CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044283	Rhodococcus erythropolis strain X5 plasmid pRhX5, complete sequence	0 crisprs	csa3,PD-DExK	0	0	3	0
NZ_CP044284	Rhodococcus erythropolis strain X5 chromosome, complete genome	1 crisprs	WYL,cas3,csa3,cas4,DEDDh,DinG,RT	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

213482 : 258775

Gordonia_phage(36.36%)

transposase,integrase

attL 213403:213462|attR 259818:260919

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
213403:213462	attL	NA	NA	NA	NA
WP_003943780.1\|213482_214508_+\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	4.0e-10	28.7
WP_006359314.1\|214504_216340_+\|integrase	tyrosine-type recombinase/integrase	A0A2P1CCU8	Gordonia_phage	5.3e-05	30.3
WP_151097107.1\|217108_217300_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	2.0e-24	77.8
WP_151097108.1\|217601_217949_-	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_151097110.1\|217945_218584_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_151097376.1\|218680_219913_+	FAD-dependent monooxygenase	NA	NA	NA	NA
WP_151097112.1\|220866_221658_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_151097379.1\|222072_222399_-	hypothetical protein	NA	NA	NA	NA
WP_151097114.1\|222832_223720_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_151097116.1\|224585_224957_-	hypothetical protein	NA	NA	NA	NA
WP_151097118.1\|225321_225627_-	hypothetical protein	NA	NA	NA	NA
WP_151097120.1\|225765_225945_-	hypothetical protein	NA	NA	NA	NA
WP_116058469.1\|228258_229403_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.8e-32	35.5
WP_151097122.1\|230216_230642_-	hypothetical protein	NA	NA	NA	NA
WP_099699101.1\|231076_232018_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003941073.1\|232126_232438_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_151097124.1\|232530_232836_-	hypothetical protein	NA	NA	NA	NA
WP_007732099.1\|234812_236093_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	6.0e-32	39.1
WP_151097126.1\|236460_237303_-	cell filamentation protein Fic	NA	NA	NA	NA
WP_075835818.1\|237299_237515_-	hypothetical protein	NA	NA	NA	NA
WP_151097128.1\|237671_239447_-	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	3.3e-52	36.9
WP_051649789.1\|239587_242269_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	3.0e-150	33.6
WP_003943355.1\|242471_243665_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_003943380.1\|243874_244849_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_070160344.1\|245696_245945_+	hypothetical protein	NA	NA	NA	NA
WP_070160346.1\|246031_246391_-	Lsr2 family protein	A0A160DEV0	Gordonia_phage	1.2e-17	43.7
WP_075836239.1\|246520_248155_-	Fis family transcriptional regulator	NA	NA	NA	NA
WP_151097130.1\|248454_249909_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_019749850.1\|250024_251137_+	NDMA-dependent alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.7e-38	32.2
WP_151097132.1\|251248_252148_+	hypothetical protein	NA	NA	NA	NA
WP_019749848.1\|252482_253259_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_151097134.1\|253251_255186_+	propionyl-CoA synthetase	A0A2H4PQU7	Staphylococcus_phage	4.2e-53	29.8
WP_151097136.1\|255224_256226_+	acryloyl-CoA reductase	NA	NA	NA	NA
WP_006359314.1\|256939_258775_-\|integrase	tyrosine-type recombinase/integrase	A0A2P1CCU8	Gordonia_phage	5.3e-05	30.3
259818:260919	attR	NA	NA	NA	NA

DBSCAN-SWA_2

400764 : 447180

Corynebacterium_phage(25.0%)

transposase,integrase

attL 412469:412484|attR 447686:447701

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030538129.1\|400764_402012_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.9e-76	44.4
WP_030537937.1\|402400_402715_-	hypothetical protein	NA	NA	NA	NA
WP_007733691.1\|402711_403494_-	AAA family ATPase	Q8JL10	Natrialba_phage	7.9e-11	25.1
WP_007733695.1\|407845_408103_-	hypothetical protein	NA	NA	NA	NA
WP_151097291.1\|410231_411179_-	phosphatidylserine/phosphatidylglycerophosphate/ cardiolipin synthase family protein	NA	NA	NA	NA
WP_128638091.1\|411386_411674_-	RES domain-containing protein	NA	NA	NA	NA
WP_151097294.1\|411849_412032_-	hypothetical protein	NA	NA	NA	NA
WP_030537933.1\|412060_412543_-	polyketide cyclase	NA	NA	NA	NA
412469:412484	attL	NA	NA	NA	NA
WP_151097296.1\|412719_413187_+	hypothetical protein	NA	NA	NA	NA
WP_151097298.1\|413866_414661_+	hypothetical protein	NA	NA	NA	NA
WP_151097300.1\|414976_416011_-	diiron oxygenase	NA	NA	NA	NA
WP_030538129.1\|416199_417447_-\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.9e-76	44.4
WP_151097302.1\|417601_417808_+	hypothetical protein	NA	NA	NA	NA
WP_151097304.1\|418142_418355_+	ribbon-helix-helix protein, CopG family	NA	NA	NA	NA
WP_003943396.1\|418351_418708_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A2K9V2U7	Faecalibacterium_phage	6.6e-05	34.2
WP_007728194.1\|418905_419295_-	helix-turn-helix transcriptional regulator	G9FH51	Rhodococcus_phage	3.2e-05	29.4
WP_149357472.1\|420367_420820_-	hypothetical protein	NA	NA	NA	NA
WP_116058469.1\|421565_422710_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.8e-32	35.5
WP_024488231.1\|423169_423610_-	hypothetical protein	G9FGX7	Rhodococcus_phage	1.1e-06	31.0
WP_021343300.1\|424337_424583_-	hypothetical protein	NA	NA	NA	NA
WP_127160070.1\|424812_425361_-	ATP-binding protein	NA	NA	NA	NA
WP_151097306.1\|425457_425700_-	hypothetical protein	NA	NA	NA	NA
WP_151097308.1\|425887_426121_-	hypothetical protein	NA	NA	NA	NA
WP_151097310.1\|428847_429885_-	methionine synthase	NA	NA	NA	NA
WP_151097312.1\|429905_430898_-	DUF1852 domain-containing protein	NA	NA	NA	NA
WP_151097314.1\|431023_431971_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_151097316.1\|433598_434255_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_151097318.1\|434251_434920_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_151097320.1\|435037_435271_-	hypothetical protein	NA	NA	NA	NA
WP_151097322.1\|435288_435795_+	hypothetical protein	NA	NA	NA	NA
WP_151097324.1\|436176_436980_+	hypothetical protein	NA	NA	NA	NA
WP_151097326.1\|437252_438194_-	hypothetical protein	NA	NA	NA	NA
WP_094610787.1\|440201_441881_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	M4T586	Rhodobacter_phage	5.1e-07	24.6
WP_094610788.1\|441885_442824_+	AAA family ATPase	NA	NA	NA	NA
WP_094610789.1\|442820_444053_+	TniQ family protein	NA	NA	NA	NA
WP_064075584.1\|444376_445099_+\|transposase	TnsA-like heteromeric transposase endonuclease subunit	NA	NA	NA	NA
WP_064075566.1\|445095_447180_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
447686:447701	attR	NA	NA	NA	NA

DBSCAN-SWA_3

463610 : 498569

Enterobacteria_phage(40.0%)

transposase,integrase

attL 455994:456011|attR 504470:504487

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
455994:456011	attL	NA	NA	NA	NA
WP_151097409.1\|463610_464807_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_151097328.1\|464839_465859_+	recombinase	NA	NA	NA	NA
WP_151097330.1\|466446_467124_-	zf-HC2 domain-containing protein	NA	NA	NA	NA
WP_039868167.1\|467120_467609_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_081598159.1\|467672_468659_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_039868154.1\|468880_469312_+	transcriptional repressor	NA	NA	NA	NA
WP_151097332.1\|469372_471601_+	catalase/peroxidase HPI	NA	NA	NA	NA
WP_151097334.1\|471858_472494_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_006898186.1\|472925_473171_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_151097335.1\|473306_475487_+	MMPL family transporter	NA	NA	NA	NA
WP_006898188.1\|475608_475872_+	metal-sensitive transcriptional regulator	NA	NA	NA	NA
WP_006898189.1\|475965_476502_-	hypothetical protein	NA	NA	NA	NA
WP_151097337.1\|476498_477704_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_006898191.1\|478283_479678_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_151097339.1\|480163_480952_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_006898193.1\|480980_481319_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_006898194.1\|481320_482163_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_058228376.1\|484015_484489_+	hypothetical protein	NA	NA	NA	NA
WP_051649768.1\|485122_485851_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_006898201.1\|486031_486247_+	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_151097341.1\|486269_487442_-	hypothetical protein	NA	NA	NA	NA
WP_006898203.1\|487442_487850_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_006898204.1\|487928_488441_-	hypothetical protein	NA	NA	NA	NA
WP_042925970.1\|488545_489274_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_042925969.1\|489285_490158_+	cytochrome c biogenesis protein CcdA	NA	NA	NA	NA
WP_042925967.1\|490195_490543_-	hypothetical protein	NA	NA	NA	NA
WP_042926436.1\|491273_491900_-	peroxiredoxin	NA	NA	NA	NA
WP_081558932.1\|491946_492636_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_128638085.1\|493224_494421_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	5.2e-30	33.5
WP_151097343.1\|494618_495329_-\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	5.1e-49	47.3
WP_006359314.1\|495347_497183_-\|integrase	tyrosine-type recombinase/integrase	A0A2P1CCU8	Gordonia_phage	5.3e-05	30.3
WP_003943780.1\|497179_498205_-\|integrase	tyrosine-type recombinase/integrase	A0A0A7AR08	Bacillus_phage	4.0e-10	28.7
WP_151097345.1\|498278_498569_-\|transposase	transposase	Q9ETV7	Enterobacteria_phage	2.2e-14	48.9
504470:504487	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP044284

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044284_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044284_1

131808-131919

Orphan

Consensus_repeat	Method
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044284_1

>merge|NZ_CP044284|1|131808-131919|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCCCACACCCTGCAGAGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGGTGAACGGGTTGTCGACGAGAGCGTTGGTGCC

>NZ_CP044284|1|1|131808-131919|CRISPRCasFinder
TGAACGGGTTGTCGACGAGGGCGTTGGTGCC	CACACCCTGCAGAGCGTGTGCGGACGTTGCCTCGGCAACCGGCTCGAAGG
TGAACGGGTTGTCGACGAGAGCGTTGGTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044284.1\|WP_007735911.1\|137216_137669_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044284.1\|WP_081377593.1\|122824_123946_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP044284.1\|WP_134929797.1\|126099_126891_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224662
NZ_CP044284.1\|WP_151097483.1\|129459_130890_-\|CocE/NonD-family-hydrolase	unknown	unknown	gnl\|CDD\|273375
NZ_CP044284.1\|WP_151097489.1\|132074_133334_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP044284.1\|WP_151097486.1\|130886_131699_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274832
NZ_CP044284.1\|WP_151097477.1\|126837_128130_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP044284.1\|WP_151097492.1\|135273_136254_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238568
NZ_CP044284.1\|WP_042920630.1\|133418_134486_+\|iron-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|376439
NZ_CP044284.1\|WP_125050154.1\|121582_122785_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP044284.1\|WP_151097474.1\|125241_125868_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP044284.1\|WP_007735909.1\|136935_137220_-\|SHOCT-domain-containing-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP044284.1\|WP_003943598.1\|124794_125235_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|379177
NZ_CP044284.1\|WP_050657053.1\|137672_139319_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340879
NZ_CP044284.1\|WP_054188691.1\|140653_141241_+\|DinB-family-protein	unknown	unknown	gnl\|CDD\|368218
NZ_CP044284.1\|WP_042920627.1\|136250_136934_+\|SagB/ThcOx-family-dehydrogenase	unknown	unknown	gnl\|CDD\|188352
NZ_CP044284.1\|WP_064073664.1\|139387_140311_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044284.1\|WP_042453274.1\|134482_135277_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP044284.1\|WP_151097480.1\|128126_129467_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274674
NZ_CP044284.1\|WP_007735886.1\|123942_124683_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|213222

Protein	Function_ID	Function_description	E-value
NZ_CP044284.1\|WP_050657053.1\|137672_139319_-\|MFS-transporter	gnl\|CDD\|340879	cd17321, MFS_MMR_MDR_like, Methylenomycin A resistance protein (also called MMR peptide) and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This family is composed of bacterial, fungal, and archaeal multidrug resistance (MDR) transporters including several proteins from Bacilli such as methylenomycin A resistance protein (also called MMR peptide), tetracycline resistance protein (TetB), and lincomycin resistance protein LmrB, as well as fungal proteins such as vacuolar basic amino acid transporters, which are involved in the transport into vacuoles of the basic amino acids histidine, lysine, and arginine in Saccharomyces cerevisiae, and aminotriazole/azole resistance proteins. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. For example, MMR confers resistance to the epoxide antibiotic methylenomycin while TetB resistance to tetracycline by an active tetracycline efflux. MMR-like MDR transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.38096e-22
NZ_CP044284.1\|WP_081377593.1\|122824_123946_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.95187e-11
NZ_CP044284.1\|WP_134929797.1\|126099_126891_+\|hypothetical-protein	gnl\|CDD\|224662	COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism].	0.00343742
NZ_CP044284.1\|WP_151097483.1\|129459_130890_-\|CocE/NonD-family-hydrolase	gnl\|CDD\|273375	TIGR00976, Hypothetical_protein_Rv1835c/MT1883/Mb1866c., putative hydrolase, CocE/NonD family. This model represents a protein subfamily that includes the cocaine esterase CocE, several glutaryl-7-ACA acylases, and the putative diester hydrolase NonD of Streptomyces griseus (all hydrolases). This family shows extensive, low-level similarity to a family of xaa-pro dipeptidyl-peptidases, and local similarity by PSI-BLAST to many other hydrolases. [Unknown function, Enzymes of unknown specificity].	2.71089e-38
NZ_CP044284.1\|WP_151097489.1\|132074_133334_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.65829e-54
NZ_CP044284.1\|WP_151097486.1\|130886_131699_-\|hypothetical-protein	gnl\|CDD\|274832	TIGR03882, hypothetical_protein, bacteriocin biosynthesis cyclodehydratase domain. This model describes a ThiF-like domain of a fusion protein found in clusters associated with the production of TOMMs (thiazole/oxazole-modified microcins), small bacteriocins with characteristic heterocycle modifications. This domain is presumed to act as a cyclodehydratase, as do members of the SagC family modeled by TIGR03603.	5.3276e-05
NZ_CP044284.1\|WP_151097477.1\|126837_128130_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	1.38231e-66
NZ_CP044284.1\|WP_151097492.1\|135273_136254_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238568	cd01148, TroA_a, Metal binding protein TroA_a. These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	7.58601e-45
NZ_CP044284.1\|WP_042920630.1\|133418_134486_+\|iron-ABC-transporter-permease	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	8.01281e-91
NZ_CP044284.1\|WP_125050154.1\|121582_122785_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	2.9773e-52
NZ_CP044284.1\|WP_151097474.1\|125241_125868_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	1.88041e-09
NZ_CP044284.1\|WP_007735909.1\|136935_137220_-\|SHOCT-domain-containing-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	2.92733e-06
NZ_CP044284.1\|WP_003943598.1\|124794_125235_+\|PAS-domain-S-box-protein	gnl\|CDD\|379177	pfam13426, PAS_9, PAS domain.	3.26675e-11
NZ_CP044284.1\|WP_042920627.1\|136250_136934_+\|SagB/ThcOx-family-dehydrogenase	gnl\|CDD\|188352	TIGR03605, antibiot_sagB, SagB-type dehydrogenase domain. SagB of Sterptococcus pyogenes participates in the maturation of streptolysin S from a ribosomally produced precursor polypeptide. Chemically similar systems operate on highly diverse sets of bacteriocin precursors in numerous other bacteria. This model describes a domain within SgaB and homologous regions from other proteins, many of which appear to be involved in biosynthesis of secondary metabolites. While some substrates may be intermediates in non-ribosomal peptide syntheses, others are involved in heterocycle-containing bacteriocin biosynthesis, and can be found near SgaC-like (see TIGR03603, cyclodehydratase) and SgaD-like (see TIGR03604, "docking") proteins. Members of this domain family are heterogeneous in length, as many have a partial second copy of the domain represented here. The incomplete second domain scores below the cutoffs to this model in most cases.	4.20312e-29
NZ_CP044284.1\|WP_054188691.1\|140653_141241_+\|DinB-family-protein	gnl\|CDD\|368218	pfam04978, DUF664, Protein of unknown function (DUF664). This family is commonly found in Streptomyces coelicolor and is of unknown function. These proteins contain several conserved histidines at their N-terminus that may form a metal binding site.	2.47452e-42
NZ_CP044284.1\|WP_042453274.1\|134482_135277_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	1.47196e-101
NZ_CP044284.1\|WP_151097480.1\|128126_129467_-\|hypothetical-protein	gnl\|CDD\|274674	TIGR03604, hypothetical_protein, thiazole/oxazole-forming peptide maturase, SagD family component. Members of this protein family include enzymes related to SagD, previously referred to as a scaffold or docking protein involved in the biosynthesis of streptolysin S in Streptococcus pyogenes from the protoxin polypeptide (product of the sagA gene). Newer evidence describes an enzymatic activity, an ATP-dependent cyclodehydration reaction, previously ascribed to the SagC component. This protein family serves as a marker for widely distributed prokaryotic systems for making a general class of heterocycle-containing bacteriocins.	2.30459e-66
NZ_CP044284.1\|WP_007735886.1\|123942_124683_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	4.53615e-80

>NZ_CP044284.1|WP_151097486.1|130886_131699_-|hypothetical-protein
MYALADGHQLYPTPDGVWHYLTPDENAVTIGAPAEDLAELDNFLRRSGSVLGPGAIEIADALVSRGVLAVPGQVPEIPRPQRVLMDGIGPVADACIALLSKALPHLEVVSTTAPIEDDVASSDLVLSVAGAPPHDEWSELDTWCRRNQTPWQRVHAELGDICIGPFFDGIGSASYRDVCGRRLAASRVPDHLQALWNHLAGSERRPLGLSPTAAAMASALACSAVVAGVRGAPPSHLHHQIRMNPRTLMMTRHPVLPLPGGVLEPAPTLR
>NZ_CP044284.1|WP_151097483.1|129459_130890_-|CocE/NonD-family-hydrolase
MISLGVKIPAADGSSLATDVLLPPDSSPRGLIVIRTPYGRGWHLAEGIEWQSRGIAFISQDVRGRHDSTGSWEPYVHEREDSAALAEWLQDQPWTPECVIASGASYAAGTAWAFAAETNSADRSFRVDGVVSKVPTIGSDRVKRDPSGILLLAEHLAWWGEHGDSSSSREGFIPALMRSDSSLLEHLPVQSMIEKVGLTSDSPGWLTPILRARKREDFGGDDLVSADELSELDIAGLHIGGWDDAMIRETLQHFTSVGRGPQSLIVGPWAHDLRPGRVGETSFGRLQVEWMESVFAARPLTINRVFDRGVGEWSTEPFVTGANRVHLEPDRKDAAYSFLYDASRDRNNCVVLTFDIKHDSVLSGTPSVELKVHSPEGEADWIAELSVVDPAGVTRSIARGAGVSLQPTMVTIDLDPVLHTVRAGDVLSLRIAGSDFPRLARNLGDGDRYRGTRSTALHQSFSGSLTLPILGGTDGG
>NZ_CP044284.1|WP_151097480.1|128126_129467_-|hypothetical-protein
MDDLLVDARSGVLTSLEPHIRSDMPTGWVGWAARVADTRNFGGSGSLFRADPYGFGASIRNDAAARGAATGEAVERYCGNVVPEDLVRSSASALELAGSRVVDPAKFALYSEDQYRLPGFPFVPFTSDLNIRWALGHTMDEKVPTYVPAALTYLGYYTGTRRCEPPIASLQYAGIAAGRSRDEAEMSALLELLERDATALWWCGDRSQPAIELSDWERLPAHRQLGDLESQARSVRVLLLPSPFGIPVAAAWIRDDRRGLVALGTACRPTVEAAVSKALVEAYAVLAITIDLADPDGPTWRSVADGTLPAHLYKPFRADRRYRDEFDPQWKDIVDLPTVAQLYLDPVMALAAEEHLFDYTETLSVSEIPDEAPLDLASLVALLMSRGHQPISVDLTTGDISIAGLHVVRILTPGLYNNAPAAFPLLGGSRLTSASTTHLHLPVPLA
>NZ_CP044284.1|WP_151097477.1|126837_128130_-|hypothetical-protein
MTSSLVDRRTGIIRELVDAVVPQHFPPEFKLIHSYVSDSARFSPWSSDSAGAGYCFDLGDRARPTAAAIGEAVERYCGNIVAKPIVRESAEALIGASIDLSQLARFDTAQYARPQFPFVEPNDDLEMDWTRGADLITGSDIWVPAELVWGSYPHFVARTGPALSPVAQAGLAAGPSVKFAIDNALREIVERDAMTLSWNGRCGVRIVTGIPEVLRRLGNHGTLSTRWLSFDSDFGIPVLGALVHDGLTGYSTIGTACHEEAQTAAFKSLGEALQLQLLSADYDNPQSGIGRAAASPTSPLAPWRADRSYAGAYRSDFADVMDYGCHLQLHLDPEIQARFESELVGAVVGEVGLDSLTSAAGTESALTAAGFRPAWVDLTTTDVLHAGLHVVRVVVPGCLTNAAAGLPFLGSPRLVDSLAGRSARTIPLPH
>NZ_CP044284.1|WP_134929797.1|126099_126891_+|hypothetical-protein
MVNASGFEDVGLADEAVRGGAAFVDITATSSYCEELEAVDGPVLMGVGLAPGLTSVLATEAHRLGDGPVDILIGLGGGELHGPAATAWTYGMLGTRFPDPDGRSVRNYTGMKTFRIPADVTGYRTGPAVRADFSDQHALTRDLGVPVRTYLRLDTSTATLGLAAMTWAPALQKVVPKKLWGSDRWVAMARADTGPALWVSGRSQSVATAAIAARAVQVIRDAAISKPTWFHAVETTESLQAAVPELSVRQWDGASRSSGKTVH
>NZ_CP044284.1|WP_151097474.1|125241_125868_-|TetR/AcrR-family-transcriptional-regulator
MTEVLREDTSARRKIIEAAREVFVDPGYAAATIKQLAAAAGVSVQSVYFVFGNKPTVLSALLDVAVAGDEEKTATLDRPWVAAALGAPHPLGQLRIQVHHGRLILERTADILLALRAAASADEDAARLWQINRTQRRTVQEHLMVGIVEKAPTVDLETAVNVALTLLSPETYTDLVVGAGWTGQQYEEWVVNTLAATLGLDRTVKSRK
>NZ_CP044284.1|WP_003943598.1|124794_125235_+|PAS-domain-S-box-protein
MERRRNVAQPPQSPIADLEQMPALILLDRLPVPVMAVHRDGSIVFANPSFADMLGYPKKAVSALRLQDILYDKDADDVSAEQAHRELSSEPGSVKEFVHSDSTLVRATVSQSLLRRDDDTITLAVLHDLTERLWNNPRHIDDKPTK
>NZ_CP044284.1|WP_007735886.1|123942_124683_+|ABC-transporter-ATP-binding-protein
MTMTTGTTVLDIQNVDLTFPDGQSRVTALDDVSLRLHRGEIAAITGPSGSGKSSLLAVASTLIRPDSGHVYLRTPEGSTDIAALSRRAASELRRSSIGIVFQQSNLVSSLTALEQLEVMAHLGQSVFTSRTRRKAVKSKAMDLLDAVGLADQSGKRPSQLSGGQRQRVNLARALMNDPQLLVVDEPTSALDQERGAAVMDLIIGVVREREAATLLVTHDRSHLSRMDTVYRVVDGSLAEDQEALAA
>NZ_CP044284.1|WP_081377593.1|122824_123946_+|ABC-transporter-permease
MSIRGAMERVCIRESVEASTGKEFTVFVAMRDLRAARGRFALISVVVLLVALLVSFLSGLTAGLRHQNVSAIEAMNADTVVFADTGAGASFDESALTQDQVNAWTSTSKDVDPIGIGRGKAGLADGNQKSVALFGADGGFGDVTPSASGTVVLSEGAARELGAGAGDQVSVGTKQFTVSAVRGDDWYSHSPVVWMTLDDWQAANPRGGVATVLAVTGASDASATDKAAATTSTTVSGSLDAIGSYKSENGSLTLMTLMLFAISALVIGAFFTVWTIQRTPDIATLKALGATTGSLVRDALGQALIVLIAGVTVGIGLTAVAGSLIGDAMPFVLDASTTVVPAVALIGLGLLGAAFALRFLSTTDPLTALGSAR
>NZ_CP044284.1|WP_125050154.1|121582_122785_-|sensor-histidine-kinase
MDEPGPNLAKLGEMHRSPLTPVFAGLQLGLHVLVMALAGVVFLRALIDESDLTATIIALAVIFVAVYLFGVAKRLRGNAARWWLAVLTLVWIATMAVSADAAYLAFGLFFLYLHILRRPWSLLAVTAATAVAVIGTGLHRGWTVAGAVGPIIGAAVAVAIGLGYQALYREAAERGRLIDELMNTREELASTSRDAGKFAERERLAAEIHDTVAQGLSSIQMLLHAAERADPDSPAIRQISLARETAADSLAETRQLIAELTPAALDGQSLADALRRICERASSPELEARSVVEGEAVRLPMPLEATLVRIAQGAVSNVLRHADATRMAVTLTYSDDTVSLDVVDNGRGFDVAVLERGPAESFGLNAIRRRVELQGGTFSIESEPGHTAVAVTFPLEVGEP
>NZ_CP044284.1|WP_151097489.1|132074_133334_+|MFS-transporter
MSETPTTGSVEAQPHVFRDRSFRLFFTARTIAVAGAAVTGVAMPILVFDISRSPFLTSLAAAGTVLPYLVFGLFAGAVADRVNRRTVILCAQAVAALALASIPAAQALGVLTAWHAVGVSMCIGTCFVWFDAAAFGALPALVGRQRIPAANSALWTSSTLVDVAFPAIAGVLVASIGPAYALGADALAYVLAGLAMASIGASFSTTPAAPKKSGTGIARDIREGLSFLWRSPLLRALTGVGFVNSLTQGAVTALLVVYASERLGISTSSPMIGAVWTAVSVGGVVGALVLPRLPARWPVGAITVGALTIAPVVLFVVATTGNTGAAITALVVYSGCATVTILNGIGARQRLTPDRLQGRVNTTARMVAWGGSPVGALIAGAIAGRWDIGTAYLVACIFALAGALFAWASALRTDPYPHK
>NZ_CP044284.1|WP_042920630.1|133418_134486_+|iron-ABC-transporter-permease
MTLTSEAAPRVPSRPHPVGERGYVPFLLATAVVLVAVSTVAVWSGAASVSFADVFAVLYAHVGGPPVDPLLDRIVWGLRVPRILIAALAGAGLSLAGAVLQALVRNPIADPYILGVGSGASFGAVLIMTTGIGTGLSIGVPVAAFLGAMVSLIAVLVLGRREGMLVPLRMVLAGVAIGYLLSAATSFVQLRADPSQLSGVLFWLLGSVSGASWSDLGVPAAVITVCAAILLTQSRQLNALAMGDESAQSVGVDVRRTRLLLLVIASLLTAVVVSVAGGIGFVGLLVPHAVRLLVGSDHGKLLPATALVGATFLVIVDLAARMLDAPNELPLGIITAGLGAPFFLWLLRRDGGAQS
>NZ_CP044284.1|WP_042453274.1|134482_135277_+|ABC-transporter-ATP-binding-protein
MRLSASGIHVVRGGRLVVSGVDLEAPEGSVVGLVGPNGSGKSSLLRALYRSMKPRSGIVKVDEVNVWDDLSPRSAARIIGVVGQEHSSDFSFSVREVVATGRTPHHSAFSRLGEIDRDIVSAALVRTGMQGFGSRLFAELSGGEKQRVMLARAIAQQPSVLVLDEPTNHLDIRAQLELMELVAELGTTTIVAIHELALAAAYCDYVCLLSGGVVVATGPTAEVLTEDLLSEVFGVQVHLGTHPLTGRPLLSFAPPLLHTKEAVS
>NZ_CP044284.1|WP_151097492.1|135273_136254_+|ABC-transporter-substrate-binding-protein
MKSSIRTAALLCSAVTATAVLTACGNSTADSAASSSEKITVTNCDREVTVPKTAERIVSLYPSMTELLIQLGAADRIVGQSNTDLSPPSPELADQFAAVPVLSTGVPAKEALLDARPDLIVSDGEYWFDGDRLQTMDELRDLGIPIFVNSGYCHKAVTEGRIDDVWSDLDALGALTGTSDAAATLLADGKKSLAATEASVAGQEPVPTVMVQVSEGQSYALARGLYSSVLEAAGGSNLFENDLPDGKYFGQVATESVLAKSPKAVLVVYSTESARESTLDAARTAFAGTPAAASNAIFAVPEAWFAGELVSIDGAGEVSRLLHPGS
>NZ_CP044284.1|WP_042920627.1|136250_136934_+|SagB/ThcOx-family-dehydrogenase
MTALERIEAVVSLHAVLDRTVSPSELPFDEHALPPVTCESVELPAATPLPACGFADVLQARRSRYDPAQTVLRAGELSNVLHHSLVSSPTAGGMRELTLSFVLSRPGDELGAGVYRYARGRAEAVRPGDVREHLRASLLQPEFVDVFPVLLFVVADVEAPLEKYAMRHYRTMHVDAGVLVQNLYLVTEAMGLAGCAIAGFTDARVASLLNLATTQLPVMAFALGRRS
>NZ_CP044284.1|WP_007735909.1|136935_137220_-|SHOCT-domain-containing-protein
MSFLRRAGRVAVASSIHGNVQRRQRTRWAAEDQARAAQAQPVPPIPDLPPLPPQAAPAASMDLKLEQLTKLGELKNAGVLTEAEFETQKARILA
>NZ_CP044284.1|WP_007735911.1|137216_137669_-|hypothetical-protein
MSNQDQFGPIEYVAVEFPGGAPTSAGFEQLLTLVDSGVIRILDLEFVTKAADGSVAVVPASTFELADFDLAQFDGAASGLLDAGDIAAVGDELATGSVAAVLVYEELAILPVIDAWTRSGAKIVTEGHLSLDELATALDNTAPGNTEKDA
>NZ_CP044284.1|WP_050657053.1|137672_139319_-|MFS-transporter
MSVKPGAAATTAAVSTASWLPLIVVVLTQIQASFAVNALTVSMAGITTDLDTPATSVGTAITAGTFAMAAFILLGAKIGARYGTRLVFQIAVAIHGLAMAAVALSQSPAMLFVAQAASGAVIALIAPALTVFIATNFSGDQQAKAIGYLAAAIPAAGVLALLIAGSFATTIGWRYSFALVVALAVVNLILSFRVKPVPPQKDITIDWAGAAIAAVAVILLSFGFSGLNSWGVILATDAAPFSVIGVSPAAILIVLGTICAQGFFQWTRSRKAQNKPQLFNLDVLKTGAERATTICMATMMFVGTAANFLIPLYMQIIQGRSSLQTSFSIIPYTLSIFIASTVVARLYKTYSPRLIARAGFVVVAAGLILLAFTIRGDWHQIFVVIGLITLGLGQGAIVALVFNTLLTAAPKELAGDVGAWRGLVHNMSGSVGIAVASVFAVGILGSLVSSQLIDNPTIPASLKVESGINLDQVNFVPNDQLVVTLENTSATQAQIDEAIRINTEARLRALRTSLLVLAGLSLLAIIPAGRMPDEVPALEEPQPTKGKK
>NZ_CP044284.1|WP_064073664.1|139387_140311_-|hypothetical-protein
MRAAHLAVLEARVAALDAGDTDTVAAAIRGYVPLNSGNPVVRHVQDLGSRIREEARHVVSGKPRSIAFRLGLSLGMGLAYLAFIRLFQWDAKEDRLPYLALYALSGVVGSVVCTNALSFDAGRVRAALSGGTRLWHVLVAKNAVMLLLVGSAGFLLSAVLAWRSGSSADLVKACGQVLTMILLWLGVANVMSVSLPLRAEPMTARRHDGTWKQFLLSFVISYGVGLIVNLMLYWRVWAKTTLLEQMGGPWIPVLLLLASAAATWLLLTVLAVLLAEQPRFRRALHREMVVYREETNHLQATIQHNSG
>NZ_CP044284.1|WP_054188691.1|140653_141241_+|DinB-family-protein
MTTNSEKEDLQRYLQAARDALVWKLDGLSEYDIRRPMTRTGTNLLGLVKHMIGVELGYFGPTFGRRVPDLPAWLRSEELNVDMWARADESTADIVETYRRTWAFADATIEEHDLDAPGFVKHWPEDRRDVTLHRILVHVVTEIHRHAGHADIVRELIDGAAGMKAGDNNLAPGDEAWWAEYNDRLETAAREAHRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2484865 : 2492427

Lactobacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_030534957.1\|2484865_2485432_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	4.3e-06	33.9
WP_030534956.1\|2485487_2486315_-	siderophore-interacting protein	NA	NA	NA	NA
WP_003944717.1\|2486606_2486837_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	1.1e-21	64.0
WP_003944767.1\|2486919_2487399_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	4.5e-09	30.1
WP_085989958.1\|2487380_2489540_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	1.5e-205	51.0
WP_003944723.1\|2489601_2489814_-	hypothetical protein	NA	NA	NA	NA
WP_085989609.1\|2489826_2490651_-	SPFH domain-containing protein	NA	NA	NA	NA
WP_003944744.1\|2490914_2491880_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	7.7e-157	86.8
WP_007736052.1\|2491953_2492427_-	NUDIX domain-containing protein	D0R7J3	Paenibacillus_phage	1.9e-12	31.2

DBSCAN-SWA_2

4131386 : 4168271

uncultured_Caudovirales_phage(25.0%)

integrase,terminase,protease,capsid,transposase

attL 4131282:4131304|attR 4140411:4140433

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4131282:4131304	attL	NA	NA	NA	NA
WP_151098078.1\|4131386_4132577_-\|integrase	site-specific integrase	A0A2H4JCB7	uncultured_Caudovirales_phage	8.6e-33	30.1
WP_151098079.1\|4132563_4133025_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_151098080.1\|4133074_4133293_+	DNA-binding protein	NA	NA	NA	NA
WP_151098081.1\|4133375_4133789_+	hypothetical protein	NA	NA	NA	NA
WP_151098551.1\|4133830_4134064_+	hypothetical protein	NA	NA	NA	NA
WP_070160516.1\|4134060_4135263_+	AAA family ATPase	NA	NA	NA	NA
WP_116056514.1\|4135733_4135994_+	hypothetical protein	NA	NA	NA	NA
WP_007733306.1\|4135993_4136182_+	hypothetical protein	NA	NA	NA	NA
WP_151098082.1\|4136174_4136630_+	hypothetical protein	NA	NA	NA	NA
WP_151098083.1\|4136933_4137815_+\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_151098552.1\|4137880_4138327_+\|terminase	P27 family phage terminase small subunit	NA	NA	NA	NA
WP_151098084.1\|4138323_4139823_+	hypothetical protein	I7KQY6	Yersinia_phage	2.7e-07	26.4
WP_141751392.1\|4139955_4140207_+	hypothetical protein	NA	NA	NA	NA
WP_007733298.1\|4140723_4141134_-	MerR family transcriptional regulator	NA	NA	NA	NA
4140411:4140433	attR	NA	NA	NA	NA
WP_030538129.1\|4141850_4143098_+\|transposase	IS256 family transposase	A0A220NQR7	Corynebacterium_phage	3.9e-76	44.4
WP_007733294.1\|4143708_4144917_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_030537911.1\|4145430_4146861_+	amidase	NA	NA	NA	NA
WP_007733292.1\|4147093_4147315_-	DUF3618 domain-containing protein	NA	NA	NA	NA
WP_007733290.1\|4147460_4147934_+	thioredoxin-dependent thiol peroxidase	NA	NA	NA	NA
WP_007733289.1\|4147930_4149280_-	dipeptidase	NA	NA	NA	NA
WP_003945379.1\|4149570_4150272_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003945362.1\|4150330_4150729_-	holo-ACP synthase	NA	NA	NA	NA
WP_030537910.1\|4150739_4160051_-	type I polyketide synthase	NA	NA	NA	NA
WP_030537909.1\|4160470_4161187_+	hypothetical protein	NA	NA	NA	NA
WP_030537908.1\|4161401_4162121_-	hydrogenase expression protein HupH	NA	NA	NA	NA
WP_020970031.1\|4162331_4162739_+	hypothetical protein	NA	NA	NA	NA
WP_003945334.1\|4162735_4163116_+	DUF3817 domain-containing protein	NA	NA	NA	NA
WP_003945370.1\|4163178_4163787_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	A0A0P0A2M4	Ugandan_cassava_brown_streak_virus	1.7e-08	29.5
WP_003945332.1\|4163790_4164576_-	ribonuclease PH	NA	NA	NA	NA
WP_019749149.1\|4164628_4165396_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_030537907.1\|4165484_4166144_-\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_030537906.1\|4166236_4167304_-	P1 family peptidase	NA	NA	NA	NA
WP_003945318.1\|4167300_4167891_-	DUF2017 domain-containing protein	NA	NA	NA	NA
WP_029255695.1\|4167959_4168271_-\|protease	ATP-dependent Clp protease adapter ClpS	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044283

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP044284

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection