgaggccgtg	Protospacer
. *********** ******** ** *

14. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to NC_016585 (Azospirillum lipoferum 4B plasmid AZO_p1, complete sequence) position: , mismatch: 5, identity: 0.815

gctgccgaggagagcgccgagggcgag	CRISPR spacer
gacgccgagaagggcgccgagggcgat	Protospacer
* .******.**.*************

15. spacer 1.1|1421643|27|NZ_CP044227|CRISPRCasFinder matches to JN698994 (Mycobacterium phage DS6A, complete genome) position: , mismatch: 6, identity: 0.778

gctgccgaggagagcgccgagggcgag	CRISPR spacer
agcgccgaggccagcgccgagggcgac	Protospacer
. .*******  **************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

528990 : 584784

Bacillus_phage(33.33%)

capsid,tail,plate,portal,terminase,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151075327.1\|528990_530043_-\|plate	baseplate J/gp47 family protein	A0A0M3LQN4	Mannheimia_phage	1.1e-31	30.4
WP_008982070.1\|530055_530412_-	hypothetical protein	NA	NA	NA	NA
WP_151075328.1\|530416_530824_-	hypothetical protein	NA	NA	NA	NA
WP_151075329.1\|530834_531785_-	hypothetical protein	A0A2H4J9E6	uncultured_Caudovirales_phage	5.5e-06	31.0
WP_151076614.1\|531781_532342_-	LysM peptidoglycan-binding domain-containing protein	A0A0E3XAL9	Bacillus_phage	4.7e-05	54.5
WP_151075330.1\|532375_532963_-	hypothetical protein	NA	NA	NA	NA
WP_151076615.1\|532959_533169_-	molybdopterin oxidoreductase	NA	NA	NA	NA
WP_008982064.1\|533249_533591_-	hypothetical protein	NA	NA	NA	NA
WP_008982063.1\|533592_533982_-	hypothetical protein	NA	NA	NA	NA
WP_151075331.1\|533994_535056_-\|tail	phage tail sheath protein	NA	NA	NA	NA
WP_151075332.1\|535052_535559_-	hypothetical protein	NA	NA	NA	NA
WP_151075333.1\|535555_535894_-	hypothetical protein	NA	NA	NA	NA
WP_151075334.1\|535890_536241_-	hypothetical protein	NA	NA	NA	NA
WP_008982058.1\|536237_537257_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_151075335.1\|537281_537623_-	hypothetical protein	NA	NA	NA	NA
WP_151075336.1\|537656_538589_-	hypothetical protein	NA	NA	NA	NA
WP_151075337.1\|538585_539728_-\|portal	phage portal protein	NA	NA	NA	NA
WP_151075338.1\|539795_541052_-\|terminase	PBSX family phage terminase large subunit	E5DV50	Deep-sea_thermophilic_phage	1.8e-113	48.8
WP_151075339.1\|541048_541348_-	XRE family transcriptional regulator	NA	NA	NA	NA
WP_151075340.1\|541517_542669_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.6e-39	35.3
WP_051355005.1\|542870_544928_+	1,4-alpha-glucan branching protein GlgB	NA	NA	NA	NA
WP_110441390.1\|544993_546202_+	glucose-1-phosphate adenylyltransferase	NA	NA	NA	NA
WP_008982051.1\|546198_547311_+	glucose-1-phosphate adenylyltransferase subunit GlgD	NA	NA	NA	NA
WP_008982050.1\|547418_548855_+	glycogen synthase GlgA	NA	NA	NA	NA
WP_008982049.1\|549147_551583_+	glycogen/starch/alpha-glucan phosphorylase	NA	NA	NA	NA
WP_008982048.1\|551743_552181_+	ribose 5-phosphate isomerase B	NA	NA	NA	NA
WP_151075341.1\|552250_555229_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075342.1\|555504_556179_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.2e-35	36.9
WP_008981974.1\|556307_556640_-	ArsC family transcriptional regulator	NA	NA	NA	NA
WP_151075343.1\|556636_556843_-	hypothetical protein	NA	NA	NA	NA
WP_008981973.1\|557322_558981_+	ribonuclease J	NA	NA	NA	NA
WP_151075344.1\|559641_562506_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075345.1\|562577_563228_-	hypothetical protein	NA	NA	NA	NA
WP_151075346.1\|563644_566746_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075347.1\|566804_567305_-	hypothetical protein	NA	NA	NA	NA
WP_151075348.1\|567719_570875_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075349.1\|570945_571413_-	hypothetical protein	NA	NA	NA	NA
WP_151075350.1\|571829_574982_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075351.1\|575045_575615_-	hypothetical protein	NA	NA	NA	NA
WP_151075352.1\|576030_579063_+	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_151075353.1\|579129_579612_-	hypothetical protein	NA	NA	NA	NA
WP_151075354.1\|580109_581285_+	cation transporter	NA	NA	NA	NA
WP_151075355.1\|581371_582073_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.2e-46	41.1
WP_151076616.1\|582121_583546_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.2e-12	28.4
WP_008981989.1\|583566_584784_+\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	2.8e-15	27.5

DBSCAN-SWA_2

1754975 : 1822950

Clostridium_phage(23.33%)

capsid,tail,plate,portal,terminase,protease,tRNA,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_110440401.1\|1754975_1756463_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_020989694.1\|1756689_1757694_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_151075979.1\|1757859_1759029_+	undecaprenyl/decaprenyl-phosphate alpha-N-acetylglucosaminyl 1-phosphate transferase	NA	NA	NA	NA
WP_151075980.1\|1759025_1760177_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	A0A1V0SAG5	Catovirus	9.2e-24	28.1
WP_110440398.1\|1760210_1760975_+	hypothetical protein	NA	NA	NA	NA
WP_151075981.1\|1761014_1761365_-	hypothetical protein	NA	NA	NA	NA
WP_151075982.1\|1761357_1761750_-	hypothetical protein	NA	NA	NA	NA
WP_151075983.1\|1761778_1762042_-	hypothetical protein	NA	NA	NA	NA
WP_020989696.1\|1762106_1762565_+	YfcE family phosphodiesterase	NA	NA	NA	NA
WP_084203545.1\|1762682_1764125_+	cardiolipin synthase	NA	NA	NA	NA
WP_151075984.1\|1764172_1764772_-	DUF4093 domain-containing protein	NA	NA	NA	NA
WP_008980972.1\|1764782_1765844_-	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_151075985.1\|1765857_1768191_-	DNA internalization-related competence protein ComEC/Rec2	M1PSD2	Streptococcus_phage	2.8e-11	31.8
WP_151075986.1\|1768331_1768949_-	folate family ECF transporter S component	NA	NA	NA	NA
WP_151075987.1\|1769271_1770141_+	ribosomal RNA small subunit methyltransferase A	NA	NA	NA	NA
WP_008980976.1\|1770329_1771937_+	phosphoenolpyruvate carboxykinase (ATP)	A0A2H4PQN1	Staphylococcus_phage	2.1e-119	47.3
WP_151075988.1\|1772007_1772679_+	DUF1275 domain-containing protein	NA	NA	NA	NA
WP_151075989.1\|1772725_1773913_-	diaminopropionate ammonia-lyase	NA	NA	NA	NA
WP_151075990.1\|1774333_1775413_-	S-layer homology domain-containing protein	NA	NA	NA	NA
WP_008980982.1\|1775409_1776081_-	redox-sensing transcriptional repressor Rex	NA	NA	NA	NA
WP_151075991.1\|1776185_1776899_-	RNA polymerase sporulation sigma factor SigE	A0A0Y0AU18	Bacillus_phage	5.5e-19	30.9
WP_151076646.1\|1776913_1777768_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_151075992.1\|1777946_1778261_+	PadR family transcriptional regulator	NA	NA	NA	NA
WP_151075993.1\|1778308_1779601_+	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_151075994.1\|1779626_1780835_+	DUF2812 domain-containing protein	NA	NA	NA	NA
WP_151075995.1\|1781045_1781759_+	hypothetical protein	NA	NA	NA	NA
WP_151075996.1\|1781846_1782668_-	amidase	H7BVK7	unidentified_phage	3.5e-49	45.6
WP_151075997.1\|1782664_1782994_-	hypothetical protein	NA	NA	NA	NA
WP_008980991.1\|1783075_1783300_-	hypothetical protein	A0A286QRT1	Streptococcus_phage	4.7e-09	51.7
WP_151075998.1\|1783299_1783782_-	hypothetical protein	NA	NA	NA	NA
WP_151075999.1\|1783774_1784260_-	hypothetical protein	NA	NA	NA	NA
WP_151076000.1\|1784474_1785203_-	hypothetical protein	NA	NA	NA	NA
WP_151076001.1\|1785408_1785915_+	hypothetical protein	NA	NA	NA	NA
WP_151076647.1\|1786073_1786808_-	N-acetylmuramoyl-L-alanine amidase	H7BVK7	unidentified_phage	7.1e-46	52.1
WP_151076002.1\|1786882_1787236_-	hypothetical protein	NA	NA	NA	NA
WP_151076003.1\|1787219_1787564_-	hypothetical protein	NA	NA	NA	NA
WP_151076004.1\|1787560_1787785_-	hypothetical protein	A0A286QRV3	Streptococcus_phage	2.1e-09	66.7
WP_151076005.1\|1787784_1788267_-	hypothetical protein	NA	NA	NA	NA
WP_151076006.1\|1788259_1788766_-	hypothetical protein	NA	NA	NA	NA
WP_151076007.1\|1788762_1789194_-	hypothetical protein	NA	NA	NA	NA
WP_151076008.1\|1789180_1790305_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151076009.1\|1790308_1790875_-	DUF2313 domain-containing protein	A0A0K2SUI5	Clostridium_phage	5.5e-14	34.5
WP_151076010.1\|1790888_1791992_-\|plate	baseplate J/gp47 family protein	A0A0A7RUN3	Clostridium_phage	5.7e-39	38.3
WP_151076011.1\|1791957_1792389_-	DUF2634 domain-containing protein	J9QE34	Clostridium_phage	7.7e-24	39.6
WP_151076012.1\|1792385_1792829_-	DUF2577 domain-containing protein	NA	NA	NA	NA
WP_151076013.1\|1792825_1793812_-	hypothetical protein	NA	NA	NA	NA
WP_151076014.1\|1793808_1794465_-	LysM peptidoglycan-binding domain-containing protein	A0A0A7RVP5	Clostridium_phage	5.4e-13	28.7
WP_151076015.1\|1794461_1796558_-	tape measure protein	A0A2H4IZQ5	uncultured_Caudovirales_phage	1.2e-08	44.6
WP_151076016.1\|1796750_1797170_-	hypothetical protein	NA	NA	NA	NA
WP_151076648.1\|1797182_1797608_-\|tail	phage tail tube protein	A0A1V0DZX1	Clostridioides_phage	3.8e-23	41.4
WP_151076017.1\|1797613_1798696_-\|tail	phage tail sheath protein	A0A0A7S0D2	Clostridium_phage	1.7e-48	33.0
WP_151076018.1\|1798698_1799163_-	hypothetical protein	NA	NA	NA	NA
WP_151076019.1\|1799162_1799612_-	hypothetical protein	NA	NA	NA	NA
WP_151076020.1\|1799612_1800182_-	hypothetical protein	NA	NA	NA	NA
WP_151076021.1\|1800193_1800520_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_151076022.1\|1800522_1801884_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_151076023.1\|1801732_1802446_-\|protease	Clp protease ClpP	A0A2H4JAJ9	uncultured_Caudovirales_phage	4.8e-31	43.9
WP_151076024.1\|1802442_1803714_-\|portal	phage portal protein	Q9ZXF8	Bacillus_phage	2.9e-42	31.4
WP_151076025.1\|1803710_1803890_-	hypothetical protein	NA	NA	NA	NA
WP_151076026.1\|1803923_1805687_-\|terminase	terminase	A0A2I7SBY8	Paenibacillus_phage	2.0e-126	46.7
WP_151076027.1\|1805679_1806162_-\|terminase	phage terminase small subunit P27 family	Q9ZXG2	Bacillus_phage	2.5e-15	34.4
WP_151076028.1\|1806356_1806728_-	HNH endonuclease	A0A1U7Q1S7	Geobacillus_virus	1.4e-13	36.5
WP_151076029.1\|1806799_1807000_-	hypothetical protein	NA	NA	NA	NA
WP_151076030.1\|1807072_1807840_-	hypothetical protein	NA	NA	NA	NA
WP_151076031.1\|1807832_1808054_-	hypothetical protein	NA	NA	NA	NA
WP_151076032.1\|1808038_1808305_-	hypothetical protein	NA	NA	NA	NA
WP_151076033.1\|1808364_1808628_+	hypothetical protein	NA	NA	NA	NA
WP_151076034.1\|1808682_1809105_-	single-stranded DNA-binding protein	A0A0K2CYR2	Paenibacillus_phage	4.9e-23	41.5
WP_151076035.1\|1809474_1811397_-	hypothetical protein	NA	NA	NA	NA
WP_151076036.1\|1811323_1811662_-	hypothetical protein	NA	NA	NA	NA
WP_151076037.1\|1811658_1812633_-	DUF3102 domain-containing protein	A0A2H4J025	uncultured_Caudovirales_phage	1.6e-21	45.5
WP_151076038.1\|1812625_1813399_-	ParA family protein	H7BUL8	unidentified_phage	1.4e-23	30.7
WP_151076039.1\|1813413_1813611_-	hypothetical protein	NA	NA	NA	NA
WP_151076040.1\|1813607_1814930_-	hypothetical protein	I6S783	Marinomonas_phage	2.4e-36	28.5
WP_151076041.1\|1814926_1815715_-	hypothetical protein	F8J194	Lactobacillus_virus	4.8e-16	48.4
WP_151076042.1\|1815950_1816208_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_151076043.1\|1816272_1816617_-	hypothetical protein	NA	NA	NA	NA
WP_151076044.1\|1816664_1817114_-	helix-turn-helix transcriptional regulator	A0A1L2BY71	Clostridium_phage	9.5e-17	36.6
WP_151076045.1\|1817144_1817351_-	helix-turn-helix transcriptional regulator	X2JN57	Bacillus_phage	2.9e-05	46.4
WP_151076046.1\|1817475_1817862_+	DUF2513 domain-containing protein	A0A0H4TJ44	Erysipelothrix_phage	1.8e-08	35.4
WP_151076047.1\|1818190_1818526_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_151076649.1\|1818691_1820059_+	DUF4041 domain-containing protein	M1NRY5	Streptococcus_phage	1.5e-76	56.2
WP_151076048.1\|1820091_1821336_+	hypothetical protein	NA	NA	NA	NA
WP_151076049.1\|1821429_1822950_+	recombinase family protein	I2E8X2	Clostridium_phage	8.9e-83	37.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage