CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP031695	Erwinia billingiae strain TH88 chromosome, complete genome	4 crisprs	cas3,DEDDh,csa3,DinG	0	0	3	0
NZ_CP031696	Erwinia billingiae strain TH88 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031695_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031695_1

1834267-1834406

Orphan

Consensus_repeat	Method
GGATTCACGGCGACTTTGCGTTCAACGCGCCCTCCCTGACCCGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031695_1

>merge|NZ_CP031695|1|1834267-1834406|CRISPRCasFinder
GGATTCACGGCGACTTTGCGTTCAACGCGCCCTCCCTGACCCGTCACCCGAACCCGCAGACGACTTCCCCCAAAGGAACCACTGCATCATGAAGGGATTCACGGCGACTTTGCGTTAAACGCGCCCTCCCTGACCCGTCA

>NZ_CP031695|1|1|1834267-1834406|CRISPRCasFinder
GGATTCACGGCGACTTTGCGTTCAACGCGCCCTCCCTGACCCGTCA	CCCGAACCCGCAGACGACTTCCCCCAAAGGAACCACTGCATCATGAAG
GGATTCACGGCGACTTTGCGTTAAACGCGCCCTCCCTGACCCGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031695.1\|WP_151037097.1\|1826540_1827086_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238496
NZ_CP031695.1\|WP_105759945.1\|1837712_1838474_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031695.1\|WP_151037108.1\|1842129_1843404_-\|OprD-family-porin	unknown	unknown	gnl\|CDD\|335381
NZ_CP031695.1\|WP_151037106.1\|1839635_1840403_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223673
NZ_CP031695.1\|WP_151037095.1\|1824563_1825160_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|380339
NZ_CP031695.1\|WP_151037104.1\|1836844_1837480_-\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380064
NZ_CP031695.1\|WP_151037102.1\|1833456_1833939_-\|glutathione-peroxidase	unknown	unknown	gnl\|CDD\|238207
NZ_CP031695.1\|WP_151037094.1\|1823833_1824520_-\|B3/4-domain-containing-protein	unknown	unknown	gnl\|CDD\|225917
NZ_CP031695.1\|WP_151037107.1\|1841145_1841841_-\|thiaminase-II	unknown	unknown	gnl\|CDD\|381702
NZ_CP031695.1\|WP_151037109.1\|1843556_1844957_-\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223354
NZ_CP031695.1\|WP_151037098.1\|1827371_1828574_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|182309
NZ_CP031695.1\|WP_013202742.1\|1835295_1836675_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|281959
NZ_CP031695.1\|WP_151037096.1\|1825508_1826087_+\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP031695.1\|WP_151038689.1\|1840399_1841134_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224041
NZ_CP031695.1\|WP_151037105.1\|1838674_1839610_-\|thiamine-biosynthesis-protein	unknown	unknown	gnl\|CDD\|270369
NZ_CP031695.1\|WP_134824427.1\|1830535_1830766_-\|YgdI/YgdR-family-lipoprotein	unknown	unknown	gnl\|CDD\|380215
NZ_CP031695.1\|WP_151037100.1\|1831494_1832469_-\|acyltransferase	unknown	unknown	gnl\|CDD\|143609
NZ_CP031695.1\|WP_151037101.1\|1832569_1833460_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176106
NZ_CP031695.1\|WP_151037103.1\|1834456_1835278_-\|glycosyltransferase-family-8-protein	unknown	unknown	gnl\|CDD\|133018
NZ_CP031695.1\|WP_151037099.1\|1828637_1829642_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117

Protein	Function_ID	Function_description	E-value
NZ_CP031695.1\|WP_151037097.1\|1826540_1827086_+\|cysteine-hydrolase	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	3.54809e-51
NZ_CP031695.1\|WP_151037108.1\|1842129_1843404_-\|OprD-family-porin	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	0.000341773
NZ_CP031695.1\|WP_151037106.1\|1839635_1840403_-\|ABC-transporter-permease	gnl\|CDD\|223673	COG0600, TauC, ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism].	5.42343e-62
NZ_CP031695.1\|WP_151037095.1\|1824563_1825160_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|380339	cd02209, cupin_XRE_C, XRE (Xenobiotic Response Element) family transcriptional regulators, C-terminal cupin domain. This family contains transcriptional regulators containing an N-terminal XRE (Xenobiotic Response Element) family helix-turn-helix (HTH) DNA-binding domain and a C-terminal cupin domain. Included in this family is Escherichia coli transcription factor SutR (YdcN) that plays a regulatory role in sulfur utilization; it regulates a set of genes involved in the generation of sulfate and its reduction, the synthesis of cysteine, the synthesis of enzymes containing Fe-S as cofactors, and the modification of tRNA with use of sulfur-containing substrates. This family belongs to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold capable of homodimerization.	2.32947e-10
NZ_CP031695.1\|WP_151037104.1\|1836844_1837480_-\|TetR-family-transcriptional-regulator	gnl\|CDD\|380064	pfam17938, TetR_C_29, Tetracyclin repressor-like, C-terminal domain. This domain is found in the C-terminal region of putative TetR-family regulatory proteins.	3.31123e-45
NZ_CP031695.1\|WP_151037102.1\|1833456_1833939_-\|glutathione-peroxidase	gnl\|CDD\|238207	cd00340, GSH_Peroxidase, Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.	3.4223e-95
NZ_CP031695.1\|WP_151037094.1\|1823833_1824520_-\|B3/4-domain-containing-protein	gnl\|CDD\|225917	COG3382, COG3382, Solo B3/4 domain (OB-fold DNA/RNA-binding) of Phe-aaRS-beta [General function prediction only].	1.11754e-89
NZ_CP031695.1\|WP_151037107.1\|1841145_1841841_-\|thiaminase-II	gnl\|CDD\|381702	cd19367, TenA_C_ScTHI20-like, TenA_C family similar to the C-terminal TenA_C domain of Saccharomyces cerevisiae THI20 protein. This TenA family belongs to the TenA_C class as it has a conserved active site Cys residue; the double Glu residues identified in the active site of TenA_E from the archaeon Pyrococcus furiosus is conserved in this family. TenA_C proteins (EC 3.5.99.2) catalyze the hydrolysis of the thiamin breakdown product 4-amino-5-amino-methyl-2-methylpyrimidine (amino-HMP) to 4-amino-5-hydroxymethyl-2-methylpyrimidine (HMP) in a thiamin salvage pathway. Saccharomyces cerevisiae THI20 includes a C-terminal tetrameric TenA-like domain fused to an N-terminal HMP kinase/HMP-P kinase (ThiD-like) domain, and participates in thiamin biosynthesis, degradation and salvage; the TenA-like domain catalyzes the production of HMP from thiamin degradation products (salvage). A majority of this family are single-domain TenA_C- like proteins; some however have additional domains such as a ThiD domain. It has also been suggested that TenA proteins act as transcriptional regulators based on changes in gene-expression patterns when TenA is overexpressed in Bacillus subtilis, however this effect may be indirect.	1.09266e-111
NZ_CP031695.1\|WP_151037109.1\|1843556_1844957_-\|FAD-binding-oxidoreductase	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	7.29871e-46
NZ_CP031695.1\|WP_151037098.1\|1827371_1828574_-\|MFS-transporter	gnl\|CDD\|182309	PRK10213, nepI, purine ribonucleoside efflux pump NepI.	1.16186e-96
NZ_CP031695.1\|WP_013202742.1\|1835295_1836675_-\|FAD-binding-protein	gnl\|CDD\|281959	pfam04030, ALO, D-arabinono-1,4-lactone oxidase. This domain is specific to D-arabinono-1,4-lactone oxidase EC:1.1.3.-, which is involved in the final step of the D-erythroascorbic acid biosynthesis pathway.	1.89431e-50
NZ_CP031695.1\|WP_151037096.1\|1825508_1826087_+\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	3.79137e-26
NZ_CP031695.1\|WP_151038689.1\|1840399_1841134_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224041	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism].	3.28441e-77
NZ_CP031695.1\|WP_151037105.1\|1838674_1839610_-\|thiamine-biosynthesis-protein	gnl\|CDD\|270369	cd13651, PBP2_ThiY, Substrate binding domain of ABC-type transporters for thiamin biosynthetic pathway intermediates; a member of the type 2 periplasmic binding fold superfamily. ThiY is the periplasmic N-formyl-4-amino-5-(aminomethyl)-2-methylpyrimidine (FAMP) binding component of the ABC transport system (ThiXYZ). FAMP is imported into cell by the transporter, where it is then incorporated into the thiamin biosynthetic pathway. The closest structural homologs of ThiY are periplasmic binding proteins involved in alkanesulfonate/nitrate and bicarbonate transport , as well as THI5 which is responsible for the synthesis of 4-amino-5-(hydroxymethyl)-2-methylpyrimidine phosphate (HMP-P) in the thiamin biosynthetic pathway of eukaryotes. After binding the ligand, they interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The ThiY/THI5 proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.03893e-97
NZ_CP031695.1\|WP_134824427.1\|1830535_1830766_-\|YgdI/YgdR-family-lipoprotein	gnl\|CDD\|380215	NF033216, lipo_YgdI_YgdR, YgdI/YgdR family lipoprotein. Members of this family are exclusively lipoproteins of small size, including YgdI and YgdR from E. coli K-12.	2.32936e-30
NZ_CP031695.1\|WP_151037100.1\|1831494_1832469_-\|acyltransferase	gnl\|CDD\|143609	cd07585, nitrilase_7, Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.	1.45813e-123
NZ_CP031695.1\|WP_151037101.1\|1832569_1833460_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176106	cd08414, PBP2_LTTR_aromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the substrate-binding domains from ionotropic glutamate receptors, LysR-like transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	2.14997e-39
NZ_CP031695.1\|WP_151037103.1\|1834456_1835278_-\|glycosyltransferase-family-8-protein	gnl\|CDD\|133018	cd02537, GT8_Glycogenin, Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.	2.30866e-76
NZ_CP031695.1\|WP_151037099.1\|1828637_1829642_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	1.21947e-23

>NZ_CP031695.1|WP_151037102.1|1833456_1833939_-|glutathione-peroxidase
MTTFHQLSATRLDGKPVSMADYAGKLVLVVNTASHCGFTPQYAGLEALNKKYAAQGLVVLGFPCNQFGKQEPGGADEIAQTCHINYGVSFPMFGKVEVNGANSHPVFRYLKDALPGVLGGRIKWNFTKFLIGRDGKPLKRFAPFTKPEQMESVIVAALEL
>NZ_CP031695.1|WP_151037101.1|1832569_1833460_+|LysR-family-transcriptional-regulator
MNIRLLKAFLMLAEKGNYADAARALCISQPALTKQINLLESTVKVSLFSRGRHGATLTAGGRRLLPEAEKVVRQTQLFMHHAERVSVGIEGHIAVGFGLSSFYLAPRCIADFRRDCPGIEMSLTDLPSFLQYEQLQNDELQVGFVRVPPPVALDYLPLFTDRLVLIAPATPALSLSAAEWLKKCPLLRLHTERGQGLNAQIDRFLQDNGLFISSTQLADDIHTIVALVIAGTGVAILPYSVLHIAPPERVIIPLAGKSISWKVGIAWNAGSENVIRDNFIASIRKRIAVDSINTRP
>NZ_CP031695.1|WP_151037100.1|1831494_1832469_-|acyltransferase
MHELTSLKAATVQFQHRANDKKYNLLIMEKFIEQAAIQQVKILTFPEMCLTGYWHVPKLTTAEVSDLAESIASSPSLMLIRALSIKHQMLIGAGLIERADDGRLYNAYVACMPDGSMQTHRKLHAFEHPAISSGDRFTVFDTPWGVKVGILICWDNNLVENVRATALLGADILLAPHQTGGTDSRSPYAMKPIPLALWAERETRKEEMTAAFKGPSGREWLMRWLPARAHDNGLFLLFSNGVGADDDEVRTGNAMILDPYGRIINETWAAEDCMVSAELDLSLLAMSTGRRWIHGRRPDLYQILTQPQGYERDAISARFSDEIP
>NZ_CP031695.1|WP_134824427.1|1830535_1830766_-|YgdI/YgdR-family-lipoprotein
MKKTVLFPLVALVCIAALSGCTRSSYAIHTNDGRTIVSDGKPHEDAKTGLIAYTDANGKKQQINTSEVKSMSEIGH
>NZ_CP031695.1|WP_151037099.1|1828637_1829642_+|AraC-family-transcriptional-regulator
MMPHPDFLPETPVMPVNKHFALSSELISELLQEMRLRGVQYRRLQTGSEFGVGFSSRPGHAYFHYIAVGTALLRTHDGTLHELKAGSMVFMPQGGDHQLVSDVSCSVQHIDTLGSAPLGEAVSGINTCPSSHPTPSTVLFYGCMAFDLGGMQGLGKLMPQAIVVEANEQIYPGLVPILGAMKFEICSGRAGFAGILARLAEVAAAMIVRGWIENGSENAAGLIAALRDPRLAHAILAIHRDTGREWSVAELAAQSHVSRSVFAERFKSIIGIPPQRYAREVRMRIAGHWIIHEKIAIETVALRLGYASQAAFSRAFKRINGYPPGAMRQRPARR
>NZ_CP031695.1|WP_151037098.1|1827371_1828574_-|MFS-transporter
MRNESTEAVSASLNSSEPKESAWMAVISLTMGVFGLLTAEYLPASLLTPMAADLGVTEALAGQAVTVTAVVALFAGLMVPRLTRNYDRRNVLLGFTVLMIASNLLVALSSSLAVLLVMRILLGIALGGFWSMAAAVAMRLVPAKSVPRALSIIFSGIAVGTVVSIPLGSYLGGLYGWRSAFIAATAVGVLTLIFQLFTLPGMAPRRMMITASVMDLLRRPGITMGMTGCVIAHTGQYALFTYIRPALENIAQLDVDRLSLVLLGFGIANFIGTLLAGWLMERSLRLTLIIMPALVGFAALSMILLPLDEKGLMLFVALWGMAFGGVPVAWSNWVARSVPDQAETAGGMVVAAVQSSIAAGAALGGLLFGISGVTGVFITAGCIMFFATLVIGLKVRVALT
>NZ_CP031695.1|WP_151037097.1|1826540_1827086_+|cysteine-hydrolase
MISSENALLVIDMQQGLFHGPVTPHSADTVLSNICLLIAKARQAQVPVFFARHTGPDDSPFSKQSPLTLLIPEMDVNAERDIVFIKKYPSCFRDTDLNLQLVQRGVKQLVIAGMKTEFCVDTTCRAAKELEFRIVLISDAHTTMDNEHLSANQIVDHHNVTLAGPFVTLSSAADWSFASNK
>NZ_CP031695.1|WP_151037096.1|1825508_1826087_+|YceI-family-protein
MTRILPAIALVFLFHPFSVYANPTSYSVNTQKTTISLSWHAFGDVSKACMGRVTGEITLDAGNERDDRIDVTIPVASLEASNALLTYQLKSRPFFDAESFPNIAFTSSRVVALGNGHFRLFGRLQIKNVTRPVILNASLDAKIGELSGTKNIVLHASTAISRAAFNMDSFAALVDDTVTINIEIQARPNKGA
>NZ_CP031695.1|WP_151037095.1|1824563_1825160_+|helix-turn-helix-domain-containing-protein
MTKKVNITTDAGAARVNEAVSAHVKLYRSQKKMSLDELSRRSGVSKGMLVEIEGCRANPSIALLCRLASAMNVSVADFVNVAGKPAVHLIDSGAIPVLWKGEKGGSARLLAGTSGPDMVELWEWVLYPGETFESPGHPEGTSELLHVSKGTLTLVVSDTTYIINQGSAAVARTDAPHAYMNNDAGVTVFIMTVNEKGR
>NZ_CP031695.1|WP_151037094.1|1823833_1824520_-|B3/4-domain-containing-protein
MPTVSPSISPEIYRIAPGFRALSISVEATTVADEQVGEVALREACEAVLAGHPAWAEAHLNAWAEVFRAFGAKPKRTPCSAEALRKRVLKDGTMASLDPVVDLYNAVSIQYAVPVGGENFAAYTGRPRLILADGTEIFDTMKDGQPGSELPEVGEVIWRDDTGVTCRRWNWRQGIRTRLSVADSRMWFILESLPQMPLEELHSAGKMLTDGLEKMMPGTRCHTVLISE
>NZ_CP031695.1|WP_151037103.1|1834456_1835278_-|glycosyltransferase-family-8-protein
MKAWTTLLTQPGYLVGVQALQKSLVKSGSAFPLVVMVTENIDADARKALETAGCLLRDVQPISPNSSLQNNYANARFSEVWTKLAVWKLTEFERIVFLDADMLVTQNMDELFELPLEEDQIAACHACRCNPNKIPSYPKSWRPENCFYSFCRGIEHTEELEEVDNYLNGGFLVLRPDQAIFEDMLHQLAELDDLSRYLFAEQDFLNDYFHERWKPLPYIYNALKTLPFQHSAMWDLDEVKNIHFIIDKPWEKALDKGDRYYALNKMWWDIAEA
>NZ_CP031695.1|WP_013202742.1|1835295_1836675_-|FAD-binding-protein
MTSENRGYPLRNPHPAADGKVWNWAQNSTLGDKNAVCAPESESELQQLVAASRGKIRVMGSKMSPGRMLKLVEQGDTLVDLSKLRGLIAITDDSATFAGGTPLHEVYEILSGIGRMLPASPGVIASQSLAGALSTGTHGQGLQQSSIADEALSIRLVLADGSIAEYDRDHKWFPAVQLGLGSLGVLTQVTLRTTPSVVYTCFKNAVSADTLEEDLLDWNHNYALSKAWWFPNENQVHVWAAREANAEEIALYQDNNEDLVKQEETSDAMNETIDQTLEHMRSDTKILDENGKPFRTVTRFKDFSDVTGDVYQVFCRGIATPQINVEIGIPLARAGEVIRKIKAWHADTQPHMHYPIILRCTGPSSSWLSPAYQQDTCFFGFVVYYSEDGSLSEEGVNFLRAVEEVLAEEGGRPHWGKYFEAPLYDWAALYPQWHEFASVREALDPQHKFENAFTAALLD
>NZ_CP031695.1|WP_151037104.1|1836844_1837480_-|TetR-family-transcriptional-regulator
MSVTAKRKNDPEGLKKRILAGALATFAEFGLQGARMEQIAEHAQTTKRMVVYHFSNKENLYVEVLEQVYQEIRQHETGLNLAEMPPVIAMARLAEASFDYHITHPDFMRLVCTENLMRGRYISQSERIKTLNQSALDVLEDILARGKTAGVFDSKADTVDVHRLISSICTHNVSNRYTFNTLFGGGESEQQSISRNRQLVVDATLRYLRPI
>NZ_CP031695.1|WP_105759945.1|1837712_1838474_-|hypothetical-protein
MSNFLSPAAAYLNRRNELLAQRSVVESPVVIQTINKALLASEIAMATFHDLEALKTLQLRKARLIDWHEADSQQELQNFELASNALTLADDDNEQAFLSYQRDFALMAASFSWQHASLQIVQNELFATTFNLWLETLEELFALPDRKLLFTRISKILAFSIGKIPVLGEAIDVYRMLVSVMSASLEKAKSSDAYFSTLESYTEAANICSRGILIFCFTTEAVLRGRPLPNEAQLNEKIKGHYASVIDGTHPYF
>NZ_CP031695.1|WP_151037105.1|1838674_1839610_-|thiamine-biosynthesis-protein
MFKKTLCGLLLTAACAHAASANDKLTLVLDWYINPDHAPIMVAEQIGAFKEQGLDVKIVPPSDPALPPRLVAAKQADLAITYQPQLHFFADQGLPLMRVGTLINSPLNTVMTLDKSITSPAGLKGKKIGYSVSGIEQATLGTMLNHEKVSLDQVKMVNVNFQLNSALMAGQVDAVIGGYRNIEALELKQHGQDPQVFNVEDYGVPAYDELIIVANRDEVNAPKIKKFLIALKKGSDYLHAHPQESWDAFASAHPDLNNALNKAAWMKTLPLFARDPAHLDTARYQAYERFLFDHKLIQKITPVNNYAMELR
>NZ_CP031695.1|WP_151037106.1|1839635_1840403_-|ABC-transporter-permease
MISVKESAFGRWRRGLTVFIGLIAVWWAITRSGVPAFLLPTPMSVADALWTSRAYLAAHTLVTAAEIVSGLVAGVLLGAILALCMMFSPRLQHWLMPLVLTSQAIPVFALAPLLVLWFGFGISAKVAMAVLVIFFPVTSAFFDGLRRVNNDFLDLARTMGASRWALLRHVRLMAALPAFGSGLRMAAAVAPIGAIIGEWVGAGEGLGYVMLNANARMQTELCFAALFILVLMTLLLWLAVDSALRRLIRWAPEND
>NZ_CP031695.1|WP_151038689.1|1840399_1841134_-|ABC-transporter-ATP-binding-protein
MARGVIPPGIQVRDLTLRYGARTVFERLNVDITGGQFAAMLGASGVGKTSLLKIIAGLAQPTAGTVTGSDGLPVQGRVAYMGQQDLLYPWLTVRDNISLASRLRGEKPDREWADELTARVGLSGYGDSLPAGLSGGMRQRAALARTLYQRQPMVLMDEPFSALDAITRTRIQTLASALLTGHTVLLITHDPLEACRLSHQLLVLSAAGIDDSHQIAGLPPRAPDDRHLLQSQGELLQQLTRAAE
>NZ_CP031695.1|WP_151037107.1|1841145_1841841_-|thiaminase-II
MSDNMFSRGLYGQLRQQAAADWQHYVNHPFLQQLAQGTLPESAFRRYLTQDYLFLIHFARAYALLVSKFRTLPEMRAATASLNAIVAELPLHVGYCTQWGISESQMRNEQEAPETLNYTRYVLDIGQSGDALDLLAALLPCVAGYAEIGLGLLHNPATVTEGNPYRSWIANYGDENYLASVQRAINLLETVGVQRGAQSRLPELATIFTTATRLESAFWQMGLNASLSNVG
>NZ_CP031695.1|WP_151037108.1|1842129_1843404_-|OprD-family-porin
MKTKKVNFALKLGALVVSQALLMGQALAAAPVSDCDAGVANSLTEMFTCGSVHGSLRSLYYSTHNAYFSSGYSQDTVSYGGSVKYATAEYYGLSLGVSGILQRGISHNDDHLIGELGPNETGVGEAYLSWHYQDFRITAGDQRINIPFIGDYDWRITPILFRGVDANYGDSDNFLHATKITRYKPWGDDQFLDTTAYTDADGRTNGMWGIGGGRALKLDDKKLTGQLWYEEYNNYTKMVYADSFLSWSENPLQPKIGVQFIRGLSQGDALAGEVNSTSYGAQYAMNFMPSLRWSLNWDHIAASENAYGNGALVTPYAHNTSSGQYFAQPFFTSTQDLGSGNAYSTDLNWTANSNISLGSRYSFMDLTASAGAPSSNQSEYLIYGTYSFDGVLKGLSLTDFVGVQTTSTSDKNFWQNRLALEYDF
>NZ_CP031695.1|WP_151037109.1|1843556_1844957_-|FAD-binding-oxidoreductase
MDSEQRKNAVEQMLLALPDLEWTLQAPKVKRLSRDFHWFSPVLKQQLENKQADAVVRPRNEEELSLLVKACVQHGLPLILRGGATGNYGQLVPLQGGILVDMTAFNQVVERAEGRVRAQAGIRLAEIETVTRPEGWELRCMPSTYRLATLGGLYGGGFGGIGSINYGPLGAPGNVLSVKVMTMEAEPRILSVPAPQALLLHHAYGSNGIVLEVELALAPVHQWIERLDVFDDFTDALDYANAFARSPGLVKRQLALFAAPIPSYFTHLNGNYQATQHAVISVIAEQSEGLCSGLLEKYRGQNAVRQTADEAREANASLMEYCWNHTTLHALKVDSTLTYLQTAFNYSTYRQQIIAMAELFGDEVISHIEFLRDNDSNITASGLQLIRYSSEERLNEIMQIFRDHDVKINNPHVFTIEEGKQGEIKAEVVSVKKALDPAGLLNPGKLQGWDVRDTLELQSDPLSLNT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031695_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031695_2

3264778-3264896

Orphan

Consensus_repeat	Method
GTTGTTGTGGAGCTGGGTGGCTGCACAGGTCAAAACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031695_2

>merge|NZ_CP031695|2|3264778-3264896|CRISPRCasFinder
GTTGTTGTGGAGCTGGGTGGCTGCACAGGTCAAAACCCGTTCCGTGTTACGGCGTCGACATAGGACACCCTTAAGCTTCTGCGTTGTTGGGGAGCTGGGTGGCTGCACAGGTCAAAACC

>NZ_CP031695|2|2|3264778-3264896|CRISPRCasFinder
GTTGTTGTGGAGCTGGGTGGCTGCACAGGTCAAAACC	CGTTCCGTGTTACGGCGTCGACATAGGACACCCTTAAGCTTCTGC
GTTGTTGGGGAGCTGGGTGGCTGCACAGGTCAAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031695.1\|WP_105759409.1\|3271587_3272808_-\|imidazolonepropionase	unknown	unknown	gnl\|CDD\|236478
NZ_CP031695.1\|WP_013201458.1\|3257150_3257654_+\|DNA-starvation/stationary-phase-protection-protein-Dps	unknown	unknown	gnl\|CDD\|236521
NZ_CP031695.1\|WP_105759405.1\|3267235_3267979_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226634
NZ_CP031695.1\|WP_151037884.1\|3264955_3266458_-\|histidine-ammonia-lyase	unknown	unknown	gnl\|CDD\|225533
NZ_CP031695.1\|WP_151037888.1\|3274236_3274785_+\|HutD-family-protein	unknown	unknown	gnl\|CDD\|377578
NZ_CP031695.1\|WP_013201454.1\|3259795_3260518_+\|glutamine-ABC-transporter-ATP-binding-protein-GlnQ	unknown	unknown	gnl\|CDD\|181906
NZ_CP031695.1\|WP_013201446.1\|3268724_3269582_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270417
NZ_CP031695.1\|WP_151038750.1\|3272884_3274240_+\|formimidoylglutamate-deiminase	unknown	unknown	gnl\|CDD\|236420
NZ_CP031695.1\|WP_151037881.1\|3257742_3258006_+\|DksA/TraR-family-C4-type-zinc-finger-protein	unknown	unknown	gnl\|CDD\|182903
NZ_CP031695.1\|WP_151037883.1\|3263974_3264604_+\|flavin-reductase-family-protein	unknown	unknown	gnl\|CDD\|224766
NZ_CP031695.1\|WP_151037880.1\|3255870_3256764_+\|threonine/homoserine-exporter-RhtA	unknown	unknown	gnl\|CDD\|182525
NZ_CP031695.1\|WP_151037882.1\|3260651_3262919_+\|mechanosensitive-channel-protein	unknown	unknown	gnl\|CDD\|183147
NZ_CP031695.1\|WP_151037887.1\|3270811_3271591_-\|N-formylglutamate-deformylase	unknown	unknown	gnl\|CDD\|131072
NZ_CP031695.1\|WP_013201449.1\|3266460_3267243_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226961
NZ_CP031695.1\|WP_151037885.1\|3267991_3268708_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|226670
NZ_CP031695.1\|WP_151037879.1\|3254989_3255505_-\|outer-membrane-protein-OmpX	unknown	unknown	gnl\|CDD\|181828
NZ_CP031695.1\|WP_151037886.1\|3270016_3270772_+\|histidine-utilization-repressor	unknown	unknown	gnl\|CDD\|188194
NZ_CP031695.1\|WP_013201456.1\|3258303_3259050_+\|glutamine-ABC-transporter-substrate-binding-protein-GlnH	unknown	unknown	gnl\|CDD\|236540
NZ_CP031695.1\|WP_013201452.1\|3262915_3263848_-\|23S-rRNA-(adenine(1618)-N(6))-methyltransferase-RlmF	unknown	unknown	gnl\|CDD\|236964
NZ_CP031695.1\|WP_013201455.1\|3259139_3259799_+\|glutamine-ABC-transporter-permease-GlnP	unknown	unknown	gnl\|CDD\|181907

Protein	Function_ID	Function_description	E-value
NZ_CP031695.1\|WP_105759409.1\|3271587_3272808_-\|imidazolonepropionase	gnl\|CDD\|236478	PRK09356, PRK09356, imidazolonepropionase; Validated.	0
NZ_CP031695.1\|WP_013201458.1\|3257150_3257654_+\|DNA-starvation/stationary-phase-protection-protein-Dps	gnl\|CDD\|236521	PRK09448, PRK09448, DNA starvation/stationary phase protection protein Dps; Provisional.	2.98295e-108
NZ_CP031695.1\|WP_105759405.1\|3267235_3267979_-\|ABC-transporter-permease	gnl\|CDD\|226634	COG4160, ArtM, ABC-type arginine/histidine transport system, permease component [Amino acid transport and metabolism].	1.4107e-85
NZ_CP031695.1\|WP_151037884.1\|3264955_3266458_-\|histidine-ammonia-lyase	gnl\|CDD\|225533	COG2986, HutH, Histidine ammonia-lyase [Amino acid transport and metabolism].	0
NZ_CP031695.1\|WP_151037888.1\|3274236_3274785_+\|HutD-family-protein	gnl\|CDD\|377578	pfam05962, HutD, HutD. HutD from Pseudomonas fluorescens SBW25 is a component of the histidine uptake and utilisation operon. HutD is operonic with the well characterized repressor protein HutC. Genetic analysis using transcriptional fusions (lacZ) and deletion mutants shows that hutD is necessary to maintain fitness in environments replete with histidine. Evidence outlined by Zhang & Rainey (2007) suggests that HutD functions as a governor that sets an upper bound on the level of hut operon transcription. The mechanistic basis is unknown, but in silico molecular docking studies based on the crystal structure of PA5104 (HutD from Pseudomonas aeruginosa) show that urocanate (the first breakdown product of histidine) docks with the active site of HutD.	6.95071e-62
NZ_CP031695.1\|WP_013201454.1\|3259795_3260518_+\|glutamine-ABC-transporter-ATP-binding-protein-GlnQ	gnl\|CDD\|181906	PRK09493, glnQ, glutamine ABC transporter ATP-binding protein GlnQ.	0
NZ_CP031695.1\|WP_013201446.1\|3268724_3269582_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270417	cd13699, PBP2_OccT_like, Substrate binding domain of ABC-type octopine transporter-like; the type 2 periplasmic-binding protein fold. This group includes periplasmic octopine-binding protein and related proteins. This group belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.08337e-112
NZ_CP031695.1\|WP_151038750.1\|3272884_3274240_+\|formimidoylglutamate-deiminase	gnl\|CDD\|236420	PRK09229, PRK09229, N-formimino-L-glutamate deiminase; Validated.	0
NZ_CP031695.1\|WP_151037881.1\|3257742_3258006_+\|DksA/TraR-family-C4-type-zinc-finger-protein	gnl\|CDD\|182903	PRK11019, PRK11019, DksA/TraR family C4-type zinc finger protein.	1.09439e-51
NZ_CP031695.1\|WP_151037883.1\|3263974_3264604_+\|flavin-reductase-family-protein	gnl\|CDD\|224766	COG1853, COG1853, Conserved protein/domain typically associated with flavoprotein oxygenases, DIM6/NTAB family [General function prediction only].	8.44058e-41
NZ_CP031695.1\|WP_151037880.1\|3255870_3256764_+\|threonine/homoserine-exporter-RhtA	gnl\|CDD\|182525	PRK10532, PRK10532, threonine and homoserine efflux system; Provisional.	3.45315e-148
NZ_CP031695.1\|WP_151037882.1\|3260651_3262919_+\|mechanosensitive-channel-protein	gnl\|CDD\|183147	PRK11465, PRK11465, putative mechanosensitive channel protein; Provisional.	0
NZ_CP031695.1\|WP_151037887.1\|3270811_3271591_-\|N-formylglutamate-deformylase	gnl\|CDD\|131072	TIGR02017, hutG_amidohyd, N-formylglutamate amidohydrolase. In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This model represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate. [Energy metabolism, Amino acids and amines].	2.20922e-124
NZ_CP031695.1\|WP_013201449.1\|3266460_3267243_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226961	COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism].	1.82476e-151
NZ_CP031695.1\|WP_151037885.1\|3267991_3268708_-\|ABC-transporter-permease-subunit	gnl\|CDD\|226670	COG4215, ArtQ, ABC-type arginine transport system, permease component [Amino acid transport and metabolism].	2.14885e-83
NZ_CP031695.1\|WP_151037879.1\|3254989_3255505_-\|outer-membrane-protein-OmpX	gnl\|CDD\|181828	PRK09408, ompX, outer membrane protein OmpX.	1.55024e-106
NZ_CP031695.1\|WP_151037886.1\|3270016_3270772_+\|histidine-utilization-repressor	gnl\|CDD\|188194	TIGR02018, Histidine_utilization_repressor, histidine utilization repressor, proteobacterial. This model represents a proteobacterial histidine utilization repressor. It is usually found clustered with the enzymes HutUHIG so that it can regulate its own expression as well. A number of species have several paralogs and may fine-tune the regulation according to levels of degradation intermediates such as urocanate. This family belongs to the larger GntR family of transcriptional regulators. [Energy metabolism, Amino acids and amines, Regulatory functions, DNA interactions].	4.85205e-116
NZ_CP031695.1\|WP_013201456.1\|3258303_3259050_+\|glutamine-ABC-transporter-substrate-binding-protein-GlnH	gnl\|CDD\|236540	PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed.	2.11137e-171
NZ_CP031695.1\|WP_013201452.1\|3262915_3263848_-\|23S-rRNA-(adenine(1618)-N(6))-methyltransferase-RlmF	gnl\|CDD\|236964	PRK11727, PRK11727, 23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF.	0
NZ_CP031695.1\|WP_013201455.1\|3259139_3259799_+\|glutamine-ABC-transporter-permease-GlnP	gnl\|CDD\|181907	PRK09494, glnP, glutamine ABC transporter permease protein; Reviewed.	8.64693e-141

>NZ_CP031695.1|WP_151037883.1|3263974_3264604_+|flavin-reductase-family-protein
MSQSRYSYQPRLGHGLPHDPLNAIIGPRPIGWISSQSASGDRNLAPYSFFNCFNYKPPIIGFSSQGWKDSVANIVETGEFVWNLATRELAEAMNESSASVARDEDEFALAGLTALPGTQVAVSMVAESPVNFECKLTQVLQLEGVNGEKLEQWMVFGEVVAIHIDPELLEDGIYQTAKANPILRAGGPSAYYGISEELRFDLIRPDARR
>NZ_CP031695.1|WP_013201452.1|3262915_3263848_-|23S-rRNA-(adenine(1618)-N(6))-methyltransferase-RlmF
MKYTAEKTQLHPRNRHRARYDFPALIASFPPLADFVAVNQHGDESVNFADPAAVRTLNQALLQHFYQIANWTIPEGFLCPPVPGRADYVHHLADLLAEDNKRSVPRDITVLDIGCGANCIYPLIGFREYGWRFTGSEVNEEAMKAANAIIAANPDLNRGVRLRRQKDSSLMFSGIIHKNEFFHAVMCNPPFHASAGDAQQGTQRKVRNLGLAKNSPLNFGGQQDELWCEGGEKGFISRMIAESVNFSRQCVWFTSLVSRKENLPDIWRALEEHEVVAYRTIEMAQGQKQSRIIAWTFMEKPARERQMGRV
>NZ_CP031695.1|WP_151037882.1|3260651_3262919_+|mechanosensitive-channel-protein
MWVPSPPWRYAFRWLFFAVILFTAPAHAVSLPAAAVAASQTQQHSATSQQDQPDPAEQKAAYAALANILQNDRSRQALIDQLRSASETPASAPEPVLTPPAVDDDKTVLESVTDVSRHFGGEFLIKVETLQRNIADAPHKPFNQHTFFTALSHFSMLAVALFAFYWLIGWAMTPVYRRMGQWGRVKNSDRTNWLHLPGMILGAFIIDLLLLGIALFVGQILSDALNAGNRTIAYQQGLFLNAFALIEFFKAILRLMFCPRYPQLRFFHLADDRAAYWNTRLSWLSGLIGYGLLVVVPIVSNQVNVQVAALVNVIVMGLITVWALYLIFHNRRNIQRELVNLADRSLSFFSLFIRAFALVWHWLASAYFIALFLFSMFNPGDSLKFMMSATVRSLAIIGIGALVSGILTRWISKTIILSPDLRRNYPELQQRVNGWISVMLKLARTLTVFAVSLLLLNAWNLFDLWHWLTVGAGVKLVDVIIRIVMILFFSAVGWTLLASLIESRLASDSHGRPMPSARTRTLLTLFRNALAVVISTITIMILLSEIGVNIAPLLAGAGALGLAVSFGSQTLVKDIITGIFIQFENGMNTGDLVTIGAITGTVERMSIRSVGVRQDTGAYHIIPWSSITTFANFVRGIGSFVANYDVDRREDSERVNSTLQAAVEELMQDTDIRGMVIGEPSFAGLVGLTNQGFTVRVSFTTQPLKQWTVRFALDNMVKKHFDAAGIRAPHQTVQVMQTGSEIDGAASIQSLPAPD
>NZ_CP031695.1|WP_013201454.1|3259795_3260518_+|glutamine-ABC-transporter-ATP-binding-protein-GlnQ
MIEFKNVSKHFGETQVLHNIDLTIQQGEVVVIIGPSGSGKSTLLRCINKLEEITSGELIVDGLKVNDPKVDERLIRQEAGMVFQQFHLFPQMNALDNVAFGPIRVRGTKKAEAHRLAKELLGKVGLAERAHHFPSELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEEGMTMVIVTHEVGFAKKVASRLIFIDKGRIAEDGNPDELIDNPPSARLREFLQHVS
>NZ_CP031695.1|WP_013201455.1|3259139_3259799_+|glutamine-ABC-transporter-permease-GlnP
MQFDWSAIWPSIPALLEGARLTLWISVLGLVGGLIIGLVAGFARAYGGWISRNIALVFIELIRGTPIVVQVMFIYFALPMAFTDLRIDPLSAAVVTIMINSGAYIAEITRGAVLSIHNGFREAGLALGLSRRETLRYVIMPLALRRMLPPLGNQWIVSIKDTSLFIVIGVAELTRQGQEIIAGNFRALEIWSAVAVIYLFITLMLSFILRRIEKRMKIL
>NZ_CP031695.1|WP_013201456.1|3258303_3259050_+|glutamine-ABC-transporter-substrate-binding-protein-GlnH
MKSIVKFSLAALTLAFAVSSTAAEKKLVVATDTAFVPFEFKQGNEYVGFDVDLWAAIAKQLNIEYTLKPMDFSGIIPALQTRNIDLALAGITITPEREKAIEFSDGYYKSGLLVMVKANNDKIKSIADLDGKVVAVKSGTGSVDYAKEHIKSKELHQFPNIDNAYMELGTNRADAVLHDTPNILYFINTAGKGQFKAVGESISAQQYGIAFPKGSDELREKVNGALKVLRENGTYNTLYKKWFGSEPK
>NZ_CP031695.1|WP_151037881.1|3257742_3258006_+|DksA/TraR-family-C4-type-zinc-finger-protein
MASGWARDDAVQEQIDSTIDDAVSRARRAIHHGVSAEYCEHCGEPIPVARRLALPGVQYCVQCQQQRDNQQAASLYNRRGSKDSQLR
>NZ_CP031695.1|WP_013201458.1|3257150_3257654_+|DNA-starvation/stationary-phase-protection-protein-Dps
MSTAKLVKAKSPDLIYTRNNVADDEKKATIEVLNRIVTEFIDLSLITKQAHWNMRGANFIGVHEMLDGFRTAITDHQDTIAERVVQLGGVALGTTQIVNDRTPLKSYPLNIHSVQDHLKALAERYAVVANDTRKAISEVEDEDTADIFTAASRDLDKFLWFIESNIE
>NZ_CP031695.1|WP_151037880.1|3255870_3256764_+|threonine/homoserine-exporter-RhtA
MSSADKSPLWLPVVVLLIAMTSIQGGAALAKTLFPVVGAPGITALRLGLGTVILCIIFKPWRLRFSRQQFIPLFLYGLALGGMNYTFYLALRTVPLGIAVALEFTGPLALALAGSRRPLDFVWVLLALLGLYFLLPIGQDISSVDPKGALLAVVAGAFWAMYILAGKRAGSEHGPATVAMGSLIASVIYVPVGLAFASAGLWSLSLIPVALLIAVLSSALPYSLEMMALTRLPAKTFGTLMSLEPAMAALSGMLFLGEILNFVQWLGLLAIILASAGSTLTMRSSKQKIDPVSEIRE
>NZ_CP031695.1|WP_151037879.1|3254989_3255505_-|outer-membrane-protein-OmpX
MKKIACLSALACVLAVSAGSAMAQSTVSGGYAQSDYQGVANKANGFNLKYRYENGSDPLGWIGSFTYTEKDNTDAGIYNKGQYYGITGGPAYRLNDWASIYGVVGIGYGKYQQNSTTSRDKSDSSDVGFSYGAGMQFNPGIQDVALDVGYEQSRIRNVDVGTWIAGVGYSF
>NZ_CP031695.1|WP_151037884.1|3264955_3266458_-|histidine-ammonia-lyase
MSATEQVTWGDTRLNWQDVVQVAKSSASLQLSAAAWQRIYAARDIVSRIVSDKQIAYGINTGLGALCNITLEDDQLSQLSRNTLLSHACGVGPKLPDVQVRAIICAAIGNYSHGKSGVSPEIVQGLLSLLNRGITPQVPTQGSVGYLTHMAHVGLALIGVGHVSYRGQIVPATEALAAEDLPLCRLGAKDGLSLVNGTPCMTGLSCLALEEASRLFAWADVTGAMSFEALRGQLDAFDAEILALKGSANVQIVGERLRGLLAGSQIIAESKGIRTQDALSLRSMPQIHGASRDQFDYAARQIETELNAATDNPLVLGTAEQWRVVSQANPHGQSVALAADALAIAVAEAGSVAERRLDRLINPLVSGLPAFLVAEPGVNSGMMIAQYVAASLCGENRQLAQPAVLDNYVTSGLQEDHLSMGTSAALKLLKLTDNTVQILAIEYLLAAQALDFHNAEHAGEGTQRAWRLLRQTVATWREDRWLAPEIEKAAQLIRTQHIAV
>NZ_CP031695.1|WP_013201449.1|3266460_3267243_-|ATP-binding-cassette-domain-containing-protein
MTDYAPITLSMNDIRKSFGSLEVLKGISLEARKGDVISILGASGSGKSTFLRCINLLETPDSGVVSVAGETIEMKRHARGHQLAANHRQVESLRSRLGMVFQSFNLWSHMTVLQNVIEGPLYVLKRSKKECIAQAEKILDRVGLLNRKDFYPSQLSGGQQQRVAIARALAMEPEVMLFDEPTSALDPELVGDVLKVMRSLAEEGRTMLVVTHEMGFARNVSNRVVFMHQGTIDCQGTPEEMFGEQGSPRFQQFISSHRAG
>NZ_CP031695.1|WP_105759405.1|3267235_3267979_-|ABC-transporter-permease
MIDFAFLTDTFLKLAAALPVTLGLFFASFVLGGVLALVILAMRMSRNPLLSGFARLYILVFRGSPLMIQLFLIYYGLGQFEVIRHSFVWPVLREPFFCAVVALALCTASYTAEIFRGGLLAIPSGQIEAGMACGMSRWLLLRRIIAPIMLRYALPAYSTEAILLVKSTALASLVTVWDVTGVAQQIIQRTYRTMEVFVCAALIYLILNFIIVQIYAWIERRLSPRLRPVEADVPLPVPPVIAGEKHD
>NZ_CP031695.1|WP_151037885.1|3267991_3268708_-|ABC-transporter-permease-subunit
MANLGFGENGWGGLILSATLTTLLLSLVAMMVGAVVGSGVAAAKLSPRRPVRWLGDGYSVIFRGIPELLIIYLFYFGGSGLITQIGQMFGADGFIEVPPFLIGALAIGLISASYQAEVFRAGRLALNSGEIEAAQAIGMPKWRILQRIILPQVVRYALPGLSNVWQMSLKDSALISVTGIVELMRASQVAAGSTRQYFTFYLIGGTCYLLLTVLSNTAFKKAEQRLGRAHQSRSAAHS
>NZ_CP031695.1|WP_013201446.1|3268724_3269582_-|transporter-substrate-binding-domain-containing-protein
MKHPLVRRVLVTSLVTSALLCAVSVQAKEWKSITIATEGSYEPWNMTLPGGKLSGFEPELMADLCQRMKISCKLVVQNWDGMIAGMQAGKYDVIMDAIVITPDRRKVIDFTVPYASTPASFITTKSGGVLPAGTGAAGIIKLHDDAKEIEPAIASLKAALKGKTIGIASGTVYTPFIDKYFKDVATVREYNASADAILDLQAERIDAVFDDVTFATSILSKPENKDLQLGGTQLGGPIWGEGEALGIRKSDNDLKAKLDEAIKAALADGTVKKLSQKWFKTDVTP
>NZ_CP031695.1|WP_151037886.1|3270016_3270772_+|histidine-utilization-repressor
MSDHKALSEMITLLSNEPTPLYQQVKQGIINLIRAGHWQPHQRVPSESEMVVELGVSRMTINRALRELTSEGFLMRLQGVGTFVAELKAFTPMLEVHNIADEIASRGHRHASEVLFLREEKAEFVAAQALGISVGSALFHSRIIHFDNEIPVQLEDRQVNPRVAPDYLQQDFTQGTPFAYLTGIAPLTAGEHVVEAVSATEEERQLLQIAAGEPCLQIQRRTWHQQAVVTCARLLYPGARYKMFGRFQPQN
>NZ_CP031695.1|WP_151037887.1|3270811_3271591_-|N-formylglutamate-deformylase
MKPFEFTQGSLPLLVSIPHAGTALTAEVEQGLSEAARGLPDTDWHIPQLYDFVREMGASVLVANYSRFVIDMNRPPDNEALYTTATTGLYPETLFDGTPTFKPGMTPTDAQRQGYLATLWTPYHQQIQKELARIKQKFGYALLFDAHSIASVIPRLFDGQLPDVNLGTNGGLSCSPAIAEGLSEICAAQSSFSWVMNGRFKGGYITRAYGKPEENQHAVQLELAQCNYMDEAPPFNWRGDKASTLQPLLKQLIDRMLKR
>NZ_CP031695.1|WP_105759409.1|3271587_3272808_-|imidazolonepropionase
MSGELRCDSLWYGADIVTMQEGKYSIIPNGAIAVRQDRIVWIGPWKDAKHIRADIHNKLDGGIVTPGFVDCHTHLVFGGDRSHEFEQRLNGVSYSEIAAQGGGIISTVTATRKASLEELVASASWRLERLLAEGVTTVEIKSGYGLDQESELRMLKAIRQLAKIHPVQIRSTCLAAHATPPEFKSDPDGWITLICEQLLPQVAREKLADAVDAFCEHLAFSPAQVTRVFEAAQRLGMPVKLHAEQLSSLGGSSLAAKFNALSADHLEYATEADVAAMAASGTVAVLLPGAFYLLREKQVPPVALFRQYKVPMALASDANPGTSPALSLRLMLNMGCTLFGMTPEEALAGATLHGARALGLADTQGSLETGKYADFVHWPLKRPAELVYWLGGQLPCQVIFRGEAIR
>NZ_CP031695.1|WP_151038750.1|3272884_3274240_+|formimidoylglutamate-deiminase
MARYFAPRVLLVDGWHHDVLIEVDDAGFIQKLTPNAAEGDAERLNGAVIPAMANLHSHAFQRVMAGLAEVAGDPQDSFWTWRDLMYRMVQRLSPEQVGAIAAHLYVDMLKGGYTQVAEFHYLHHHTDGTPYPHDQMLQQLIAAAGRVGIGQTMLPVLYSYAGFGAQPPQPGQKRFIQDSAGYLRQQQQLAELLADKPLHNQGICFHSLRAVSEPQMREVLAALPDSLPVHIHVAEQEKEVADSLAWSGERPVSWLLNRFAVDARWCLIHATHLDESEVSRLAASKAVAGLCPTTEANLGDGIFPATDYIALGGRWGIGSDSHVSLDVVEELRLLEYGQRLRDRRRNRIVTPEQTSVGDLLYRQSLEGGAQACGVKMGQLAQGYRADWLVLADDALLGSTADASLLNRWLFAGHRGQIQDVFVAGKQAIADGKHADQPQIDAAFRAVVEALK
>NZ_CP031695.1|WP_151037888.1|3274236_3274785_+|HutD-family-protein
MMHFFDMQTLPVSRWRNGGGETREIISFPPSAGAFSWRISIATIAQDGDFSLFPGIDRVITLLDGDGVELNARGKYQQLLLRNQPFVFAGEDEISSRLIGGVSSDFNVMTRRETHQAAVRVVNESISPTAETAGVAYVLAGEWVFGDRRLQQGQGVWWPQNGEPLAPGSADAGLLFTEIRQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031695_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031695_3

3385746-3385866

Orphan

Consensus_repeat	Method
AATCGCAGAAAGCAAAAAGGCGCCTTTAGGGCGCCTTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031695_3

>merge|NZ_CP031695|3|3385746-3385866|CRISPRCasFinder
AATCGCAGAAAGCAAAAAGGCGCCTTTAGGGCGCCTTCTTAACATTGGTGAGTCATGCAGGATGCAGGTTCAAATCCTTCACGAATCGCAGATAGCAAAAAGGCGCCTTTAGGGCGCCTTC

>NZ_CP031695|3|3|3385746-3385866|CRISPRCasFinder
AATCGCAGAAAGCAAAAAGGCGCCTTTAGGGCGCCTTC	TTAACATTGGTGAGTCATGCAGGATGCAGGTTCAAATCCTTCACG
AATCGCAGATAGCAAAAAGGCGCCTTTAGGGCGCCTTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031695.1\|WP_151037947.1\|3376611_3377202_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107
NZ_CP031695.1\|WP_013201341.1\|3381227_3381947_-\|nicotinamide-riboside-transporter-PnuC	unknown	unknown	gnl\|CDD\|185295
NZ_CP031695.1\|WP_013201336.1\|3387448_3387967_-\|peptidoglycan-associated-lipoprotein-Pal	unknown	unknown	gnl\|CDD\|182744
NZ_CP031695.1\|WP_013201331.1\|3391855_3392260_-\|tol-pal-system-associated-acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|182742
NZ_CP031695.1\|WP_013201347.1\|3373900_3374653_+\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase	unknown	unknown	gnl\|CDD\|184516
NZ_CP031695.1\|WP_065762065.1\|3392766_3392877_-\|cytochrome-bd-I-oxidase-subunit-CydX	unknown	unknown	gnl\|CDD\|227227
NZ_CP031695.1\|WP_151037951.1\|3383180_3383690_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|234860
NZ_CP031695.1\|WP_151037948.1\|3377198_3380321_+\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|274362
NZ_CP031695.1\|WP_013201333.1\|3390726_3391158_-\|colicin-uptake-protein-TolR	unknown	unknown	gnl\|CDD\|236824
NZ_CP031695.1\|WP_013201330.1\|3392473_3392767_-\|cyd-operon-protein-YbgE	unknown	unknown	gnl\|CDD\|236721
NZ_CP031695.1\|WP_041691947.1\|3391172_3391859_-\|Tol-Pal-system-protein-TolQ	unknown	unknown	gnl\|CDD\|182743
NZ_CP031695.1\|WP_151038753.1\|3383868_3385329_+\|DNA-3-methyladenine-glycosylase-2-family-protein	unknown	unknown	gnl\|CDD\|223200
NZ_CP031695.1\|WP_151037946.1\|3376139_3376487_+\|homeobox-protein-YbgS	unknown	unknown	gnl\|CDD\|372863
NZ_CP031695.1\|WP_151037953.1\|3388011_3389304_-\|Tol-Pal-system-protein-TolB	unknown	unknown	gnl\|CDD\|235143
NZ_CP031695.1\|WP_151037955.1\|3392892_3394032_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|184965
NZ_CP031695.1\|WP_151037950.1\|3381981_3383025_-\|quinolinate-synthase-NadA	unknown	unknown	gnl\|CDD\|236489
NZ_CP031695.1\|WP_151037949.1\|3380301_3381231_+\|CDF-family-zinc-transporter-ZitB	unknown	unknown	gnl\|CDD\|235130
NZ_CP031695.1\|WP_151037952.1\|3386620_3387439_-\|cell-division-protein-CpoB	unknown	unknown	gnl\|CDD\|182745
NZ_CP031695.1\|WP_151037945.1\|3374791_3375847_-\|3-deoxy-7-phosphoheptulonate-synthase-AroG	unknown	unknown	gnl\|CDD\|236435
NZ_CP031695.1\|WP_151037954.1\|3389425_3390697_-\|cell-envelope-integrity-protein-TolA	unknown	unknown	gnl\|CDD\|236545

Protein	Function_ID	Function_description	E-value
NZ_CP031695.1\|WP_151037947.1\|3376611_3377202_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	1.91707e-51
NZ_CP031695.1\|WP_013201341.1\|3381227_3381947_-\|nicotinamide-riboside-transporter-PnuC	gnl\|CDD\|185295	PRK15397, PRK15397, nicotinamide riboside transporter PnuC; Provisional.	1.54895e-165
NZ_CP031695.1\|WP_013201336.1\|3387448_3387967_-\|peptidoglycan-associated-lipoprotein-Pal	gnl\|CDD\|182744	PRK10802, PRK10802, peptidoglycan-associated lipoprotein Pal.	1.97835e-119
NZ_CP031695.1\|WP_013201331.1\|3391855_3392260_-\|tol-pal-system-associated-acyl-CoA-thioesterase	gnl\|CDD\|182742	PRK10800, PRK10800, acyl-CoA thioesterase YbgC; Provisional.	3.66827e-91
NZ_CP031695.1\|WP_013201347.1\|3373900_3374653_+\|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase	gnl\|CDD\|184516	PRK14115, gpmA, 2,3-diphosphoglycerate-dependent phosphoglycerate mutase.	0
NZ_CP031695.1\|WP_065762065.1\|3392766_3392877_-\|cytochrome-bd-I-oxidase-subunit-CydX	gnl\|CDD\|227227	COG4890, COG4890, Predicted outer membrane lipoprotein [Function unknown].	8.67166e-11
NZ_CP031695.1\|WP_151037951.1\|3383180_3383690_-\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|234860	PRK00901, PRK00901, methylated-DNA--protein-cysteine methyltransferase; Provisional.	2.27192e-63
NZ_CP031695.1\|WP_151037948.1\|3377198_3380321_+\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|274362	TIGR02956, sensor_protein_TorS, TMAO reductase sytem sensor TorS. This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems].	4.90334e-58
NZ_CP031695.1\|WP_013201333.1\|3390726_3391158_-\|colicin-uptake-protein-TolR	gnl\|CDD\|236824	PRK11024, PRK11024, colicin uptake protein TolR; Provisional.	3.00722e-97
NZ_CP031695.1\|WP_013201330.1\|3392473_3392767_-\|cyd-operon-protein-YbgE	gnl\|CDD\|236721	PRK10588, PRK10588, hypothetical protein; Provisional.	5.48379e-49
NZ_CP031695.1\|WP_041691947.1\|3391172_3391859_-\|Tol-Pal-system-protein-TolQ	gnl\|CDD\|182743	PRK10801, PRK10801, Tol-Pal system protein TolQ.	4.06517e-166
NZ_CP031695.1\|WP_151038753.1\|3383868_3385329_+\|DNA-3-methyladenine-glycosylase-2-family-protein	gnl\|CDD\|223200	COG0122, AlkA, 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair].	2.23626e-62
NZ_CP031695.1\|WP_151037946.1\|3376139_3376487_+\|homeobox-protein-YbgS	gnl\|CDD\|372863	pfam13985, YbgS, YbgS-like protein. This family of proteins is functionally uncharacterized. The family includes the YbgS protein from E. coli. This family of proteins is found in bacteria. Proteins in this family are approximately 130 amino acids in length. Some members of this family are annotated as homeobox protein, but this annotation cannot be verified.	2.97818e-40
NZ_CP031695.1\|WP_151037953.1\|3388011_3389304_-\|Tol-Pal-system-protein-TolB	gnl\|CDD\|235143	PRK03629, tolB, Tol-Pal system protein TolB.	0
NZ_CP031695.1\|WP_151037955.1\|3392892_3394032_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|184965	PRK15003, PRK15003, cytochrome d ubiquinol oxidase subunit II.	0
NZ_CP031695.1\|WP_151037950.1\|3381981_3383025_-\|quinolinate-synthase-NadA	gnl\|CDD\|236489	PRK09375, PRK09375, quinolinate synthase NadA.	0
NZ_CP031695.1\|WP_151037949.1\|3380301_3381231_+\|CDF-family-zinc-transporter-ZitB	gnl\|CDD\|235130	PRK03557, PRK03557, CDF family zinc transporter ZitB.	0
NZ_CP031695.1\|WP_151037952.1\|3386620_3387439_-\|cell-division-protein-CpoB	gnl\|CDD\|182745	PRK10803, PRK10803, tol-pal system protein YbgF; Provisional.	2.07842e-147
NZ_CP031695.1\|WP_151037945.1\|3374791_3375847_-\|3-deoxy-7-phosphoheptulonate-synthase-AroG	gnl\|CDD\|236435	PRK09261, PRK09261, phospho-2-dehydro-3-deoxyheptonate aldolase; Validated.	0
NZ_CP031695.1\|WP_151037954.1\|3389425_3390697_-\|cell-envelope-integrity-protein-TolA	gnl\|CDD\|236545	PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional.	8.23133e-50

>NZ_CP031695.1|WP_151038753.1|3383868_3385329_+|DNA-3-methyladenine-glycosylase-2-family-protein
MIDKQVAYRALTSRDVRFDGVFYVGVTSTGIYCRPVCPVKPPHEVNCLFFDSAEAAEKAAFRPCLRCRPELAPGNAPVDSSHRIADLLIQRIEEGLVEDIDSLEEIAAQFSLSSRQLRRIVQKELGVSPLELRQTRRLLLAKQLLTETTLPVTEVAYASGFASLRRFNEVFSRQYRMPPSRLRKEASETGHFISSETSTLLLSYRPPFNWAALLAFLRLRAIKGVESVDNKSYARTVRLGQHTGWVRVTQSDKKHGLQVEFTHSLTPVLPALLRRLKNLFDLDAHPDLIAAHLEQDPRLRDSLTKDAGLRVPGAFDGFEMVVRAILGQQITVKAATTIGGRFAEAFGEAIMTPFPELTRLSPLAARIAVSTLDEVASLGIVSARSRTLIAIAQAYDRGELKLDAGTDPDRAIASLMEQPGIGEWTAHYIAMRALRWPDAFPAGDVVVRKNLGSVTAKEAERLSQAWRPWRSYAVMHIWKNLAPGKA
>NZ_CP031695.1|WP_151037951.1|3383180_3383690_-|methylated-DNA--[protein]-cysteine-S-methyltransferase
MSYFCKVMPSPVGALTLIASDLGLTAILWQDDKPNRVRLPDMQENPTHPVLVETERQLNEYFAGTRTTFTMTLDFVGTEFQKKVWQALVAIPFGETRSYADIAREIGNPKAVRAVGAANGKNPISIIAPCHRVIGSNGKLTGFAGGLEVKAFLLKIETAKQGEAEFILK
>NZ_CP031695.1|WP_151037950.1|3381981_3383025_-|quinolinate-synthase-NadA
MSLMFDPETAVYPFPPKPARLTQDEKQIYREKIKRLLKERNAVMVAHYYTDPEIQALAEETGGCVADSLEMARFGSQHSASTLLVAGVRFMGETAKILSPEKTILMPTLQAECSLDLGCPIDEFNRFCDQHPDRTVVVYANTSAAVKARADWVVTSSIAVELIEHLDSLGEKIIWAPDRHLGQYVTRQTGADILCWQGACIVHDEFKTQALQRMKTLYPDAAVLVHPESPQAIVDLADAVGSTSQLIQAAKTLPNPQMIVATDRGIFYKMQQACPDKELLEAPTAGEGATCRTCAHCPWMAMNGLKAIADGLEHGGSQHEIHVDAALREGALISLNRMLTFAASLKG
>NZ_CP031695.1|WP_013201341.1|3381227_3381947_-|nicotinamide-riboside-transporter-PnuC
MDFFSTHNILVHIPLGTGGYDLSWIEAIGTVAGLLCIWLASLEKISNYAFGLINVTLFAVIFFQIQLYASLLLQLFFFVANIYGWYAWSRQTTDNQQALQIRWMTLPKAIGWLLVCVVAIGLMTLYINPVFAWLTKIAVTVMQGVGLSVAMPELQPDAFPFWDSCLMVLSIVAMILMTRKYVENWLLWVIINVISVMIFARQGVYAMSLEYAILTLIALNGCWLWIKSAREQGSRALSS
>NZ_CP031695.1|WP_151037949.1|3380301_3381231_+|CDF-family-zinc-transporter-ZitB
MAHTHSEGTGNRTRLLAAFLVTAVFMVAEVAGGILSGSLALLADAGHMLTDAAALLMALLAVQFAQRKPNARHTFGLLRLTTLAAFVNAIALVVITVLIVWEAIVRFRHPEPVAGGFMLTVAVAGLLANLLSFWLLHRGSEEKNLNVRAAALHVLGDLLGSVGAIAAALIIIYTGWTPIDPILSILVSVLVLRSAWALMKESIHELLEGAPPSLDVDKLKRALTQGIPEIRNVHHIHLWQVGEKPVMTLHVHVIPPYDHDALLHRIHDWLHDHYQIEHATVQMEYQSCDDGDCELSWGKGGHEHAHHHH
>NZ_CP031695.1|WP_151037948.1|3377198_3380321_+|transporter-substrate-binding-domain-containing-protein
MTRRLLLAFMLLLCLPVAAALRPISSVLMPQEMMPLDQSSKWQDKPLRVGILRDNSTPWNMVVGQDLYGINADYLVALTQTTGLKFQVEDYPDWQALQQALLEGKLDIAFGVPQQTLEKGMSATQPWFTSPLRIYRSRENLRPVMFNSTDAQITISKSALALIDPAFARQHHWQVVDNDLQALYALLNNKSDYVVADETSAGFLLNQLQQGQIYQLASPLDPGELRLQAITTQPALTERLDMAIRQLPMEVINGIQGRWSSQLPRYQDTNTAHLTPMERSWITQHPVVTYAAIGDDYPWSYRAANGQPSGYSVELLNIIGQNTGLRFQPWWVSNAQQAQALVDQGRVMIQLTLPLTGDDAMRSNTLPIWRALWGVYVGQMSRPATGWQQLQGLKVGIRRGDIARGLIPAGITVVPFEDSKTLYDALANGQINALVDNVISARWLIQSRYSDALRLAFAASDTAWPITLGVSPAFPLLRTLLNTSLQQIPADTQQRMRETWSNNSSVLSEGAENSMRPISLFVLIAALFAIVFLLVLLIRRYLEQRRERLQRRQLELEREEAERANQMKSQFLATVSHELRTPMQAILGLLEVEVSRTPASKNLNVIHSSASTLLTLLNDLQDHAKLESNSFTLVPQPLDPAKWLSRLADFYHPLMRNNGPLFRVETLPPLPALIMIDGQRLQQIANNLISNAIKFTRQGEIRVTLATENDRLRLQVIDSGSGIPAEEQTRLFEPWYQTPSGRQLSVQGSGLGLSICKEIVARMGGEILLASTPHQGTTLTVFLPLQIVTSDPAMNEPAPVRSPGGTPNVQRVAVVDDHPTNLLVMQQQLAWFGIEADCYPDGRAFLAAGGMYDLLFIDYSMPHPDGVTLAKIIRRGERHTARRCRIVMCSADADILASPQVAALTDKVLLKPVTLNEIEPLLTAGTEIVFVDLHQRLWDLAGHDHAFFSKLQKTLQQTVREDSTRLVTALKEQDWEKAEKAAHRLKGSWQMLGYAEGENRCQHIIGQCRAQQQPATELNLLISLTESLLTELESYGAHPF
>NZ_CP031695.1|WP_151037947.1|3376611_3377202_+|response-regulator-transcription-factor
MVTLLLIDDHPLVHVALEAALARAPFPFTLLAAEDENRAHALLAAQPVDIVVLDIGLPDSDGLQLLKFIRRHFPALPVIIYSAQEERLYQRLAEAAGAAGYVAKRQPMPQLLSAILAVLGGQQAFPVSSERETTTHMLTSKEQQILALLARGLSNLQIAEQLNISNKTVSTHKKNIMDKTGASSVVELAGFWKAQQ
>NZ_CP031695.1|WP_151037946.1|3376139_3376487_+|homeobox-protein-YbgS
MMNKFAIVFLTAAMTLGSGAAMAESGNNGTSNQAADAGAAAGGAAQKIAPNGVDNSKINNTGDATSGTTHKTMKHHKKMSAEQVHKNSQCKDGKCPNINKKVGPDANTKTDGTTQ
>NZ_CP031695.1|WP_151037945.1|3374791_3375847_-|3-deoxy-7-phosphoheptulonate-synthase-AroG
MNYQNDDLRIKEIKELLPPVALLEKYPATDMAAKTVSDSRQAIHNILKKTDDRLLVVIGPCSIHDTQAAKEYAARLLTLREELSDSLEVVMRVYFEKPRTTVGWKGLINDPHMDNSYQINDGLRIARKLLLDINDSGLPAAGEFLDMITPQYMADLMSWGAIGARTTESQVHRELSSGLSCPVGFKNGTDGTIKVAIDAINAASAPHCFLSVTKYGHSAIVETSGNGDCHIILRGGKEPNYSAHHVSAVKTGLEKAGLDPQVMIDFSHANSSKQFQKQLVVSDDVSQQIASGDKAIIGVMIESHLVEGNQSLESGEPLVYGKSVTDACIGWEDTEKVLRQLADAVKARRAH
>NZ_CP031695.1|WP_013201347.1|3373900_3374653_+|2,3-diphosphoglycerate-dependent-phosphoglycerate-mutase
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFTFDFAYTSVLKRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETAQKYGDEQVKQWRRGFAVTPPELDRADERFPGHDPRYAALTAEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVIIAAHGNSLRALVKYLDNMSEEAILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKAAAVANQGKAK
>NZ_CP031695.1|WP_151037952.1|3386620_3387439_-|cell-division-protein-CpoB
MISNFRLNVLGLSLLVGVAAPWAANAQASISNVGSGSVEDRVTTLERISNAQAQLLQQLQQQLSDSQRDVDSLRGQIQENQYQMNQMTERQKSMYQQIDTLSNGGGNANAQAQGASGDAAAAAGGAAADNAANGNSAASGASAAPVQSGDANTDYNAAVALVLEKKQNEQAISAFQAFVKKYPDSTYQPNANYWLGQLNYNKGKKDDAAYYFATVVKNYPKSPKSPDALYKVGVIMQEKGDTAKAKAVYQQVSKLYPNSDAAKNAAKRAAAL
>NZ_CP031695.1|WP_013201336.1|3387448_3387967_-|peptidoglycan-associated-lipoprotein-Pal
MQLNKVLKGLMLALPVIAVAACSSHKNNNNDQTNGMGDGANANSGMNSGNMSSDEQARLQMQELQKNNIVYFGLDKYDIQSEFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNIALGERRATAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDESAYAKNRRAVLVY
>NZ_CP031695.1|WP_151037953.1|3388011_3389304_-|Tol-Pal-system-protein-TolB
MKQAFRVAMSFLLLFVAVAHAEVRIEITQGVNTARPIGVVPFKWAGPGAAPEDIGGIVAADLRNSGKFNPLDRSRLPQQPSTAAEVQPAAWTALGIDAVVVGQVQPGADGSYLVSYQLVDTSGNPGAILAQNQYKVTKQWLRYAAHTASDEAFEKLTGIKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQNTVHRSPQPLMSPAWSKDGSKLAYVTFESGKSALVVQTLANGAIKQVASFPRHNGAPAFSPDGTKLAFALSKTGSLNLYVMDLASGQINQLTDGRYNSTEPTWFPDSQSLAYTSDQAGRPQIYKISASGGTAQRLTWEGGQNQDADVSSDGKSLVMISTNGGAQHVARQDLETGAVQQLTDTFLDETPSLAPNGTMVIYSSTQGMGSVLQLVSTDGRFKARLPATDGQVKFPAWSPYL
>NZ_CP031695.1|WP_151037954.1|3389425_3390697_-|cell-envelope-integrity-protein-TolA
MSKATEQNDKLKRAIIFSVILHVLVIAVLIWSSFDEHIDASSGGGGGDIDAVMVDPGAIVDQYNRQQNQQSDSKRADNQRKKQAQQQAEELQQKQAAEQQRLKEMEKERLQAQQDAKQQAAAQAAEQKQAQDAAKQAQEEQKQAEMAAAKAKSDAKAQADAQAKSAAEAQKKAEAEAKQAAADAQKKAEAEAKKVAAEAKKQADAEAKEAAAEAAKVKAAADAKAKATADAKAKAAEEAKEAKAAAAKEAAEAKEKAAEEAKAKAEASAKAKADAAAKAKAAADAKKKAAADAAKDTSDVDDLLGGLSSGKNAPKQGKSGGAAAGQGNQKKAGASGAAIDSYIGQVQAAIQSKFYDSDTFKGRTCDIHIKIMSDGTLVSATAAGGDAALCQAAINAARMARMPKPPSAEVYQAVKDATLEFKP
>NZ_CP031695.1|WP_013201333.1|3390726_3391158_-|colicin-uptake-protein-TolR
MARTRGRGGRREMKSEINIVPLLDVLLVLLLIFMATAPIITQSVEVDLPDATDSKTVSSDDNPPVIVEVAGVGQYSLVVDHDRMEQLPPEQVVAEAQRRIEANPKTVFLIGGAKDVPYDEIIKALNLLHQAGVKSVGLMTQPI
>NZ_CP031695.1|WP_041691947.1|3391172_3391859_-|Tol-Pal-system-protein-TolQ
MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGRDADAFEDKFWSGIELSRLYQESQARRDELGGSEQIFYSGFKEFARLHRANNHAPEAVVEGATRAMRISLNREMEALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFTAILHRQAFSSENTK
>NZ_CP031695.1|WP_013201331.1|3391855_3392260_-|tol-pal-system-associated-acyl-CoA-thioesterase
MSTTLFRWPVRVYYEDTDAGGVVYHASYVAFYERARTEMLRQHHFNQQALLEQQVAFVVRRITVDYLAAARLDDLLEVQCEVVSMTRTTMTFAQRIVNAEGRTLNEAEVLIACINPHLMKPIALPKSIVAEFKQ
>NZ_CP031695.1|WP_013201330.1|3392473_3392767_-|cyd-operon-protein-YbgE
MGQGITRLYQWMDKSPLRALSLLMALLLAGCMFWDPKRFAANSSSLEIWQGLLMMWAVCTGVIHGVGFRPRRLRWQAFFSPLPAWIVLIFGLAFFFS
>NZ_CP031695.1|WP_065762065.1|3392766_3392877_-|cytochrome-bd-I-oxidase-subunit-CydX
MWYFAWILGTLLACAFGIITALAIEHIEDSEVKEKR
>NZ_CP031695.1|WP_151037955.1|3392892_3394032_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MITYELLRFVWWVLIGVLLIGFAVADGFDMGVGMLTRILGRTDTERRIMINSIAPHWDGNQVWLITAGGALFAAWPTVYAAAFSGFYVAMILVLASLFFRPIGFDYRSKLEDNRWRGMWDWAIFIGSFVPPLVIGVAFGNLLQGVPFHMDEYLRLFYTGNFFQLLNPFALLAGIVSLTMILTQGATYLQMRTVGELHVRSRLAAQISALVMVVCFVLAGVWVMHGIDGYAVTSVLDHNAASNPLGKEVVREAGAWMVNFNKTPLLWIIPALGVVLPLLTILCSRLEKGAWAFVFSSLTLACVILTAGVAMFPFIMPSSTMPNMSLTMWDSTSSLLTLKIMTVAAIIFVPIILAYTTWCYYKMFGRLTKEQIENNTHSLY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP031695_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031695_4

4089135-4089246

Orphan

Consensus_repeat	Method
TCCGGGACGCCGTAAATCCATCCCTGGAGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031695_4

>merge|NZ_CP031695|4|4089135-4089246|CRISPRCasFinder
TCCGGGACGCCGTAAATCCATCCCTGGAGGGCTTAAGGTCAAAAGCAGCTTCAGTGGTTCGGCGTCAACATAGAGCGCGTTATCCGGGACGCCGTAAATCCATCCATGGAGG

>NZ_CP031695|4|4|4089135-4089246|CRISPRCasFinder
TCCGGGACGCCGTAAATCCATCCCTGGAGG	GCTTAAGGTCAAAAGCAGCTTCAGTGGTTCGGCGTCAACATAGAGCGCGTTA
TCCGGGACGCCGTAAATCCATCCATGGAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031695.1\|WP_151038319.1\|4083979_4084903_+\|sugar-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380524
NZ_CP031695.1\|WP_151038317.1\|4080993_4082949_-\|GAF-domain-containing-protein	unknown	unknown	gnl\|CDD\|226350
NZ_CP031695.1\|WP_151038324.1\|4089776_4090799_-\|DUF4432-family-protein	unknown	unknown	gnl\|CDD\|185703
NZ_CP031695.1\|WP_151038323.1\|4087464_4088901_-\|3-isopropylmalate-dehydratase-large-subunit	unknown	unknown	gnl\|CDD\|183543
NZ_CP031695.1\|WP_013200652.1\|4099778_4101005_-\|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR	unknown	unknown	gnl\|CDD\|236151
NZ_CP031695.1\|WP_134823422.1\|4094719_4095667_-\|lactate-dehydrogenase	unknown	unknown	gnl\|CDD\|240652
NZ_CP031695.1\|WP_151038315.1\|4076051_4076750_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	unknown	unknown	gnl\|CDD\|274567
NZ_CP031695.1\|WP_151038321.1\|4085925_4086840_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP031695.1\|WP_041691892.1\|4097671_4098568_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP031695.1\|WP_151038320.1\|4084943_4085894_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176168
NZ_CP031695.1\|WP_151038325.1\|4090795_4092121_-\|L-fucose:H+-symporter-permease	unknown	unknown	gnl\|CDD\|340952
NZ_CP031695.1\|WP_151038316.1\|4077071_4081019_+\|amino-acid-adenylation-domain-containing-protein	unknown	unknown	gnl\|CDD\|236668
NZ_CP031695.1\|WP_151038777.1\|4093246_4093909_+\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|234784
NZ_CP031695.1\|WP_013200670.1\|4075258_4076050_+\|urea-ABC-transporter-ATP-binding-protein-UrtD	unknown	unknown	gnl\|CDD\|274568
NZ_CP031695.1\|WP_151038327.1\|4098665_4099667_+\|zinc-binding-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176214
NZ_CP031695.1\|WP_013200657.1\|4093933_4094710_+\|DNA-binding-transcriptional-repressor-DeoR	unknown	unknown	gnl\|CDD\|182644
NZ_CP031695.1\|WP_151038322.1\|4086836_4087478_-\|3-isopropylmalate-dehydratase-small-subunit	unknown	unknown	gnl\|CDD\|179314
NZ_CP031695.1\|WP_151038326.1\|4092134_4093049_-\|ribokinase	unknown	unknown	gnl\|CDD\|274000
NZ_CP031695.1\|WP_151038318.1\|4083148_4083928_+\|TIM-barrel-protein	unknown	unknown	gnl\|CDD\|226149
NZ_CP031695.1\|WP_013200655.1\|4095927_4097595_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992

Protein	Function_ID	Function_description	E-value
NZ_CP031695.1\|WP_151038319.1\|4083979_4084903_+\|sugar-ABC-transporter-substrate-binding-protein	gnl\|CDD\|380524	cd06301, PBP1_rhizopine_binding-like, periplasmic binding proteins specific to rhizopines. Periplasmic binding proteins specific to rhizopines, which are simple sugar-like compounds produced in the nodules induced by the symbiotic root nodule bacteria, such as Rhizobium and Sinorhizobium. Rhizopine-binding-like proteins from other bacteria are also included. Two inositol based rhizopine compounds are known to date: L-3-O-methly-scyllo-inosamine (3-O-MSI) and scyllo-inosamine. Bacterial strains that can metabolize rhizopine have a greater competitive advantage in nodulation and rhizopine synthesis is regulated by NifA/NtrA regulatory transcription activators which are maximally expressed at the onset of nitrogen fixation in bacteroids. The members of this group belong to the pentose/hexose sugar-binding protein family of the type 1 periplasmic binding protein superfamily.	5.58035e-116
NZ_CP031695.1\|WP_151038317.1\|4080993_4082949_-\|GAF-domain-containing-protein	gnl\|CDD\|226350	COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms].	1.73586e-154
NZ_CP031695.1\|WP_151038324.1\|4089776_4090799_-\|DUF4432-family-protein	gnl\|CDD\|185703	cd09269, deoxyribose_mutarotase, deoxyribose mutarotase_like. Salmonella enterica serovar Typhi DeoM (earlier named as DeoX) is a mutarotase with high specificity for deoxyribose. It is encoded by one of four genes beonging to the deoK operon. This operon has also been found in Escherichia coli where it is more common in pathogenic than in commensal strains and is associated with pathogenicity. It has been found on a pathogenicity island from a human blood isolate AL863 and confers the ability to use deoxyribose as a carbon source; deoxyribose is not fermented by non-pathogenic E.coli K-12. Proteins in this family are members of the aldose-1-epimerase superfamily. Aldose 1-epimerases, or mutarotases, are key enzymes of carbohydrate metabolism, catalyzing the interconversion of the alpha- and beta-anomers of hexose sugars such as glucose and galactose. This interconversion is an important step that allows anomer specific metabolic conversion of sugars. Studies of the catalytic mechanism of the best known member of the family, galactose mutarotase, have shown a glutamate and a histidine residue to be critical for catalysis; the glutamate serves as the active site base to initiate the reaction by removing the proton from the C-1 hydroxyl group of the sugar substrate, and the histidine as the active site acid to protonate the C-5 ring oxygen. Site directed mutagenesis of this latter histidine residue renders Salmonella enterica DeoM inactive.	1.30123e-166
NZ_CP031695.1\|WP_151038323.1\|4087464_4088901_-\|3-isopropylmalate-dehydratase-large-subunit	gnl\|CDD\|183543	PRK12466, PRK12466, 3-isopropylmalate dehydratase large subunit.	0
NZ_CP031695.1\|WP_013200652.1\|4099778_4101005_-\|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR	gnl\|CDD\|236151	PRK08099, PRK08099, multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR.	0
NZ_CP031695.1\|WP_134823422.1\|4094719_4095667_-\|lactate-dehydrogenase	gnl\|CDD\|240652	cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric.	1.1822e-120
NZ_CP031695.1\|WP_151038315.1\|4076051_4076750_+\|urea-ABC-transporter-ATP-binding-subunit-UrtE	gnl\|CDD\|274567	TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	3.84279e-141
NZ_CP031695.1\|WP_151038321.1\|4085925_4086840_-\|alpha/beta-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.41774e-28
NZ_CP031695.1\|WP_041691892.1\|4097671_4098568_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.4478e-66
NZ_CP031695.1\|WP_151038320.1\|4084943_4085894_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176168	cd08479, PBP2_CrgA_like_9, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 9. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.41426e-93
NZ_CP031695.1\|WP_151038325.1\|4090795_4092121_-\|L-fucose:H+-symporter-permease	gnl\|CDD\|340952	cd17394, MFS_FucP_like, Fucose permease and similar proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of L-fucose permease (also called L-fucose-proton symporter) and similar proteins such as glucose/galactose transporter and N-acetyl glucosamine transporter NagP. L-fucose permease facilitates the uptake of L-fucose across the boundary membrane with the concomitant transport of protons into the cell; it can also transport L-galactose and D-arabinose. Glucose/galactose transporter functions in the uptake of of glucose and galactose. The FucP-like subfamily belongs to the bacterial fucose permease, eukaryotic Major facilitator superfamily domain-containing protein 4 (FucP/MFSD4) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.24498e-131
NZ_CP031695.1\|WP_151038316.1\|4077071_4081019_+\|amino-acid-adenylation-domain-containing-protein	gnl\|CDD\|236668	PRK10252, entF, enterobactin non-ribosomal peptide synthetase EntF.	0
NZ_CP031695.1\|WP_151038777.1\|4093246_4093909_+\|deoxyribose-phosphate-aldolase	gnl\|CDD\|234784	PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional.	1.78077e-119
NZ_CP031695.1\|WP_013200670.1\|4075258_4076050_+\|urea-ABC-transporter-ATP-binding-protein-UrtD	gnl\|CDD\|274568	TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity. [Transport and binding proteins, Amino acids, peptides and amines].	1.34123e-154
NZ_CP031695.1\|WP_151038327.1\|4098665_4099667_+\|zinc-binding-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176214	cd08252, AL_MDR, Arginate lyase and other MDR family members. This group contains a structure identified as an arginate lyase. Other members are identified quinone reductases, alginate lyases, and other proteins related to the zinc-dependent dehydrogenases/reductases. QOR catalyzes the conversion of a quinone and NAD(P)H to a hydroquinone and NAD(P+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP031695.1\|WP_013200657.1\|4093933_4094710_+\|DNA-binding-transcriptional-repressor-DeoR	gnl\|CDD\|182644	PRK10681, PRK10681, DNA-binding transcriptional repressor DeoR; Provisional.	7.02869e-152
NZ_CP031695.1\|WP_151038322.1\|4086836_4087478_-\|3-isopropylmalate-dehydratase-small-subunit	gnl\|CDD\|179314	PRK01641, leuD, 3-isopropylmalate dehydratase small subunit.	1.08829e-87
NZ_CP031695.1\|WP_151038326.1\|4092134_4093049_-\|ribokinase	gnl\|CDD\|274000	TIGR02152, Putative_ribokinase, ribokinase. This model describes ribokinase, an enzyme catalyzing the first step in ribose catabolism. The rbsK gene encoding ribokinase typically is found with ribose transport genes. Ribokinase belongs to the carbohydrate kinase pfkB family (pfam00294). In the wide gulf between the current trusted (360 bit) and noise (100 bit) cutoffs are a number of sequences, few of which are clustered with predicted ribose transport genes but many of which are currently annotated as if having ribokinase activity. Most likely some have this function and others do not. [Energy metabolism, Sugars].	1.21469e-131
NZ_CP031695.1\|WP_151038318.1\|4083148_4083928_+\|TIM-barrel-protein	gnl\|CDD\|226149	COG3622, Hfi, Hydroxypyruvate isomerase [Carbohydrate transport and metabolism].	1.627e-87
NZ_CP031695.1\|WP_013200655.1\|4095927_4097595_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0

>NZ_CP031695.1|WP_151038323.1|4087464_4088901_-|3-isopropylmalate-dehydratase-large-subunit
MSNKTLYEKLIDSHVVRELDNDGHVLLYIDRSILNEYTSPQAFSGLRESGRGVRHPENILLNVDHVNPTRPTRDAEMTDAGGQLQVDYFRQNAADFGIELFDVMDPRQGIEHVVAHEQGMVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEHLLATQTLVYRRLKTMRVTVTGLLPYACTAKDIILDLLGKISASGATGYAIEFDGDAIDDLSMEGRMTLCNMAVEAGARGAIIAPDQKVFDYITGKPQMPTGALWQQALAEWSQLRSDPMAVFDKTVQIDCSELDPKVTWGISPDQTSPIGGAVPDPEQEPDLIKQQAIRKALQYMGLTAGTPLREIPITHAFIGSCTNGRIEDLRSAAAVLQGRKIASHVRGIIVPGSSQVRRQAEAEGLAQQFLDAGFEWRQSGCSMCLAMNEDVLAPGDRCASGTNRNFPGRQGVGARTHLMSPAMVAAAAISGHLEDVRTMLNAGGNHGSI
>NZ_CP031695.1|WP_151038322.1|4086836_4087478_-|3-isopropylmalate-dehydratase-small-subunit
MEAFDWVSGILAPLLEANIDTDVIMPKQFLKGIDRQGLDKGVFFDRRFTVDGELNPDFILNQPGWQGASFLLVGPNFGCGSSREHAVWGLRQLGIRALIGTSFAGIFNDNCQNNGVLTVSLDDSSFGRLSQLAVNPDSNRITVSLETCEITAGAETLPFSVSALKREMLAGGEDAIGWTLQYLSAIEQFEAQHYGQKPWLKRPAASQSAGRNG
>NZ_CP031695.1|WP_151038321.1|4085925_4086840_-|alpha/beta-hydrolase
MIARAERGDSPFVPGFRLHDITLESGITLRVAIGGDGPPLLMLHGHPQNHISWRKVAPTLAKTHTVILPDLRGYGDSDKPASDEQHRPYSKRVMAQDLVQLMAGLGHPTFAFVGHDRGARVGHRLALDHPQRVTCCTFVDIAPTATMYALTNQAFATRYFWWFLLIQPTPVPETLILHDPEFFLRKHIDGQLKIPGAMSEAVFQDYLRCYQNPQMVHAVCEDYRAAATLDLEDDAADSENRIRCPLQLLWGEKGTVGQLYDVLATWRDKALNVQGEALPCGHSPQEEIAYLFLQKLQPFLKTVL
>NZ_CP031695.1|WP_151038320.1|4084943_4085894_-|LysR-family-transcriptional-regulator
MKTPSAGKNLRQPVEGWPAIDDLSVFVTVARNGGFARAAQELGLSPSTISKRIAMLEKQLDIRLFFRNNRSMRLTAEGEIALEGAMQIVSGVGDFVSDLNGLRGAVTGNITLSCSFGFGHEYMADALSGLMNLHNGLNVKLMLSDREVNLVDEGIDIEIHVGDEIKDLYIARQLAANRRILCASPDYLRRAGVPTSLDDLRQHDCLIIQERSAAFGNWALTNGEDAIVCRVNSQHSSNSGSVVLAWALRGQGIVLRSAWDVAKHLASGELVQILPAWYQQANIWAVYTQRSSHSLRIKTCIDFLSDYFAQRLPTPR
>NZ_CP031695.1|WP_151038319.1|4083979_4084903_+|sugar-ABC-transporter-substrate-binding-protein
MKLSQSLLLVCTLALSPLSQAKEQTVGVALANFDLNFVSILRTQMVKELAKEKINGQFEDAKGDVAVQVQQVENFINQGVDAIILNPVDTQAVKPMMEAASRAKIPLIFVNRKPEIPLSANMAYVGSDSELGGKMEMEALAKKMNYKGNVAILMGALSAEEARQRTKATEEVIAKYKDMKVVEKQSAQWMRNEAVDVTSGWLLNGDKIDAIAANNDEMAIGAIMALQQAGKKDVLVAGIDGTPDALRFVKSGKLSLTIFQDAAGQGIGAVQTAKKMLAGEKVESTIWIPYQTITPENYTEFMTKNSK
>NZ_CP031695.1|WP_151038318.1|4083148_4083928_+|TIM-barrel-protein
MTLFTLSVCAEMVFLELPFIERVKRIHQLGFGVELWNWQNKDIPALAATGARFTSMTGYLSGNFTDDREIASLLASAEVSLGVAEQLGCPSLNLHGTGLDDKGLPVKPVEAVTGAMWLKAASTLEKLATMAERAGKVFTLENLNTAVDHPGTPFAKASEVLALVEAVNSPHLRINLDLYHAQIGEGNLIELVKRAGSAIGEIQVADVPGRQEPGTGEINYRAIANALRAMNYQGVVAMEGWASGDSETALMRFKEQFML
>NZ_CP031695.1|WP_151038317.1|4080993_4082949_-|GAF-domain-containing-protein
MHIPVLAGAIVEECEGKLSLPQGAEASRWDAQFELAWRAFVAGQEPSFLRPQIRASWQASRDAGIDPGAINYVFPAEDELKGILENHAELIEVADSIMQSLLAYNPDGHINLTDANGVTLCYCGLDLTPVGSILRESVMGTNCTGRCLNEQRLVYVLNGENWKQALRQRHRQCAAAPVRNAEGRMIGVLTLTASQDNFHYHTLGTVQAAAEAIGRQLVLRSLLAEQRSILETLNEGVIVTDARGIIKTINRYARQIFHGMMLTGKSVDSALNPEGVTLTGITFCNDREVVFQPQDRPRVSCLVSVMPAPDGGRIVSLRDNQRIRAITRQVMGIGASYTFEMICGRSTALSEVLDKARTSSRSDSTVLLTGESGTGKELFAQAIHNGSARHGGPFIAVNCGALPRDLVQSELFGYVDGAFTGSRRGGAAGKFELADGGTLFLDEIGDMPLEAQTSLLRVLQEAEVMRIGAQRPVKVNVRIIAATNCDLQRAIETGAFRRDLFYRLNVISLRIPALRERTGDVPQLVEWFSEKMCTRLKKASMQFTPAAMAALEQYPWPGNVRELENIVERAINLSDKLLIDAGDLPEEIATEERPKSGDSQRLDSHERAHIVTMLASLNGNLRKTAQKMGVSRAGLYNKLKKHGISVDEFRG
>NZ_CP031695.1|WP_151038316.1|4077071_4081019_+|amino-acid-adenylation-domain-containing-protein
MRLSIYPLTSSQQAVWLDQALTPDTPCYNVGGLWRIDSPLDASLLHRAINLVLQQHDALKIKLTEGEEGINQTTVHKREFILECHDVSRESQPVHTAREILNARLIQPFKLYGELLWRSSLVKVNATTSLWLVNAHHIIADGTSVSLLGRMIIDRYKSLLLGQALAVTDACAGYTDFIGQDRDYLASSRYPRDRAYWLSRFADAPASLLERRNGFAASEAWPSTQILRTLPQARYRQLTAFAGRYGASPMHFFSALMACWFARQWQTEDFTLGVPVHNRSGARHKQTLGMFSAMLPVRLQIDTAQPFSSLIRQVSAELRRSYRHQRFPVAELNRHLRLSQQGRRQLYDMSFSLETFPTDIELNGTPLKVEALHHGFEQMPVAVYLRHYHPGDDPVLECNVNQAWFSEQEAGKIADRLLHLLNAILDSPPEQPMALLPLLLPDEQHAILNLWNDTAADWPLPEGIHRWFEQQVGKTPDAVALSGVAEMTYATLNAEANRLAHWLRAGGIQPDDRIALCVSRSAEMVIALLAILKAGAAYVPLDPDYPQDRLHHMLSDCGAKQVLVDDVGARALQPIASLPLVHLRNDQPRWQAGSTDNLPALADDPQRSLAYVIYTSGSTGKPKGVMNEHLAVMNRLQWMQDAYPLTAQDRVLQKTPFSFDVSVWEFFWPLMVGARLAMAKPGGHQDPGYLSDFIQQQQITTLHFVPSMLQLFLRHGEMAHCRSLRRLFCSGEALPLTAVERCHQQLPAVELHNLYGPTEAAVDVSYWHCKPGEIGSSVPIGRPVANTQLYILDANLQLLPPGISGELHIGGVQVARGYLNREELSQQRFIADPLSAQPDARLYKTGDLARWREDGNIEYLGRNDFQVKIHGLRIELGEIEQQIVACPQVEDCVVLACEDDDGDKRLIAWVVARPDPQLADSLRQQIGQSLPEFMIPASFVRVDALPLSPNGKLDRKALPMPAADAQPAFTPPATAQERLLAACWSDLLGVSPVGRDDDFFALGGHSLHAIQLMMRLRKRGIEVEMKTLFAHPKLRQQAEALSQPATAQSPQWVDTPAPLANLLKQLNRPQQTFDLIQPLNAATQGDDLWMIHPAVVGCEIYQDLADSLSGKFNVLGINNYNLHNRPHIPTLAALASYYLQHMLQWGLPTDRPVRLLGWSLGGVIALEIAAQLEQRGYTQLQVCLLDSLYQTEVQQRVAPGMLASLLKAIGLEGDAAKRAIQAEETELSINNQAVSSPLHHTQVTLLKAMQFFDLSDSGTAEGNELLAIKDNGVGALCSSLKIVPLAANHHSIILCHQEIAAALSAVGVSRETHPH
>NZ_CP031695.1|WP_151038315.1|4076051_4076750_+|urea-ABC-transporter-ATP-binding-subunit-UrtE
MLKVSELNQYYGGSHILRGLSFEVKTGEITCLLGRNGVGKTTLLKCLMGIIPAKSGTISWQDKILNGRKPHQRVQAGIAYVPQGREIFPRLTVEENLLMGLARFSGAEAKQVPEEIYRLFPVLKEMKQRRGGDLSGGQQQQLAIGRALACRPQLLILDEPTEGIQPSVIKEIGAVIRQLAQRGDMAILLVEQFYDFAAELADSYLVMSRGEIVQRGQGDSMEADGVRSLVAI
>NZ_CP031695.1|WP_013200670.1|4075258_4076050_+|urea-ABC-transporter-ATP-binding-protein-UrtD
MTDQLFTQPHPADRHRDQTDPVLLLENINVSFDGFKALTNLSLQIGVGELRCIIGPNGAGKTTLMDVITGKTRPDNGRVMYDQSTDLTTLSPVDIARIGIGRKFQKPTVFEALTVFENLEIALKTDKSVWACLRSRLSGEQQDRIDEVLKLLRLGAERYRLAGLLSHGQKQFLEIGMLLVQDPHLLLLDEPAAGMTDAETEYTAELFRSLAGQHSLMVVEHDMGFVETIADHVTVLHQGQVLAEGSLRDVQANEQVIEVYLGR
>NZ_CP031695.1|WP_151038324.1|4089776_4090799_-|DUF4432-family-protein
MRTTLPLHPSLFGETPRTLLDNADVKVDLFRYPSGIEAVRMENRRGYVIVLPYYGQMVWDAAFDGQRMTMGNGFKQPLPGKDIIDTYGCFAFHSGLLANGCPGEGDTHALHGEMACARMDSAWIVLEEEGVSVRGEVEYIKGFGHHYRALPGVTLLADRPRLRIEMAVTNLSGTAMPLQYMCHMNSAYVDNGSFSQSIPDSAFKLRTSIPGHVHPTPVWLDYTRQLAAEPQAFGGLTRPEMYDPEIVFFADNLAQYGETVTFNLHSPDGHGFSTTFQTAQFNYATRWILHNSDQQVAAYVLPATCRPEGFNAAKQAGTLIMLEPREQRHFSVETGLIEKP
>NZ_CP031695.1|WP_151038325.1|4090795_4092121_-|L-fucose:H+-symporter-permease
MHPTIVQQPDGYLNKTPLFQFILLSCLFPLWGCAASLNDILITQFKSVFALSDFASALVQSAFYGGYFLIAIPASLVIRSSSYKIAILLGLALYIAGCVMFYPASHMATYTMFLAAIFAIAIGLSFLETAANTYSSMIGHRDHATLRLNVSQTFYPIGALMGIVLGKYLVFQDGDSLHSQMAGMNPEQLHQFRLTMLEHTLEPYKYLVMVLVVVMVLFLLTRYPHCKPQSNEKKLPSLGETFSYLAKNRHFKRGIIAQFLYVGMQVAVWSFTIRLALNLGAANERHASNFMIYSFICFFIGKFVANFLMTRFRAEKVLIAYSIVGVATLAYVMLVPNFTAVYAAVFVSVLFGPCWATIYAGTLSTVESKYTEVAGAFIVMAIVGAAFIPALQGLVSDRLGSMQMAFGVSLLCFAWVGFYFWGELRHKKQPAVTGRLAEEAR
>NZ_CP031695.1|WP_151038326.1|4092134_4093049_-|ribokinase
MDIAVIGSNMVDLITYTNSMPKAGETLEAPDFALGCGGKGANQAVAAAKLGASVMMVSKVGEDLFADNTVKNLQRFGVDAQHVTVAAGTSSGVAPIFVDDQSQNRILIIKGANARLSPADIDAAAEDLKRCRLMVLQLEIPLPTVYYAIDFARQNGIQVILNPAPAVAGLDIDYACQCDFFMPNETELEILTGLPVSTEDEVLRAGQMLLGRGLKNLIITLGSRGSVWMQGDAVHRIKPTPVKAIDTSGAGDAFIGCFAHFLIQHGDIAKAMQSASDYAACSVTGRGTQLSYPDADTFHRFLND
>NZ_CP031695.1|WP_151038777.1|4093246_4093909_+|deoxyribose-phosphate-aldolase
MDYARYIDHTLLAANATVQQIATLCDEAIAHHFYAVCVNSGYVPLVAEKLAGSEVKVCSVIGFPLGAGLTSAKAFEAKAAIAAGAQEIDMVINVGWLQSGEVKAVSADIQAVREVCGPIPLKVILETCLLSDAQIIQICEICRELKVAFVKTSTGFSTGGAREEHVRLMHDTVGPEVAVKASGAVRDRQTADIMIQAGASRIGTSSGVAIVKGSAAGEGY
>NZ_CP031695.1|WP_013200657.1|4093933_4094710_+|DNA-binding-transcriptional-repressor-DeoR
METRRDERVNKLASALKRTDKIHLREAARLLGVSEMTIRRDLNEQPSVVVLLGGYIVSDPKSNQGHYFVSDQQAHNVEKKRRLGQLAASLIEPGDTVFFDCGTTMPWIVDAIDNELAFTAICCAMNTFLALKEKPACQVILNGGEFHADNAIFTPLGHGSVMDSLCPGKAFISAAGIDAGQGATCYNLNELPMKHQAMQRASHKILVADSSKFGKVLPARIGELSAFETLVSDDAPPKELAQKLKQLGIDVMVGQKAR
>NZ_CP031695.1|WP_134823422.1|4094719_4095667_-|lactate-dehydrogenase
MRVLIAAEENAWGGMIQQFRHTLPDVEFTASAGHAAESLAGYDALIPGMAKVTPELLKTADRLKLIQQAGAGLEGVDLASAKALGIQVANVPSDRSGNADSVAELGIWMMIGLARKAREIPEMIATRQLGLPVGMGLMGKTVGLVGLGGIGKALAKRLAPFGVRLIGVKRTADQAFAKAHQLDWLGNMAHLPALLNDADFVILSLPDNADTRHIIDETALAQMKPGSFLINLGRGGLIEKQALLAALEVNHLAGAGLDVFWQEPPEPDDALFQYNVIATPHIGGVTDNSLNGNVAGVCENLRRLRDGEEILNRWA
>NZ_CP031695.1|WP_013200655.1|4095927_4097595_+|energy-dependent-translational-throttle-protein-EttA
MAQFVYSMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGSGKSTLLRIMAGIDKDIEGEARPQPGLKIGYLPQEPQLNMEHTVRESVEEALAEVVGALKRLDEVYALYAEEDADFDKLAAEQGKLEEIIQAHDGHNLNTQLERAADALRLPEWDAKVATLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDFEGTVVAITHDRYFLDNVAGWILELDRGEGIPWEGNYSSWLEQKDARLAQEASSEAARRKSIEKELEWVRQGAKGRQSKGKARLARFEELNNTDYQKRNETNELFIPPGARLGDKVVEVANLRKSYGDRLLIDDLSFSVPKGAIVGIIGPNGAGKSTLFRMMSGQEEADSGSIVLGDTVKLASVDQFRDSMDNSKTVWEEVSGGQDIMRVGNTEMPSRAYVGRFNFKGVDQGKRVGELSGGERGRLHLAKLLQVGGNMLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIATHILDYQDEGKIEFFEGNFTEYEEYKKRTLGAEALEPKRIKYKRMTK
>NZ_CP031695.1|WP_041691892.1|4097671_4098568_-|LysR-family-transcriptional-regulator
MMFKQLQDMALFALVAECGSFTGAAKKAGLPKSSVSQRISQLEQALGLRLINRTTRQLNLTFAGERYLVHCQEMMQASERANVAIERLRDNPSGRLRITSPAGIGATLLARLNAAFQQEYPDVTLEVSVSDEVRDIVLEGYDVALRTGQPQDSSLIGRRIGYCERLLVASKGYLEQYEAITHPQQLAEHRCIAHRAWSEWLLNRGEEYYRWLLPPTHMTDNLVYARECALGDAGITLLPRFLTQEILPGGGLVQVLPDWQVEGNELWLVYPSRKLNSPAVARFIDYALQSPVFREFYQ
>NZ_CP031695.1|WP_151038327.1|4098665_4099667_+|zinc-binding-alcohol-dehydrogenase-family-protein
MTIKAIAINPEKPQQFIEIQVEKPTPGEYDLLVDVKAASVNPVDTKVHKGAQKNGLQHPRILGWDASGVVVEVGSKVSGFKPGDEVYYAGDITRPGSNTTQQLIDARITGHKPTSLDWAESAAIPLTALTAWEGLFDRLQLDKAEEGKTLLIVGGAGGVGSLAIPFAKLHSKVKVIATASRPDSVQWCKDRGADLVINYHDMPGELEKHGLKQVDYIFCLNDTDGHWDAMAKLVAPQGHICTIVENEKPLEMNELKLKSAALHFEFMYTRSMYTTPDIARQGEILDATAKLLDAGKVSSSLSKTLHGLSVETLSEAHRLVLEGHMRGKVVMVY
>NZ_CP031695.1|WP_013200652.1|4099778_4101005_-|multifunctional-transcriptional-regulator/nicotinamide-nucleotide-adenylyltransferase/ribosylnicotinamide-kinase-NadR
MSPFDYLKTAIRQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRREKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDEPRDRQLFEASAMSQQPTVSDRLRWLLQTFKYQKNIRIHSFNEEGMEPYPHGWDVWSRGINDFMENHGIVPNRVYTSEEFDAPQYQQHLGIEAVVVDAKRSFMSISGAQIRHDPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEFGRDYVFSHLGGDEMALQYSDYDKIALGQAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILVENNVPWVADGLRSLGSSVDRKEFQTLLVSMLEENNISYVHVEQDSYDERFLRCVELVKEMLGA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2153538 : 2212345

Enterobacteria_phage(28.0%)

integrase,protease,terminase,capsid,tail,head,holin,portal

attL 2153392:2153406|attR 2217733:2217747

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2153392:2153406	attL	NA	NA	NA	NA
WP_151037264.1\|2153538_2154720_+\|integrase	tyrosine-type recombinase/integrase	K7PGY1	Enterobacteria_phage	1.6e-116	49.9
WP_151037265.1\|2154700_2154925_-	hypothetical protein	K7PM28	Enterobacteria_phage	7.8e-12	51.7
WP_151037266.1\|2154969_2155320_-	hypothetical protein	A0A193GYX4	Enterobacter_phage	1.7e-29	56.9
WP_151037267.1\|2155366_2156050_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	2.0e-90	66.4
WP_151037268.1\|2156061_2156319_-	hypothetical protein	A0A1V0E5L1	Salmonella_phage	3.2e-25	73.1
WP_151037269.1\|2156311_2157052_-	DUF2786 domain-containing protein	NA	NA	NA	NA
WP_151037270.1\|2157300_2157483_-	DUF1317 family protein	NA	NA	NA	NA
WP_151037271.1\|2157443_2157893_-	hypothetical protein	NA	NA	NA	NA
WP_151038699.1\|2158365_2159004_-	LexA family transcriptional regulator	A5VW98	Enterobacteria_phage	1.1e-34	42.8
WP_151037272.1\|2159110_2159314_+	hypothetical protein	NA	NA	NA	NA
WP_151037273.1\|2159336_2159861_+	hypothetical protein	K7PJS5	Enterobacterial_phage	5.3e-19	43.0
WP_151037274.1\|2159887_2160097_+	hypothetical protein	NA	NA	NA	NA
WP_151037275.1\|2160077_2160266_+	DUF4222 domain-containing protein	A0A1W6JP38	Morganella_phage	3.9e-09	49.1
WP_151037276.1\|2160262_2161297_+	GntR family transcriptional regulator	K7PLZ7	Enterobacterial_phage	2.7e-38	60.6
WP_151037277.1\|2161293_2161737_+	PerC family transcriptional regulator	NA	NA	NA	NA
WP_151037278.1\|2161855_2163157_+	chromosome partitioning protein ParB	A0A2H4J902	uncultured_Caudovirales_phage	5.2e-92	65.7
WP_151037279.1\|2163153_2163780_+	DNA methyltransferase	I6PDF5	Cronobacter_phage	4.3e-76	66.5
WP_151037280.1\|2163776_2164160_+	RusA family crossover junction endodeoxyribonuclease	A0A1C9IIA0	Salmonella_phage	2.5e-34	59.5
WP_151037281.1\|2164240_2165044_+	KilA-N domain-containing protein	A0A1W6JP13	Morganella_phage	3.2e-84	58.8
WP_151037282.1\|2165053_2166058_+	DUF968 domain-containing protein	A0A291AWV9	Escherichia_phage	7.1e-105	53.8
WP_151037283.1\|2166069_2166435_+	antitermination protein Q	K7PGW2	Enterobacterial_phage	2.1e-46	74.4
WP_151037284.1\|2166437_2167067_-	hypothetical protein	NA	NA	NA	NA
WP_151037285.1\|2167059_2167482_-	hypothetical protein	NA	NA	NA	NA
WP_151037286.1\|2167492_2168590_-	hypothetical protein	NA	NA	NA	NA
WP_134824684.1\|2168825_2169209_+	hypothetical protein	F1C592	Cronobacter_phage	1.3e-46	76.4
WP_134824683.1\|2169195_2169480_+\|holin	phage holin family protein	A0A248XD85	Klebsiella_phage	1.7e-08	36.0
WP_151037287.1\|2169476_2170103_+	glycoside hydrolase family 19 protein	F1C591	Cronobacter_phage	1.2e-73	63.8
WP_151038700.1\|2170382_2170628_+	peptidase	Q8SBD8	Shigella_phage	4.1e-14	58.0
WP_151037288.1\|2170670_2170976_-	hypothetical protein	NA	NA	NA	NA
WP_151037289.1\|2171180_2171402_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_151037290.1\|2171431_2171716_+	hypothetical protein	NA	NA	NA	NA
WP_151037291.1\|2171796_2172204_+	DUF2513 domain-containing protein	NA	NA	NA	NA
WP_151037292.1\|2172372_2173830_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	2.1e-214	70.7
WP_151037293.1\|2173811_2174402_+	hypothetical protein	K7P7D2	Enterobacteria_phage	5.0e-74	66.3
WP_151037294.1\|2174424_2174775_+	HNH endonuclease	A0A1W6JP27	Morganella_phage	2.0e-46	71.6
WP_151037295.1\|2175031_2175505_+\|terminase	phage terminase small subunit P27 family	K7PHI2	Enterobacteria_phage	4.1e-63	71.8
WP_151037296.1\|2175508_2177239_+\|terminase	terminase large subunit	A0A1P8DTK0	Proteus_phage	1.2e-274	77.8
WP_151037297.1\|2177238_2178543_+\|portal	phage portal protein	K7PJU5	Enterobacteria_phage	1.5e-216	85.3
WP_151037298.1\|2178554_2179403_+\|protease	Clp protease ClpP	K7PH05	Enterobacteria_phage	4.6e-105	71.0
WP_151037299.1\|2179412_2180627_+\|capsid	phage major capsid protein	K7PM57	Enterobacteria_phage	1.8e-195	88.3
WP_151037300.1\|2180679_2181006_+\|head,tail	phage gp6-like head-tail connector protein	K7PKT4	Enterobacteria_phage	9.5e-35	62.0
WP_151037301.1\|2181068_2181275_+	hypothetical protein	Q9MCV3	Escherichia_phage	2.4e-07	52.9
WP_151037302.1\|2181277_2181610_+\|head	phage head closure protein	A0A286S2A2	Klebsiella_phage	1.0e-39	71.8
WP_151038701.1\|2181602_2182088_+	HK97 gp10 family phage protein	A0A0U3TGT7	Pseudomonas_phage	2.3e-48	57.9
WP_151037303.1\|2182084_2182450_+	DUF3168 domain-containing protein	K7PHI9	Enterobacteria_phage	1.4e-47	73.6
WP_151037304.1\|2182503_2182998_+\|tail	phage tail protein	A0A286S1Q8	Klebsiella_phage	4.0e-61	70.6
WP_151037305.1\|2183053_2183485_+\|tail	phage tail protein	K7PJU9	Enterobacteria_phage	1.5e-51	78.9
WP_151038702.1\|2183445_2183700_+\|tail	phage tail protein	A0A286S1P2	Klebsiella_phage	2.2e-26	65.1
WP_151037306.1\|2183719_2186194_+\|tail	phage tail tape measure protein	K7PGX8	Enterobacteria_phage	2.9e-224	54.8
WP_151037307.1\|2186197_2186536_+\|tail	phage tail protein	K7PHL4	Enterobacterial_phage	1.5e-43	69.6
WP_151037308.1\|2186532_2187288_+\|tail	phage minor tail protein L	K7PKU0	Enterobacteria_phage	1.3e-111	79.7
WP_151037309.1\|2187290_2187998_+	peptidase P60	Q9MCU3	Escherichia_phage	5.0e-113	78.8
WP_134824662.1\|2188057_2188480_+	hypothetical protein	NA	NA	NA	NA
WP_134824951.1\|2188537_2189125_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	1.8e-68	71.0
WP_151037310.1\|2189178_2192352_+	host specificity protein J	O64335	Escherichia_phage	0.0e+00	80.1
WP_151037311.1\|2192361_2192670_+	hypothetical protein	A0A192Y8D4	Enterobacteria_phage	8.2e-12	41.7
WP_151037312.1\|2192666_2193329_+	hypothetical protein	G8C7R6	Escherichia_phage	5.8e-47	43.9
WP_151037313.1\|2193405_2193717_+	TonB family protein	NA	NA	NA	NA
WP_151037314.1\|2193780_2194968_+\|tail	tail fiber domain-containing protein	A0A1V0E5M2	Salmonella_phage	2.6e-37	49.5
WP_151038703.1\|2195074_2195320_+	DNA polymerase V	I6PD82	Cronobacter_phage	9.1e-14	50.0
WP_151037315.1\|2195321_2195642_+	hypothetical protein	K7PGV5	Enterobacterial_phage	5.0e-12	32.1
WP_053142832.1\|2195830_2196367_-	septation protein A	NA	NA	NA	NA
WP_151037316.1\|2196434_2197172_-	UPF0259 family protein	NA	NA	NA	NA
WP_151037317.1\|2197510_2198143_+	outer membrane protein OmpW	NA	NA	NA	NA
WP_013202402.1\|2198203_2198518_-	BON domain-containing protein	NA	NA	NA	NA
WP_151037318.1\|2198675_2199482_-	tryptophan synthase subunit alpha	NA	NA	NA	NA
WP_013202400.1\|2199481_2200672_-	tryptophan synthase subunit beta	NA	NA	NA	NA
WP_151037319.1\|2200722_2202084_-	bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF	A0A0P0IR83	Acinetobacter_phage	5.0e-37	40.7
WP_053142839.1\|2202086_2203085_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	3.1e-52	40.6
WP_013202397.1\|2203100_2203679_-	glutamine amidotransferase	A0A0P0IKJ1	Acinetobacter_phage	6.2e-29	37.0
WP_151037320.1\|2203678_2205241_-	anthranilate synthase component 1	NA	NA	NA	NA
WP_053142843.1\|2205488_2206400_+	PHP domain-containing protein	NA	NA	NA	NA
WP_013202393.1\|2206433_2207054_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_151037321.1\|2207152_2207779_-	trypsin-like peptidase domain-containing protein	NA	NA	NA	NA
WP_013202391.1\|2208695_2209643_+	23S rRNA pseudouridine(2605) synthase RluB	NA	NA	NA	NA
WP_013202390.1\|2209726_2210317_-	cob(I)yrinic acid a,c-diamide adenosyltransferase	NA	NA	NA	NA
WP_151037322.1\|2210316_2211078_-	YciK family oxidoreductase	NA	NA	NA	NA
WP_013202388.1\|2211295_2212345_+\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	3.1e-18	28.7
2217733:2217747	attR	NA	NA	NA	NA

DBSCAN-SWA_2

2969114 : 2979020

uncultured_Caudovirales_phage(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013201731.1\|2969114_2969360_+	DinI family protein	K7PKR6	Enterobacteria_phage	1.5e-24	69.6
WP_151038735.1\|2969459_2969699_+	hypothetical protein	A0A2H4J1D0	uncultured_Caudovirales_phage	2.0e-13	52.9
WP_013201729.1\|2969714_2969912_-	hypothetical protein	NA	NA	NA	NA
WP_151037753.1\|2970211_2971963_-	amylovoran biosynthesis protein AmsF	A0A1S6L3G8	Erwinia_phage	1.6e-165	48.3
WP_013201726.1\|2972103_2972454_-	hypothetical protein	A0A286N2Q7	Klebsiella_phage	9.9e-22	45.5
WP_013201725.1\|2972450_2972918_-	glycoside hydrolase family protein	H9C148	Vibrio_phage	2.0e-25	44.4
WP_151037754.1\|2973197_2973887_+	helix-turn-helix transcriptional regulator	F1C5C2	Cronobacter_phage	9.5e-93	75.1
WP_151037755.1\|2974154_2974442_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_151037756.1\|2974428_2974809_-\|holin	holin	F1C592	Cronobacter_phage	2.2e-30	58.8
WP_053145469.1\|2975123_2975954_+	alpha/beta hydrolase	A0A0B5A484	Mycobacterium_phage	4.9e-11	29.1
WP_151037757.1\|2976175_2976694_+	ATP-binding protein	A0A2H4JFX6	uncultured_Caudovirales_phage	1.5e-21	34.4
WP_105759230.1\|2976816_2976999_+	addiction module toxin, HicA family	A0A0D4DC32	Acinetobacter_phage	1.1e-13	55.9
WP_151038736.1\|2977071_2977485_+	type II toxin-antitoxin system HicB family antitoxin	A0A0D4DCG1	Acinetobacter_phage	3.8e-20	41.8
WP_013201718.1\|2977769_2979020_-	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	8.2e-18	87.0

DBSCAN-SWA_3

3565968 : 3625092

Salmonella_phage(68.18%)

integrase,protease,terminase,capsid,tail,lysis,head,plate,tRNA,portal

attL 3574713:3574734|attR 3622132:3622153

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151038041.1\|3565968_3567357_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.8e-45	35.0
WP_013201152.1\|3567590_3568085_+	peptidylprolyl isomerase B	NA	NA	NA	NA
WP_151038042.1\|3568084_3568810_+	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_053141923.1\|3568957_3569467_+	5-(carboxyamino)imidazole ribonucleotide mutase	NA	NA	NA	NA
WP_151038043.1\|3569463_3570534_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_151038044.1\|3570986_3571730_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_151038045.1\|3571697_3572351_-	acyl-homoserine-lactone synthase	NA	NA	NA	NA
WP_151038046.1\|3572508_3574926_-	ABC transporter permease	NA	NA	NA	NA
3574713:3574734	attL	NA	NA	NA	NA
WP_013201145.1\|3574922_3575609_-	ABC transporter ATP-binding protein	A0A2H4UU96	Bodo_saltans_virus	2.0e-05	25.8
WP_151038047.1\|3575579_3576203_+\|protease	multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1	NA	NA	NA	NA
WP_013201143.1\|3576469_3576688_-	transcriptional regulator	Q37973	Salmonella_virus	4.0e-21	61.1
WP_151038048.1\|3576767_3577862_-	phage late control D family protein	E5G6Q3	Salmonella_phage	2.5e-148	73.4
WP_013201141.1\|3577858_3578344_-\|tail	phage tail protein	E5G6Q2	Salmonella_phage	7.2e-55	66.5
WP_151038049.1\|3578340_3580986_-\|tail	phage tail tape measure protein	A0A2H4JGB2	uncultured_Caudovirales_phage	1.0e-134	43.4
WP_071822138.1\|3580978_3581101_-\|tail	GpE family phage tail protein	E5G6Q0	Salmonella_phage	1.8e-10	71.8
WP_151038050.1\|3581115_3581439_-\|tail	phage tail assembly protein	E5G6P9	Salmonella_phage	1.2e-26	68.1
WP_151038051.1\|3581497_3582013_-\|tail	phage major tail tube protein	A0A1S6L002	Salmonella_phage	2.9e-86	91.2
WP_151038052.1\|3582025_3583198_-\|tail	phage tail sheath protein	A0A1S6KZY7	Salmonella_phage	5.8e-207	91.3
WP_151038053.1\|3583440_3584523_+	DUF4875 domain-containing protein	NA	NA	NA	NA
WP_151038054.1\|3584562_3585153_-\|tail	tail fiber assembly protein	A0A218M4J2	Erwinia_phage	2.2e-45	47.5
WP_151038055.1\|3585152_3586214_-\|tail	phage tail protein	A0A2I8TVA9	Erwinia_phage	4.3e-100	55.7
WP_151038758.1\|3586210_3586804_-\|tail	phage tail protein I	A0A1S6L000	Salmonella_phage	3.6e-88	76.6
WP_151038056.1\|3586821_3587736_-\|plate	baseplate assembly protein	A0A1S6KZY6	Salmonella_phage	1.3e-100	65.9
WP_151038057.1\|3587722_3588079_-\|plate	baseplate assembly protein	A0A1S6KZZ4	Salmonella_phage	2.8e-40	65.0
WP_151038058.1\|3588078_3588657_-\|plate	phage baseplate assembly protein V	A0A1S6KZX7	Salmonella_phage	9.8e-83	77.5
WP_151038059.1\|3588743_3589952_+	hypothetical protein	NA	NA	NA	NA
WP_151038060.1\|3589985_3590435_-	phage virion morphogenesis protein	A0A1S6L001	Salmonella_phage	2.1e-40	55.5
WP_151038061.1\|3590427_3590862_-\|tail	phage tail protein	E5G6N3	Salmonella_phage	6.7e-52	70.0
WP_151038062.1\|3590824_3591028_-	hypothetical protein	A0A1S6KZX6	Salmonella_phage	4.1e-20	67.2
WP_151038759.1\|3590957_3591383_-\|lysis	LysB family phage lysis regulatory protein	A0A1S6KZX8	Salmonella_phage	1.9e-43	66.7
WP_151038063.1\|3591382_3591898_-	lysozyme	E5G6N1	Salmonella_phage	3.0e-75	79.4
WP_151038064.1\|3591878_3592091_-	hypothetical protein	E5G6N0	Salmonella_phage	5.3e-18	61.8
WP_053143687.1\|3592094_3592298_-\|tail	phage tail protein	E5G6M9	Salmonella_phage	5.4e-28	85.1
WP_151038760.1\|3592297_3592762_-\|head	head completion/stabilization protein	E5G6M8	Salmonella_phage	7.4e-57	66.9
WP_151038065.1\|3592868_3593519_-\|terminase	terminase endonuclease subunit	E5G6M7	Salmonella_phage	1.4e-90	78.7
WP_151038066.1\|3593522_3594584_-\|capsid	phage major capsid protein, P2 family	A0A1S6KZZ3	Salmonella_phage	5.8e-166	85.1
WP_151038067.1\|3594600_3595455_-\|capsid	GPO family capsid scaffolding protein	A0A1S6KZW9	Salmonella_phage	3.8e-107	76.4
WP_151038068.1\|3595598_3597365_+\|terminase	terminase ATPase subunit family protein	A0A1S6KZW3	Salmonella_phage	0.0e+00	89.5
WP_151038069.1\|3597364_3598414_+\|portal	phage portal protein	A0A1S6KZW5	Salmonella_phage	9.2e-172	90.0
WP_151038070.1\|3598434_3599454_-	DUF2806 domain-containing protein	A0A291AUV8	Sinorhizobium_phage	2.0e-06	24.5
WP_151038071.1\|3599582_3601259_-	ATP-binding protein	NA	NA	NA	NA
WP_041691929.1\|3601476_3601734_-	hypothetical protein	J9Q7T5	Salmonella_phage	5.1e-15	47.1
WP_013201115.1\|3601782_3601974_-	hypothetical protein	NA	NA	NA	NA
WP_151038761.1\|3602078_3604355_-	replication endonuclease	F1BUS0	Erwinia_phage	0.0e+00	75.5
WP_151038072.1\|3604394_3604970_-	hypothetical protein	NA	NA	NA	NA
WP_151038073.1\|3604966_3605821_-	DNA adenine methylase	E5G6L8	Salmonella_phage	1.8e-93	64.0
WP_151038074.1\|3605817_3606045_-	TraR/DksA family transcriptional regulator	F1BUS2	Erwinia_phage	1.5e-15	51.4
WP_053143662.1\|3606044_3606272_-	DUF2732 domain-containing protein	A0A1S6L021	Salmonella_phage	2.1e-09	51.9
WP_053143659.1\|3606339_3606681_-	hypothetical protein	A0A1S6L019	Salmonella_phage	4.6e-32	60.2
WP_151038075.1\|3606644_3606836_-	DUF2724 domain-containing protein	F1BUS5	Erwinia_phage	1.1e-11	69.6
WP_151038076.1\|3606843_3607353_-	phage regulatory CII family protein	A0A0M4QWN1	Salmonella_phage	9.6e-50	59.5
WP_013201107.1\|3607365_3607620_-	phage regulatory protein	F1BUS7	Erwinia_phage	2.7e-05	39.5
WP_013201106.1\|3607715_3608312_+	bacteriophage CI repressor	A0A1S6KZZ7	Salmonella_phage	1.5e-33	39.2
WP_151038077.1\|3608320_3609361_+\|integrase	tyrosine-type recombinase/integrase	E5G6L0	Salmonella_phage	1.1e-105	56.2
WP_134823621.1\|3609476_3610250_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_151038078.1\|3610327_3611185_+	co-chaperone YbbN	NA	NA	NA	NA
WP_013201102.1\|3611282_3612200_+	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_105759596.1\|3612196_3612664_+	NfeD family protein	NA	NA	NA	NA
WP_013201100.1\|3612632_3613826_-	hypothetical protein	NA	NA	NA	NA
WP_151038079.1\|3613825_3614905_-	GTP-binding protein	NA	NA	NA	NA
WP_013201098.1\|3614908_3615205_-	hypothetical protein	NA	NA	NA	NA
WP_151038080.1\|3615220_3615970_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	3.5e-08	42.7
WP_151038081.1\|3615978_3616752_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.2e-14	30.4
WP_053141903.1\|3616755_3618138_-	MFS transporter	NA	NA	NA	NA
WP_151038082.1\|3618168_3619050_-	polysaccharide deacetylase	NA	NA	NA	NA
WP_151038083.1\|3619431_3620439_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_134823614.1\|3620454_3620865_-	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_151038084.1\|3620961_3623547_+	copper-exporting P-type ATPase CopA	A0A218MNH6	uncultured_virus	6.1e-108	36.7
3622132:3622153	attR	NA	NA	NA	NA
WP_151038085.1\|3623638_3624439_+	conjugal transfer protein TraB	NA	NA	NA	NA
WP_013201089.1\|3624612_3625092_+\|tRNA	Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP031695

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection