CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP043405	Streptococcus ratti strain ATCC 31377 chromosome, complete genome	5 crisprs	csa3,cas3,DEDDh,WYL,DinG,csm6,csn2,cas2,cas1,cas9,cas6e,cas5,cas7,cse2gr11,cas8e	0	12	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP043405_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043405_1

1579978-1580883

Orphan

Consensus_repeat	Method
AATCNGAATCNCAAAGNG	CRT

17 spacers

The CRISPR arrays of NZ_CP043405_1

>merge|NZ_CP043405|1|1579978-1580883|CRT
AAAGTGAATCGCAATCCGAGTCCCAAAGTGAATCGCAATCTGAATCGCAATCTGAATCGCAATCAGAGTCTCAATCCGAATCAGAAAGTGAATCGCAATCTGAATCTCAATCCGAGTCACAAAGCGAATCCCAATCAGAATCCCAAAGTGAGTCACAAAGCGAGTCTCAATCTGAATCGCAAAGCGAGTCCCAATCTGAATCCCAATCGGAATCCCAAAGTGAATCTGAGTCAGAATCCCAATCTGAGTCACAATCTGAATCGCAAAGCGAGTCTCAATCTGAATCTCAAAGTGAATCGCAAAGTGAGTCCCAATCTGAATCCCAATCGGAATCCCAAAGCGAGTCACAAAGCGAGTCCCAATCTGAATCCCAATCGGAATCCCAAAGTGAATCGCAATCAGAATCCCAAAGTGAGTCTCAAAGTGAGTCTCAATCAGAGTCCCAAAGTGAGTCACAAAGCGAATCGCAAAGCGAGTCCCAATCCGAGTCTCAATCTGAATCTCAAAGTGAGTCTCAAAGTGAATCGCAATCCGAATCCCAAAGTGAGTCTCAAAGCGAGTCTCAATCAGAATCCCAAAGTGAATCGCAATCCGAGTCTCAATCCGAATCTCAAAGTGAATCGCAATCCGAATCCCAAAGTGAGTCTCAAAGCGAGTCTCAATCAGAATCCCAAAGTGAATCGCAATCCGAGTCTCAATCCGAATCTCAAAGTGAATCGCAATCTGAATCCCAAAGCGAATCGCAAAGTGAGTCCCAATCTGAATCCCAATCGGAATCCCAAAGCGAATCCCAATCTGAGTCACAATCTGAATCGCAAAGTGAATCCCAAAGCGAGTCACAATCTGAATCCCAAAGTGAGTCCCAATCAGAGTCCCAAAGCGAGTCTCAATCTGAATCCCAAAGTG

>NZ_CP043405|1|1|1579978-1580883|CRT
AAAGTGAATCGCAATCCG	AGTCCCAAAGTGAATCGC
AATCTGAATCGCAATCTG	AATCGCAATCAGAGTCTCAATCCGAATCAGAAAGTGAATCGC
AATCTGAATCTCAATCCG	AGTCACAAAGCGAATCCCAATCAGAATCCCAAAGTGAGTCACAAAGCGAGTCTC
AATCTGAATCGCAAAGCG	AGTCCCAATCTGAATCCCAATCGGAATCCCAAAGTGAATCTGAGTCAGAATCCCAATCTGAGTCAC
AATCTGAATCGCAAAGCG	AGTCTCAATCTGAATCTCAAAGTGAATCGCAAAGTGAGTCCCAATCTGAATCCC
AATCGGAATCCCAAAGCG	AGTCACAAAGCGAGTCCCAATCTGAATCCCAATCGGAATCCCAAAGTGAATCGC
AATCAGAATCCCAAAGTG	AGTCTCAAAGTGAGTCTC
AATCAGAGTCCCAAAGTG	AGTCACAAAGCGAATCGCAAAGCGAGTCCCAATCCGAGTCTC
AATCTGAATCTCAAAGTG	AGTCTCAAAGTGAATCGC
AATCCGAATCCCAAAGTG	AGTCTCAAAGCGAGTCTC
AATCAGAATCCCAAAGTG	AATCGCAATCCGAGTCTCAATCCGAATCTCAAAGTGAATCGC
AATCCGAATCCCAAAGTG	AGTCTCAAAGCGAGTCTC
AATCAGAATCCCAAAGTG	AATCGCAATCCGAGTCTCAATCCGAATCTCAAAGTGAATCGC
AATCTGAATCCCAAAGCG	AATCGCAAAGTGAGTCCC
AATCTGAATCCCAATCGG	AATCCCAAAGCGAATCCCAATCTGAGTCAC
AATCTGAATCGCAAAGTG	AATCCCAAAGCGAGTCAC
AATCTGAATCCCAAAGTG	AGTCCCAATCAGAGTCCCAAAGCGAGTCTC
AATCTGAATCCCAAAGTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043405.1\|WP_003087914.1\|1570800_1572354_+\|accessory-Sec-system-protein-Asp2	unknown	unknown	gnl\|CDD\|274739
NZ_CP043405.1\|WP_003087938.1\|1586655_1587804_+\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341459
NZ_CP043405.1\|WP_003087937.1\|1585960_1586542_+\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	unknown	unknown	gnl\|CDD\|376665
NZ_CP043405.1\|WP_003087939.1\|1587807_1588152_+\|BMC-domain-containing-protein	unknown	unknown	gnl\|CDD\|132886
NZ_CP043405.1\|WP_003087925.1\|1581269_1582454_+\|CapA-family-protein	unknown	unknown	gnl\|CDD\|214858
NZ_CP043405.1\|WP_003087930.1\|1583558_1583888_+\|ribosomal-processing-cysteine-protease-Prp	unknown	unknown	gnl\|CDD\|381747
NZ_CP043405.1\|WP_003087929.1\|1583235_1583550_+\|50S-ribosomal-protein-L21	unknown	unknown	gnl\|CDD\|235510
NZ_CP043405.1\|WP_003087913.1\|1569230_1570808_+\|accessory-Sec-system-protein-Asp1	unknown	unknown	gnl\|CDD\|274740
NZ_CP043405.1\|WP_003087919.1\|1575235_1576759_+\|accessory-Sec-system-glycosyltransferase-GtfA	unknown	unknown	gnl\|CDD\|131964
NZ_CP043405.1\|WP_081498721.1\|1572365_1572776_+\|accessory-Sec-system-protein-Asp3	unknown	unknown	gnl\|CDD\|379726
NZ_CP043405.1\|WP_003087918.1\|1572842_1575224_+\|accessory-Sec-system-translocase-SecA2	unknown	unknown	gnl\|CDD\|163426
NZ_CP043405.1\|WP_003087941.1\|1588178_1588745_+\|response-regulator	unknown	unknown	gnl\|CDD\|226230
NZ_CP043405.1\|WP_003087910.1\|1567024_1567975_+\|sugar-transferase	unknown	unknown	gnl\|CDD\|236626
NZ_CP043405.1\|WP_003087921.1\|1576739_1578065_+\|accessory-Sec-system-glycosylation-chaperone-GtfB	unknown	unknown	gnl\|CDD\|274351
NZ_CP043405.1\|WP_145961919.1\|1585526_1585961_+\|EutP/PduV-family-microcompartment-system-protein	unknown	unknown	gnl\|CDD\|371185
NZ_CP043405.1\|WP_003087907.1\|1565481_1566699_+\|tRNA-4-thiouridine(8)-synthase-ThiI	unknown	unknown	gnl\|CDD\|234960
NZ_CP043405.1\|WP_081498710.1\|1567979_1569206_+\|accessory-Sec-system-protein-translocase-subunit-SecY2	unknown	unknown	gnl\|CDD\|237095
NZ_CP043405.1\|WP_003087932.1\|1583909_1584203_+\|50S-ribosomal-protein-L27	unknown	unknown	gnl\|CDD\|235464
NZ_CP043405.1\|WP_003087934.1\|1585175_1585520_+\|BMC-domain-containing-protein	unknown	unknown	gnl\|CDD\|132886
NZ_CP043405.1\|WP_003087906.1\|1564089_1565232_+\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029

Protein	Function_ID	Function_description	E-value
NZ_CP043405.1\|WP_003087914.1\|1570800_1572354_+\|accessory-Sec-system-protein-Asp2	gnl\|CDD\|274739	TIGR03712, acc_sec_asp2, accessory Sec system protein Asp2. This protein is designated Asp2 because, along with SecY2, SecA2, and other proteins it is part of the accessory secretory protein system. The system is involved in the export of serine-rich glycoproteins important for virulence in a number of Gram-positive species, including Streptococcus gordonii and Staphylococcus aureus. This protein family is assigned to transport rather than glycosylation function, but the specific molecular role is unknown. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	3.1178e-162
NZ_CP043405.1\|WP_003087938.1\|1586655_1587804_+\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341459	cd08180, PDD, 1,3-propanediol dehydrogenase (PPD) catalyzes the reduction of 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol in glycerol metabolism. 1,3-propanediol dehydrogenase (PPD) plays a role in glycerol metabolism of some bacteria in anaerobic conditions. In this degradation pathway, glycerol is converted in a two-step process to 1,3-propanediol (1,3-PD) which is then excreted into the extracellular medium. The first reaction involves the transformation of glycerol into 3-hydroxypropionaldehyde (3-HPA) by a coenzyme B-12-dependent dehydratase. The second reaction involves the dismutation of the 3-hydroxypropionaldehyde (3-HPA) to 1,3-propanediol by the NADH-linked 1,3-propanediol dehydrogenase (PPD). The enzyme requires iron ion for its function. Because many genes in this pathway are present in the propanediol utilization (pdu) operon, they are also named pdu genes. PPD is a member of the iron-containing alcohol dehydrogenase superfamily. The PPD structure has a dehydroquinate synthase-like fold.	8.27998e-178
NZ_CP043405.1\|WP_003087937.1\|1585960_1586542_+\|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase	gnl\|CDD\|376665	pfam01923, Cob_adeno_trans, Cobalamin adenosyltransferase. Cobalamin adenosyltransferase This family contains the gene products of PduO and EutT which are both cobalamin adenosyltransferases. PduO is a protein with ATP:cob(I)alamin adenosyltransferase activity. The main role of this protein is the conversion of inactive cobalamins to AdoCbl for 1,2-propanediol degradation.The EutT enzyme appears to be an adenosyl transferase, converting CNB12 to AdoB12.	1.43397e-72
NZ_CP043405.1\|WP_003087939.1\|1587807_1588152_+\|BMC-domain-containing-protein	gnl\|CDD\|132886	cd07046, BMC_PduU-EutS, 1,2-propanediol utilization protein U (PduU)/ethanolamine utilization protein S (EutS), Bacterial Micro-Compartment (BMC) domain. PduU encapsulates several related enzymes within a shell composed of a few thousand protein subunits. PduU exists as a hexamer which might further assemble into the flat facets of the polyhedral outer shell of the pdu organelle. This proteinaceous noncarboxysome microcompartment is involved in coenzyme B12-dependent degradation of 1,2-propanediol. The core of PduU is related to the typical BMC domain and its natural oligomeric state is a cyclic hexamer. Unlike other typical BMC domain proteins, the 3D topology of PduU reveals a circular permuted variation on the typical BMC fold which leads to several unique features. The exact functions related to those unique features are still not clear. Another difference is the presence of a deep cavity on one side of the hexamer as well as an intermolecular six-stranded beta barrel that seems to block the central pore that is present in other BMC domain proteins. EutS proteins included in this CD are sequence homologs of PduU. They are encoded within eut operon and may be required for the formation of the outer shell of bacterial eut polyhedral organelles which are involved in the cobalamin-dependent degradation of ethanolamine. Although it has been suggested that EutS might also form hexamers and play similar functional roles in the construction of the eut organelle outer shell at present no experimental evidence directly supports this view.	1.07573e-47
NZ_CP043405.1\|WP_003087925.1\|1581269_1582454_+\|CapA-family-protein	gnl\|CDD\|214858	smart00854, PGA_cap, Bacterial capsule synthesis protein PGA_cap. This protein is a putative poly-gamma-glutamate capsule biosynthesis protein found in bacteria. Poly-gamma-glutamate is a natural polymer that may be involved in virulence and may help bacteria survive in high salt concentrations. It is a surface-associated protein.	1.45831e-95
NZ_CP043405.1\|WP_003087930.1\|1583558_1583888_+\|ribosomal-processing-cysteine-protease-Prp	gnl\|CDD\|381747	cd16332, Prp-like, ribosomal-processing cysteine protease Prp and similar proteins. This model represents a family of cysteine proteases that include members found to cleave the N-terminus extension of ribosomal subunit L27 in eubacteria. Proteins in this family are distinguished by a pair of invariant histidine and cysteine residues with conserved spacing that form the classic catalytic dyad of a cysteine protease. Dependence of Staphylococcus aureus on L27 cleavage by Prp makes the enzyme a target for antibiotic development.	4.15817e-35
NZ_CP043405.1\|WP_003087929.1\|1583235_1583550_+\|50S-ribosomal-protein-L21	gnl\|CDD\|235510	PRK05573, rplU, 50S ribosomal protein L21; Validated.	9.52768e-45
NZ_CP043405.1\|WP_003087913.1\|1569230_1570808_+\|accessory-Sec-system-protein-Asp1	gnl\|CDD\|274740	TIGR03713, acc_sec_asp1, accessory Sec system protein Asp1. This protein is designated Asp1 because, along with SecY2, SecA2, and other proteins it is part of the accessory secretory protein system. The system is involved in the export of serine-rich glycoproteins important for virulence in a number of Gram-positive species, including Streptococcus gordonii and Staphylococcus aureus. This protein family is assigned to transport rather than glycosylation function, but the specific molecular role is unknown. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.80464e-172
NZ_CP043405.1\|WP_003087919.1\|1575235_1576759_+\|accessory-Sec-system-glycosyltransferase-GtfA	gnl\|CDD\|131964	TIGR02918, lipopolysaccharide_biosynthesis_protein, accessory Sec system glycosylation protein GtfA. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. Members are associated with glycosylation of serine-rich glycoproteins exported by the accessory Sec system. [Protein fate, Protein modification and repair].	0
NZ_CP043405.1\|WP_081498721.1\|1572365_1572776_+\|accessory-Sec-system-protein-Asp3	gnl\|CDD\|379726	pfam15432, Sec-ASP3, Accessory Sec secretory system ASP3. Sec-ASP3 is family of bacterial proteins involved in the Sec secretory system. The family forms part of the accessory SecA2/SecY2 system specifically required to export GspB, a serine-rich repeat cell-wall glycoprotein adhesin encoded upstream in the same operon.	1.24809e-41
NZ_CP043405.1\|WP_003087918.1\|1572842_1575224_+\|accessory-Sec-system-translocase-SecA2	gnl\|CDD\|163426	TIGR03714, Protein_translocase_subunit_SecA_2, accessory Sec system translocase SecA2. Members of this protein family are homologous to SecA and part of the accessory Sec system. This system, including both five core proteins for export and a variable number of proteins for glycosylation, operates in certain Gram-positive pathogens for the maturation and delivery of serine-rich glycoproteins such as the cell surface glycoprotein GspB in Streptococcus gordonii. [Protein fate, Protein and peptide secretion and trafficking].	0
NZ_CP043405.1\|WP_003087941.1\|1588178_1588745_+\|response-regulator	gnl\|CDD\|226230	COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms].	6.9225e-54
NZ_CP043405.1\|WP_003087910.1\|1567024_1567975_+\|sugar-transferase	gnl\|CDD\|236626	PRK09814, PRK09814, sugar transferase.	2.0122e-102
NZ_CP043405.1\|WP_003087921.1\|1576739_1578065_+\|accessory-Sec-system-glycosylation-chaperone-GtfB	gnl\|CDD\|274351	TIGR02919, conserved_hypothetical_protein, accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair].	0
NZ_CP043405.1\|WP_145961919.1\|1585526_1585961_+\|EutP/PduV-family-microcompartment-system-protein	gnl\|CDD\|371185	pfam10662, PduV-EutP, Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways. PduV may be involved in the association of the bacterial microcompartments (BMCs) to filaments.	1.93511e-57
NZ_CP043405.1\|WP_003087907.1\|1565481_1566699_+\|tRNA-4-thiouridine(8)-synthase-ThiI	gnl\|CDD\|234960	PRK01565, PRK01565, thiamine biosynthesis protein ThiI; Provisional.	0
NZ_CP043405.1\|WP_081498710.1\|1567979_1569206_+\|accessory-Sec-system-protein-translocase-subunit-SecY2	gnl\|CDD\|237095	PRK12417, secY, preprotein translocase subunit SecY; Reviewed.	1.09367e-100
NZ_CP043405.1\|WP_003087932.1\|1583909_1584203_+\|50S-ribosomal-protein-L27	gnl\|CDD\|235464	PRK05435, rpmA, 50S ribosomal protein L27; Validated.	3.04053e-52
NZ_CP043405.1\|WP_003087934.1\|1585175_1585520_+\|BMC-domain-containing-protein	gnl\|CDD\|132886	cd07046, BMC_PduU-EutS, 1,2-propanediol utilization protein U (PduU)/ethanolamine utilization protein S (EutS), Bacterial Micro-Compartment (BMC) domain. PduU encapsulates several related enzymes within a shell composed of a few thousand protein subunits. PduU exists as a hexamer which might further assemble into the flat facets of the polyhedral outer shell of the pdu organelle. This proteinaceous noncarboxysome microcompartment is involved in coenzyme B12-dependent degradation of 1,2-propanediol. The core of PduU is related to the typical BMC domain and its natural oligomeric state is a cyclic hexamer. Unlike other typical BMC domain proteins, the 3D topology of PduU reveals a circular permuted variation on the typical BMC fold which leads to several unique features. The exact functions related to those unique features are still not clear. Another difference is the presence of a deep cavity on one side of the hexamer as well as an intermolecular six-stranded beta barrel that seems to block the central pore that is present in other BMC domain proteins. EutS proteins included in this CD are sequence homologs of PduU. They are encoded within eut operon and may be required for the formation of the outer shell of bacterial eut polyhedral organelles which are involved in the cobalamin-dependent degradation of ethanolamine. Although it has been suggested that EutS might also form hexamers and play similar functional roles in the construction of the eut organelle outer shell at present no experimental evidence directly supports this view.	5.04084e-50
NZ_CP043405.1\|WP_003087906.1\|1564089_1565232_+\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	7.03963e-171

>NZ_CP043405.1|WP_003087921.1|1576739_1578065_+|accessory-Sec-system-glycosylation-chaperone-GtfB
MINLFDNYTQSSWDLHYSLIVAGFENPTIALNDDGFLPSDVQSPYSHYLEFENLDSRALYFNEIPVPDYWEIKATNDFGEIFNLGKKKANIYFAAPSHNRFVRTVEWFDDSGRVRSIDRYNKFGFKFAETIVSREGKWLKTSYYNRFKKEIISENHQTGEFILSWKDRVQLFNSKKEFVIFYLKDAGFNLDRIFYNSLSTPFLVSYNLAEQGDDILFWQEKIKDSLPWNMKLLLHDQKRRTRILVQDHESYLQMQSLLGKAEQERVGFLGYMYPFKNTYTFSHQALILTNSDHIEHLEMLLGALPELHFHIGAVTDMSNKLKDFAKYQNVSLYPNIAMSKVYQLLQDCSIYLDINYGKEILSAIRAAFENNLLIYAFTSTVHNYTYINPKNCYQAEGAETMAQALKSAISSQEAFIDQLNQQKEAAFVESADSYQQKIGLI
>NZ_CP043405.1|WP_003087919.1|1575235_1576759_+|accessory-Sec-system-glycosyltransferase-GtfA
MTIYNVNIGIGWASSGVEYAQAYRATIFRKLNLDSKFIFTDMFPRENLSNLTRNIGFLDSEIIWLYSYFTDQKLGPSTYTLEQLKSTLTQPVLSEEAAADLVTLTLDNKQVIKAYLAKGSKEVVKFVEYLFNGNLSRRDFFIQKKLFTEYYMLSDKKVQLCQRVFYNKDGSFAYEEIIDDKNRIYRFPNQIFYSKEELQEHFIKSLQLQEDDVIILDRSTGIGQAVFRNHGKAKLGVVIHAEHYNQKATNQETILWNNFCDYQFTNSDRVDFFVTSTERQRDVLSEQFRKYTKRTPKVVAIPVGSLDELQLADDAGRKPFSVITASRLAGEKHIDLLVKAVIQAKKKLPQLQFDIYGSGGEESKLRNIISNQGAKDYIRLCGHQNLTYVYQKYEAYLSGSMSEGFGLTLLEAIGSGLPIIGFDVPYGNQTFIKDGKNGYLVNLADKENEELLVSLLSEKIVQLFTSNRLADARRESYEIAKSFLTSEVEGKWKQLIEELVSYDKSIR
>NZ_CP043405.1|WP_003087918.1|1572842_1575224_+|accessory-Sec-system-translocase-SecA2
MGNLKTFFSLDYFRLKKVRKILKKINSYAAEMATLSASALQAKTSEFRERIEQGQETLEDILPEAFAVVREADKRLLGLYPYDVQVMGAIVLHYGNIAEMRTGEGKTLTATMPLYLNALSGQSAMLITTNEYLAIRDATELKKVYEFLGLTIGVGVRNDEKKMTVTQKRQVYQSDIIYTTSSALGFDYLIDNLADSPNKKFLSPFNYVIIDEADAVLLDTAQTPLIISGAPRVQSNLYRAADNFITTLLADEDFHYDKEKKEVWLTQKGIDEAERFFSVKNLYHPDHFELVRHLTLALRAQKLYKLGKDYIIDNNKIKLVDQKNGRILEGTKLQSGQHQAIEAKEQLKITQELRAMASITYPNLFLMFKKISGMTGTGKPDEAEFIDVYNMEVIRIPTNKPVIRKDYPDLIYTTLPEKVAASIAQVKKIHKTGQPILLITGSVRMSELYSEILLLEAIPHNLLNAHSAVKEAQMIAEAGRLGSVTVATNMAGRGTDIKLSDEVKKLGGLAVIGIERMVSERMDLQARGRSGRQGDPGFSQFFVSLEDDLLVEYGSAWLLDYFKKYKDTVDESRPQPLKAGKFKRAVRNAQSASASNGRSARNMTLSFDESVKIQRNKVYSMRNQLLSEKEFIFDAQSVIEGAIEDFIASHPNMDSFVLERYIFDHISYSFAGIDSDFDLQDKKAVKQLLLDLAMGELQRKKELIHQQFDDFQRVAVLRAIDESWIEEVDYLQQLRIVVSGRSSAQRNPIYEYHREALLSYKDMKKEIQKMTLHYLMLSEVSYTPNGDLSVYFI
>NZ_CP043405.1|WP_081498721.1|1572365_1572776_+|accessory-Sec-system-protein-Asp3
MYWKRVSNRNYLYGSSIHINGRKIRFYNELMPPSLVIQEWNSLSSYQSNHLQPDLPLLKKGSLYQISSYIQLVPEKSLYVRIEFFDRFSQLIDFKIFKEMTGQFRYPESAYSYRIQLVNAGCQSIEFDHLLLQSCS
>NZ_CP043405.1|WP_003087914.1|1570800_1572354_+|accessory-Sec-system-protein-Asp2
MNKIKILQVGTSDWQSEIELPEHIDWVFLESKNIAQSLTALQERYQSQINFNRPKIFDALLLTDTKIGESIFQLESLVESYSIFYPKAPQIISSPLQRFLNRKLAQKMEMTDKKKVVYTLSKILFPEQYGRKIPIYDLEISPDFKGVLNYQGKTGLTVEGNYGLKFRQFATFRTNIPYDSRRIFDIWQEFSKDSSCDLKIQVKLIDNSLEANVLKEWQLETGTVKKPLQIDARQNGYLSISLWTKGFGKMTIGTLHYRWGRAGYGDFILGGRRLIDDNQSEVAYYFNPQDFTPPLVVHFSDWSLKEGFADYRDIEALGCPFLLISDLRLDGGAFFIGSQKLESSIISIIKQSIAFLNIKSDDLIFSGLSMGAFAALFYSAEIQPKALVLGKPLVNIGTVAEKEKIDRPNVFPSSLDFLLQTCQTLDALSVQKMDAYLWERFDQADLSGTQIMVAYMKNDDYDPSAFSDIISHAKHRNIKVAGRGWIGRHDDEASKVSTWFMTQLQAILRDDFGRKEE
>NZ_CP043405.1|WP_003087913.1|1569230_1570808_+|accessory-Sec-system-protein-Asp1
MFYFVPSWYNPSRTWYDTTKAWYDGKDSIQFDDTLSQMRMFQSSKEPLTALVLNYAPNLRYFLHKNDLLEIPYFSVFDDIQGIGAVKTKIIDFKDLTWPQEIEFIYTPFSIQAYLGKDLFAKVDFGEDGQVIWIDYYIDGFLQRKCVFDDRGFLSSIIYYTKEGAAYYQEYLDYDGQWQIREYLLPKDKHVQINPNVQERFKRDFYADIKDLIFERTFDFFSEQVKQEDTLVVASDKRHNDLILSMVTKQQLILSFFKNRYPIKTDSDGHLAETLPQADLVLSDSSALAEQLQSNGVRVQHLSPFDARLTLGESQHIQDLILYVLLDGFSQEMLSSVLPQFFQLLMENENVKILFVSYDNDKAYLNTVKDNIQTAFESFKEQESCFGDFFFEDVFEIADGSERDSSKRISLLSLYSEYEIIQVLNTVRLIIDLGDEPDLYTQIAGISAGIPQINKTANEFVEHKKNGCIIETSEDLKAALDYFLKGLKNWNESLVYSVQKISDYTSGKLVQKIKDSLMTDGKENE
>NZ_CP043405.1|WP_081498710.1|1567979_1569206_+|accessory-Sec-system-protein-translocase-subunit-SecY2
MLVIFLKKIVRRPLTRKLMVSAWLVLVVMIGRHIPIPNVSISDYLLKDNTFLGLSASVLGGDLSRVSLFSLGLGPWMYTLILLRVANLGRKKVSSPKTDTIKRNALMLIIAIIQSLSIIVNVDFHSSANQLLLVLETMLVLVAGAFVLSWLGNMNTYFGIGGPTVIVLVSMLNTQLNAILSSYTAIFSPSNRWLTVGIVLWSLAAIYIYMIFEHAEYRIPLKRVSINSSLITETYLPIKVNSAGGMQMMYAISFLLLPQYILLLLQYLYPHNNQLSKWQSYFSTSSLAGILIYMGIIFALTLIFSFVNIDLTKTVENFRKSGDYIPNIRPGKDTKEYLKRVIIVLSVFSGFIISAIVAFPLFVALGNTDLAKVAPLTGVLMMSSAMIWIIREEIRTIQLQKQYTSLFE
>NZ_CP043405.1|WP_003087910.1|1567024_1567975_+|sugar-transferase
MSQNMVTEIANSLGFKEIGIYNFCPDLSNKEAVFSRFDGMNAAVGSDDIVIIQSPTWNGTEYDLAYIRRLKIYSNIKLAVFIHDVIPLMFTNNFYLMDQTIEMYNLADLLIVPSQKMLDTLRGYGLTVEKVIIQHMWDHPTDLRLDSPKFERLINFAGSPDRFPFLYDWKYETNLRLFSDKRIDNPDLNIKSEGWRYSIDLLNSLSQNGGFGLVWPQGGDGNYYELNISYKLSTYLAAGIPVIVPKTLSNASIIEKNNLGFVVENLQEANDLVSIISEDHYRFLLNNVWEYRELLIRGDYTRKLLIDTVHSLLTTD
>NZ_CP043405.1|WP_003087907.1|1565481_1566699_+|tRNA-4-thiouridine(8)-synthase-ThiI
MQYSEIMVRYGELSTKGKNRMRFINQLKRNIKHVLSAYPDVKVTADRDRAHIYLNGTDYLAVAESLKQIFGIQAFSPSYKVEKSVPVLEKAVQDIMTDLYQDGLTFKISSKRSDHHFELDSRELNQVLGSAVFEALPQIQAQMKNPDVNLKVEIREEAAYLSYENIKGAGGLPVGTAGKGMLMLSGGIDSPVAGYLALKRGVDIEAVHFASPPYTSPGALKKAQDLTRKLTKFGGNIQFIEVPFTEIQEEIKAKAPEAYLMTLTRRFMMRITDRIREERGGLVIINGESLGQVASQTLESMQAINAVTTTPVIRPVVTMDKLEIIDIAEKIDTFNISIQPFEDCCTIFAPDRPKTNPKIKNVEQYEARLDVEGLVARAVAGIKVTEISPQMHETDEVEHLIENLL
>NZ_CP043405.1|WP_003087906.1|1564089_1565232_+|cysteine-desulfurase
MIYFDNSATTLPYPEAIKTYEEAAAKVFGNPSSLHRLGSQATRILQASRQQIAALLDKSEKEIFFTSGGTEGDNWVIKGVAFEKKHYGKHIIVSDIEHPAVKESAKWLQDQGFAVDFAPVDARGFVDVKALADLIRPETTLVSVMAVNNEIGSVQPIEAISELLSDKPTISFHVDAVQAVGKVARETYLTDRVDFATFSGHKFHSVRGVGFIYKKAGKRISPLLNGGGQEAGLRSTTENVAGIAATAKALRMVLDKEAAAQQKLQSIKETLAGSLSVYEDVTLFSGMDHFAPNILTFGIKGVRGEVLVHAFEKHDIYISTTSACSSKAGKPAGTLIAMGIPAKLAQTAVRISLDDDNDMSQAEQFLTTFKHIYQQTRKVR
>NZ_CP043405.1|WP_003087925.1|1581269_1582454_+|CapA-family-protein
MKKNRIEKGKLETLFLAICFTVLLIFVTIYHFMVKTDGNHDSNKVQTARVVANGDILYHDILYTSARKDDGSYDFNPYFEYAKNWIAKADLAIGDFEGTISPDYPLAGYPLFNAPAEAAQSMKDTGYDVVDLAHNHILDSQLSGALNTVKTFNDLGLDTIGIYKKDRAKESFLIKKVKGIKIAILGYAYGYNGMEANLTKKERAAHLSNLNQKKIKAELKEAEKKADVTIVMPQMGTEYALEPTDEQKTLYHKMIKWGADVIFGGHPHVVEPSEVIKKDGEKKFIIYSMGNFISNQSYENLQNYWTERGLLMDVTFEKKADKTKIKTVKAHPTMVWSWGKGEVGAEGYEYKDYRVLILEDFIKGGKYRNKLDNTMKEKVDTAYQEMNNLVNLKW
>NZ_CP043405.1|WP_003087929.1|1583235_1583550_+|50S-ribosomal-protein-L21
MSTYAIIKTGGKQVKVEAGQAIYVEKLDVEAGAEVTFDQVVLVGGDKTVVGTPVVEGATVVGTVEKQGKQKKVVTYKYKPKKGSHRKQGHRQPYTKVVIKAINA
>NZ_CP043405.1|WP_003087930.1|1583558_1583888_+|ribosomal-processing-cysteine-protease-Prp
MIKAIFIRNQSGSLVSAKLTGHAGSGEYGFDIVCASVSTLAINFVNALEALTVCTPDLQLDDIAGGYMEITVPQDSSGDVQLLFEAFLLGMTNLAENSSEFVQTRVIEN
>NZ_CP043405.1|WP_003087932.1|1583909_1584203_+|50S-ribosomal-protein-L27
MLKMNFANLQLFAHKKGGGSTSNGRDSESKRLGAKAADGQTVTGGSILYRQRGTHIHPGANVGRGGDDTLFAKVEGVVRFERKGRNKKQVSVYPIAK
>NZ_CP043405.1|WP_003087934.1|1585175_1585520_+|BMC-domain-containing-protein
MEQKTRKVFESVPGKQVTLAHIISNPDDKLFVKLGLGNKKANAMGILTITPSDVAVIAVDFAKKEANVNIGFVDRFSGSVCVIGDVSAVESSIAKVLTELQSLMSFSVCNITRS
>NZ_CP043405.1|WP_145961919.1|1585526_1585961_+|EutP/PduV-family-microcompartment-system-protein
MVRIMMLGPIGHGKTALIQGLTKEKLVYNKTQDVIYTDNFIDTPGEFVQHRRFNIALQVTSQDASLLLFVLNATAKEQVYSPNYAQSFNKPVIGVLTHIDMASEEELKRSRKQLELAGVEEIFEVSSVTGDGLAELREYLSEVN
>NZ_CP043405.1|WP_003087937.1|1585960_1586542_+|cob(I)yrinic-acid-a,c-diamide-adenosyltransferase
MQIYTRVGDKGFTKVIGGEKLAKDSTRVTAYGELDELNSFLGFAKSFLKDERLVDELLTVQKLIFDCGSDLADPAMRMQRITQHDIDWLESRIDEYSTVPDEVESFILPGGSPAGSALHVCRAITRRAERAIVTFQWTNDMFSEDLKFVNRLSDYFYALARAINKWDYQIDTLYDRGGKVFHREITKNDIFKN
>NZ_CP043405.1|WP_003087938.1|1586655_1587804_+|iron-containing-alcohol-dehydrogenase
MQKIYLVPKIIFGDDALDYLEDMTNEQIVMITDRFIASLPSFIKIKEGLAANNAVTVFKDVVPDPLIENIIEGIRAFGETIPTVIIAIGGGSAIDAAKGIIYFACKTSAQIDRNLLQFIAIPTTSGTGSEVTDFAVITDKDKGVKYPLVEQDILPDVALLDTDLVMELPSTVTADTGIDVLTHAIEAYVSTNASTFSDALAEKAIKLVFENLPEAYAAGKANKVAREKMHQASTIAGLAFTMASLGINHSLAHAIGGKFHLVHGRINGVLLKNVILYNAGLLDNQRLPATDRALKKYGEIAQMIGVNIKNPKFAVQQLIQNIQRLLTQLDMPQTFSELKIDESQYINERSAIVQAALNDRCTPTNPRKPNISELESLLKRTY
>NZ_CP043405.1|WP_003087939.1|1587807_1588152_+|BMC-domain-containing-protein
MAEKERIIQEYVPGKQMTIAHLIAHPDLEVYEKLGIVDFNDCAIGLATVTPCEAAIIAVDIATKSAEVEIGFLDRFSGSLAIVGSYSSVKFGLEAMRSVLKNDMGFDTVELSIS
>NZ_CP043405.1|WP_003087941.1|1588178_1588745_+|response-regulator
MKYKVVIADDETIMRLDISEMLNNAGYDVVAQAKDGIEAVKLCEDYRPDLVVMDVKMPLLDGLSAAKQIIGSKYSLSVLLLTAYSEQELVQTASEIGAQGYVVKPIDERSLIPAVELAIANGRKQQELGQQLEKLKGKFEDRKYIDRAKGVLMSKQQLTEDEAYKTLRTIAMEKRLTMSELSRILIGE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043405_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043405_2

1800571-1800737

Orphan

Consensus_repeat	Method
CGTCAGTCTCCTATTTTCTTCTCGCTTTCTTCACGCCCTTTGTATCTTAAATAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP043405_2

>merge|NZ_CP043405|2|1800571-1800737|CRISPRCasFinder
CGTCAGTCTCCTATTTTCTTCTCGCTTTCTTCACGCCCTTTGTATCTTAAATAATTGAACACGGGCTAAAAGCGTCGAGAAAAAGATAGCCTGCCTTATGCGCCAGCGCACAGCGTCAGGCTCCTATTTTCTTCTCGCTTTCTTCACGCCCTTTGTATCTTAAATAA

>NZ_CP043405|2|1|1800571-1800737|CRISPRCasFinder
CGTCAGTCTCCTATTTTCTTCTCGCTTTCTTCACGCCCTTTGTATCTTAAATAA	TTGAACACGGGCTAAAAGCGTCGAGAAAAAGATAGCCTGCCTTATGCGCCAGCGCACAG
CGTCAGGCTCCTATTTTCTTCTCGCTTTCTTCACGCCCTTTGTATCTTAAATAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043405.1\|WP_003088339.1\|1790696_1792430_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP043405.1\|WP_003088362.1\|1802609_1803854_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225301
NZ_CP043405.1\|WP_003088354.1\|1798443_1799523_-\|peptide-chain-release-factor-1	unknown	unknown	gnl\|CDD\|234801
NZ_CP043405.1\|WP_003088356.1\|1799583_1800159_-\|thymidine-kinase	unknown	unknown	gnl\|CDD\|235272
NZ_CP043405.1\|WP_003088370.1\|1806304_1807825_-\|ABC-transporter-permease/substrate-binding-protein	unknown	unknown	gnl\|CDD\|270328
NZ_CP043405.1\|WP_003088376.1\|1809248_1810097_-\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP043405.1\|WP_003088358.1\|1800749_1800935_+\|4-oxalocrotonate-tautomerase	unknown	unknown	gnl\|CDD\|179406
NZ_CP043405.1\|WP_003088338.1\|1788863_1790579_+\|phospho-sugar-mutase	unknown	unknown	gnl\|CDD\|100092
NZ_CP043405.1\|WP_003088364.1\|1804031_1805537_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223650
NZ_CP043405.1\|WP_003088342.1\|1792426_1794160_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP043405.1\|WP_003090674.1\|1797030_1797621_-\|threonylcarbamoyl-AMP-synthase	unknown	unknown	gnl\|CDD\|223088
NZ_CP043405.1\|WP_003088365.1\|1805551_1806211_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP043405.1\|WP_037611389.1\|1801985_1802588_+\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223508
NZ_CP043405.1\|WP_003088360.1\|1801024_1801960_+\|FAD:protein-FMN-transferase	unknown	unknown	gnl\|CDD\|224394
NZ_CP043405.1\|WP_003088348.1\|1795758_1797021_-\|serine-hydroxymethyltransferase	unknown	unknown	gnl\|CDD\|234571
NZ_CP043405.1\|WP_003088353.1\|1797613_1798444_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	unknown	unknown	gnl\|CDD\|236467
NZ_CP043405.1\|WP_003088372.1\|1807821_1808547_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224050
NZ_CP043405.1\|WP_003088346.1\|1794784_1795762_-\|nucleoid-associated-protein	unknown	unknown	gnl\|CDD\|377262
NZ_CP043405.1\|WP_003088344.1\|1794177_1794783_-\|lysozyme-family-protein	unknown	unknown	gnl\|CDD\|372680
NZ_CP043405.1\|WP_003088374.1\|1808543_1809002_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|275265

Protein	Function_ID	Function_description	E-value
NZ_CP043405.1\|WP_003088339.1\|1790696_1792430_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.06878e-164
NZ_CP043405.1\|WP_003088362.1\|1802609_1803854_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|225301	COG2461, COG2461, Uncharacterized conserved protein [Function unknown].	4.44363e-56
NZ_CP043405.1\|WP_003088354.1\|1798443_1799523_-\|peptide-chain-release-factor-1	gnl\|CDD\|234801	PRK00591, prfA, peptide chain release factor 1; Validated.	0
NZ_CP043405.1\|WP_003088356.1\|1799583_1800159_-\|thymidine-kinase	gnl\|CDD\|235272	PRK04296, PRK04296, thymidine kinase; Provisional.	2.06207e-108
NZ_CP043405.1\|WP_003088370.1\|1806304_1807825_-\|ABC-transporter-permease/substrate-binding-protein	gnl\|CDD\|270328	cd13610, PBP2_ChoS, Substrate-binding domain ChoS of an osmoregulated ABC-type transporter and related proteins; type 2 periplasmic-binding protein fold. Osmoprotectant binding lipoprotein ChoS of Lactococcus lactis is predicted to be involved in uptake of compatible solutes such as choline and glycine betaine, but the relative substrate preference is not known. To counteract the efflux of water, microorganisms accumulate the compatible solutes for a sustained adjustment to high osmolarity surroundings. ChoS belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.3131e-159
NZ_CP043405.1\|WP_003088376.1\|1809248_1810097_-\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	6.3108e-60
NZ_CP043405.1\|WP_003088358.1\|1800749_1800935_+\|4-oxalocrotonate-tautomerase	gnl\|CDD\|179406	PRK02289, PRK02289, 4-oxalocrotonate tautomerase; Provisional.	1.04724e-34
NZ_CP043405.1\|WP_003088338.1\|1788863_1790579_+\|phospho-sugar-mutase	gnl\|CDD\|100092	cd05799, PGM2, This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.	0
NZ_CP043405.1\|WP_003088364.1\|1804031_1805537_+\|ABC-transporter-permease	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	2.27793e-11
NZ_CP043405.1\|WP_003088342.1\|1792426_1794160_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.97246e-125
NZ_CP043405.1\|WP_003090674.1\|1797030_1797621_-\|threonylcarbamoyl-AMP-synthase	gnl\|CDD\|223088	COG0009, SUA5, Putative translation factor (SUA5) [Translation, ribosomal structure and biogenesis].	1.83887e-59
NZ_CP043405.1\|WP_003088365.1\|1805551_1806211_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	8.53357e-79
NZ_CP043405.1\|WP_037611389.1\|1801985_1802588_+\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|223508	COG0431, COG0431, Predicted flavoprotein [General function prediction only].	1.24172e-45
NZ_CP043405.1\|WP_003088360.1\|1801024_1801960_+\|FAD:protein-FMN-transferase	gnl\|CDD\|224394	COG1477, ApbE, Membrane-associated lipoprotein involved in thiamine biosynthesis [Coenzyme metabolism].	1.1235e-101
NZ_CP043405.1\|WP_003088348.1\|1795758_1797021_-\|serine-hydroxymethyltransferase	gnl\|CDD\|234571	PRK00011, glyA, serine hydroxymethyltransferase; Reviewed.	0
NZ_CP043405.1\|WP_003088353.1\|1797613_1798444_-\|peptide-chain-release-factor-N(5)-glutamine-methyltransferase	gnl\|CDD\|236467	PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional.	1.83784e-101
NZ_CP043405.1\|WP_003088372.1\|1807821_1808547_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224050	COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism].	8.22503e-137
NZ_CP043405.1\|WP_003088346.1\|1794784_1795762_-\|nucleoid-associated-protein	gnl\|CDD\|377262	pfam04245, NA37, 37-kD nucleoid-associated bacterial protein.	9.48566e-28
NZ_CP043405.1\|WP_003088344.1\|1794177_1794783_-\|lysozyme-family-protein	gnl\|CDD\|372680	pfam13702, Lysozyme_like, Lysozyme-like.	2.70566e-74
NZ_CP043405.1\|WP_003088374.1\|1808543_1809002_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|275265	TIGR04472, reg_rSAM_mob, mobile rSAM pair MarR family regulator. A number of human microbiome species from both the Firmicutes and the spirochete genus Treponema share a gene cassette encoding a pair of radical SAM enzymes and, in most cases, this MarR family transcriptional regulator as well. Sequence identity can exceed 96 percent, suggesting recent lateral transfer. These observations suggest the cassette confers resistance to a toxic compound such as an antibiotic.	6.46186e-32

>NZ_CP043405.1|WP_003088356.1|1799583_1800159_-|thymidine-kinase
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSSLDTRDEFGVISSRIGMRRKAIPITDDMDIFAYINSFKDKPYCVLIDECQFLSKKNVYDLARIVDELGVPVMAFGLKNDFQNHLFEGSRELLLMADKIEEIKTICQFCSKKATMVLRTQDGKPVYEGEQIQIGGNETYIPVCRKHYFHPLIKD
>NZ_CP043405.1|WP_003088354.1|1798443_1799523_-|peptide-chain-release-factor-1
MNIYDQLQTVEDRYEELGELLSDPDVVSDTKRFMELSREEASTREMVTAYREYKQIIQNIADAEEMIKEAGGDPELEEMAKEELKESKAAKEDYEEKLKILLLPKDPNDDKNIILEIRGAAGGDEAALFAGDLLNMYQKYAESQGWKFEIMEASMNGVGGIKEVVAMVSGQSVYSKLKYESGAHRVQRVPVTESQGRVHTSTATVLVMPEVEEVEYEIDPKDLRVDIYHASGAGGQNVNKVATAVRIIHLPTNIKVEMQEERTQQKNRDKAMKIIRARVADHFAQIAQDEQDAERKSTVGTGDRSERIRTYNFPQNRVTDHRIGLTLQKLDTILAGKLDEVIDALVLYDQTQKLEKLGK
>NZ_CP043405.1|WP_003088353.1|1797613_1798444_-|peptide-chain-release-factor-N(5)-glutamine-methyltransferase
MNYAQAFAQYEAVLAANGVEKAALTYVFNDWKDWSRLDFILHQSHEIPEADLRQLDRITKLLKQHIPAQYITKKAYFADLTLTVDERVLIPRPETEELVNLILEENPDESLTVLDIGTGSGAIAIALAKTRKNWQISASDISKKALLLAQDNARANQTAVNFLHSDVFSQISDKYDIIVSNPPYIAFEDRNEVGQNVLLHEPHLALFADNEGLSVYQKIAEGAAEHLTAGGRIYLEIGYKQGASVSEIFRNYFSDKRIRLLQDSFGKDRMVVIDDG
>NZ_CP043405.1|WP_003090674.1|1797030_1797621_-|threonylcarbamoyl-AMP-synthase
MDKIEEALLAGQAVILPTETVYGLFARAMDARAVSNVYALKKRPPEKAMNLNVSSLEEILAFSKEPPAYLEALYKAFLPGPLTIILKANERVPVWVNSGLPTVGFRVPRHPLTLAYIKKTGPLIGPSANLSGQASGLVYEEIQSAFSHQLLGVQDDKAIKGKDSTILDISGPKAKILRQGTIAQAAIQARVKDIKF
>NZ_CP043405.1|WP_003088348.1|1795758_1797021_-|serine-hydroxymethyltransferase
MIFDKDNYETYDAEVWEAIHAEEKRQQNNIELIASENVVSQAVMKAQGSILTNKYAEGYPGRRYYGGTECVDMVESLAIERAKKLFGAKFANVQPHSGSQANAAAYMALIVPGDTVMGLDLAAGGHLTHGSPVSFSGQTYNFVAYNVDPETELLDYDQILEQAKEVQPKLIVAGASAYSRVIDFAKFRNIADQVGAKLMVDMAHIAGLVAAGLHPSPLPYAHITTSTTHKTLRGPRGGLVLTNDEDLAKKINSAIFPGLQGGPLEHIVAAKAITFKENMDPAFKVYAQNILDNCQAMVEVFNAHEKFRVVSGASENHLFLVDVTQVVENGKVAQNILDDVHITLNKNSIPFEKLSPFKTSGIRIGTAAVTARGFGPEECRKVAELIVKTLENTDNEAVLEEVRQEVKVLTDAFPLYENLV
>NZ_CP043405.1|WP_003088346.1|1794784_1795762_-|nucleoid-associated-protein
MMDLYLKKAVIHQFTPDDTELIFSDKLLTITPKLDEYFRKKVSRVFSDEAKRGKFDEDNVFLSYLSKDFLESSKKVAQLWKEEFVISDNQKTNDLIFIQFDKEGIEHFAFLRIALKESLAHITDGSDSPIRLTQNNLPSAAQTPDEALIINRQNRQYYLIEKRIKHNGSFANYFSENLLQVQPEQSVKKSIKLMEKTAQKVADNFNQDDFAFQSKMKSAIYKNLEEDQELSPEKLADQLFDANLTARLTFVDELKETISEPIKVADIDHTRQIKKLESQKLSLSNGIELLVPNNVYQDAESVEFIQNQDGTYSILIKNIEDIQSK
>NZ_CP043405.1|WP_003088344.1|1794177_1794783_-|lysozyme-family-protein
MKKKLVKVILLGLLLFIGYQVFTTYQNVKNVLAYRPMVREILDENDTRTNENLVLAMIYTETKGQEDDLMQSSESSSGIANTITDSRESVRQGVMVLSENLEEAKKKKTDAWTAVQAYNFGKNYIAYISKNGGKSTIKLAKHYSKTVVAPSLGNKSGQTYRYYNLVALFYGGGELYKDGGNIYYAKQVKLNLALIRFVSAF
>NZ_CP043405.1|WP_003088342.1|1792426_1794160_-|ABC-transporter-ATP-binding-protein
MKHLFIYFKGYLKETILGPLFKLLEASLELLVPLVIARMVDSYIPHNDKNHLYLMIFFLVLLAFSNIIVAIIAQFYSAKAAVGYTKQLSRSLFEKIMRLPKKSRDELTTSSLVTRLVSDTFQIQTGINQFLRLFLRAPIIVFGSVLMAFLINPRITIWFFLMVFVLFALVYLMSIVVNPLYDRIRHLTDKIVGLTREQLEGSRVIRAFGQIQAEEQQFQQTNRAYTDWQIKTGYIAALITPLTYLAVNVTLIIVIWQGHIAIWSNDLSQGMLIALVNYLLQILVELLKLTMLVSSLNQSFISAQRIAQVFEQEDEDIRAFLPVDSASDDILVKVNEMSFSYPQAAKAALKDISFTIHKQEFFGIIGGTGSGKSSLIQLLLRLYLPQQGQVTVFNSGSSARTIKEWRDWISLVPQRAELFKGTVRSNLTLGLDKKPTDEELWKALDMAQASDFVRQKTGQLDAQVEAFGRNFSGGQRQRLTIARALLRDRPLLILDDATSALDYLTEARLLSAIEKNLRKTSLIMVSQRTNSLAKADRILVLDQGKQVALASHKKLLEICPLYQEIHYSQHAKEEGIQ
>NZ_CP043405.1|WP_003088339.1|1790696_1792430_-|ABC-transporter-ATP-binding-protein
MKARNNRDTLKRLTADMLQQKLLVGGALLGTFIQVGLTVYLPVLIGRAVDAVVAKNVHELLPIILGKMILVVAFNTLIQWFNPLIYNRLVFAYSQKLRQELIEKLYRLPLSYLDSHSAGDLVSRMTTDVEQLSNGLLMVFNQFFVGILTILFTILTMAELDLLMMVLVLALTPLSLFVARFIAQKSYRLYQSQARARGSFTQHIEESLRQESLIQTFNAQEQFIDTFDHLNNTYARYSQGAIFYSSTVNPATRFINALIYALLAGIGALRIISGSFTVGQLTTFLNYVTQYTKPFNDISSVLSELQSALACAERLYMILDEEEARDEGRQELESRSVKGAITFDNISFGYSSRQTLIKNLSLTIPQGSKVAIVGPTGAGKSTLINLLMRFYELQSGQILLDGVPITAYSKASYRQQIGMVLQETWLKTATVLENIAFGWPQASREQVIAAAKAANADFFIKQLPQGYDTYLADAGESLSQGQRQLLTIARIFVHIPKILILDEATSSIDTRTEILIQEAFEKLMKNRTSFIIAHRLSTIQSADLILVMVDGNIVEQGNHKDLMQKKGVYYQMQTAQN
>NZ_CP043405.1|WP_003088338.1|1788863_1790579_+|phospho-sugar-mutase
MTYQETYQKWLDYTELPAYLREELSVMDEKTKEDAFYTNLEFGTAGMRGYIGAGTNRINIYVVRQATEGLAKLIETKGEDVKKRGVAIAYDSRHFSPEFAFESAQVLAKHGIKAYVFESLRPTPELSFAVRHLGTFAGIMVTASHNPAPFNGYKVYGEDGGQMPPADADALTDFIRAIEEPFAIELADLEESKASGLIEVIGEAVDAEYLKEVKDVNINQKLIDEYGKDMKIVYTPLHGTGEMLARRALAQAGFDSVQVVEAQAVPDPDFSTVKSPNPENQEAFALAEELGRKVDADVLVATDPDADRLGVEIRQPDGSYKNLSGNQIGAIIAKYILEAHKTAGTLPANAALCKSIVSTELVTKIAESYGATMFNVLTGFKFIAEKIQEFEEKHNHTYMLGFEESFGYLIKPFVRDKDAIQAVLIVAEIAAYYRSRGLTLADGIDEIYKEYGYFAEKTISVTLSGVDGAAEIKKIMDKFRDNGPKQFNSTDIAKTEDFQAQTATTAAGVEKLTTPPSNVLKYTLADDSWIAVRPSGTEPKIKFYIATVGSSLADAENKIAAIEKEINDFVG
>NZ_CP043405.1|WP_003088358.1|1800749_1800935_+|4-oxalocrotonate-tautomerase
MPFVKIDLFEGRTKEQKIELAREVTEVVSRVAKAPKEAIHVFINDMPEGTYYPHGEMKKKG
>NZ_CP043405.1|WP_003088360.1|1801024_1801960_+|FAD:protein-FMN-transferase
MQAQQTLHLMGTTIDIAVEASYAKELTESACQLLNIYEHRFSANSDDSELMAVNHQAGRRAVAVHPDLFELIQIGKEHSIANPSNLNIAIGPLVQTWRIGFEDAQLPNQAQIDDKLKLIDPHNIILNAQKQTVFLSQKGMKIDLGALAKGYIADKIIAYLKKQGATSAMINLGGNLLAFGPNPKRPGGFWNIGIQDPKRPRNQNVGIVKIYNQSVVTSGIYERHLQINGKDYHHIFDKNTGYPIETQMASLSIISNLSLDGEIWTTRLFGLPIPLAMKTINQMEHIEGIIITRDNRLAVSDGLKNTFIPLY
>NZ_CP043405.1|WP_037611389.1|1801985_1802588_+|NAD(P)H-dependent-oxidoreductase
MKLIGLVGTNSKKSTNRQLLQYMQKHFADKADIELVEIKDLPMFNKPADKKLPEQVTEIAAKIEAADGVIIGTPEYDHSVPAALMSALAWLSYGIYPLLNKPVMITGASYGTLGSSRAQLQLRQILNAPEIKANVLPDEFLLSHSLQAFDNEGNLADLETCQKLDAIFDDFRIFVKITEKLSSAQELLHKEAENFDWESL
>NZ_CP043405.1|WP_003088362.1|1802609_1803854_+|NAD(P)H-dependent-oxidoreductase
MKFVGLVGSNAEQSYNRKLLEYIRKQFKLKFELEVLEIDDVPMFNQDQDWKESFQLRLLYNKITRADGVIIATPEHNHTITAALKSVLEWLSCEVHPFENKPVMIVGASYYDQGTSRAQVHLRKILDAPGVNAYTLPGNEFLLGKAKEAFDDDGNIINKGTVEFLGTCLDNFVSYVGVVSKLQKPKPIEPEDLDCNHPIATSVREVDPDDPEWVEKVAEVTGAVSGDTYVKLDHGILTVDQINMFLKAMPFELTYSDDNNQFLYYNNAHQDPDTMFAKRVPSQSGSRLSTVHNSLPPERMKNVEWVIGTLRNGNQEYVRTLIPNPNPAVLNTHNYQAMYYDDGSFAGINEIVFNFKPWLDWYLQTTGQRLVGGVGSDTTSGASDSSADATSGASDSASGHSAGAADATSGASEH
>NZ_CP043405.1|WP_003088364.1|1804031_1805537_+|ABC-transporter-permease
MNFIKRAWLLTKAKKGRTALLTLVISSILIFVLAGLTIKSAADKAVENAKKETGATVNLQINRDYIMKKAQQASSSNTSSNQPPKFEMTPISLSVAQTIAKMTGVKSYLYTTTTTATAGNITPISTQSNSSDSSSSDNAFGRGESNGQNNKMTSGDFTITGVNRTDSVSEFSSSTNKIIKGKGITSQTSNNEAVIESDLAKANNLSVGDNFTVKVTNDSGSEKTYTLKVIGIYKSKTSVTSSQLQNNASNPSNNLYVNLQTANTMKGQTNTVDAATYTLSDPASVKSFVKKAKSKIDTDKFTVESNDKLYQQMLTPLNNVSSFSKNIVILVAVAGAVILTLIIILSIRERRYEIGVLMSLGENRLKIIGQFFTELFLVTLVSLALAAIAGNFVGNAVGNQLLSQQTSSSQQNRQMGAGGPERDSSSTDSKKTGQNQAPFAGGPGAAMNRTTINQINKLNVKQTPQSIAKLGLIALLITFISTILASIGLIRMKPKDILSSN
>NZ_CP043405.1|WP_003088365.1|1805551_1806211_+|ABC-transporter-ATP-binding-protein
MTLKTNNLSYWYSNNPDDYLFRKVNLEFEKGKVYAILGQSGSGKTTFLSLLAGLDSPKEGEILLDNQNINQSGLNDYRRNAVSTIFQSYNLLPYMTARQNVETALDISGIKLSDDEVTNLFNSVGISETLIDKPVLQLSGGQQQRVAIVRALAVKHDIIIADEPTGNLDEETTKDIVAIFKNIAHEQNKIVIIVTHEREVATSSDIIFELARKQFTLKQ
>NZ_CP043405.1|WP_003088370.1|1806304_1807825_-|ABC-transporter-permease/substrate-binding-protein
MTDLITTFQDRFGDWTQSLLEHLQISLLSLLLAIILALPLAIVISHRKRLSEIILQISGIFQTIPSLALLGLFIPFMGIGTVPAVAALVIYALFPILQNTITGLTTIDPSLVEAGQAFGMTKWERLKKFELPLAMPVMISGVRTAAVMIIGTATLAALIGAGGLGSFILLGIDRNNSSLILIGAISSALLAIVFNLAIKFLEKASLKKIMFAFLAMLAGLGVSYLPNIIKASQNQEEIVIAGKMGPEPEILINMYKELIERDSSLSVKVKPNFGKTTFLYEALKKGDIDIYPEFTGTVTASLLKNPPKASNNPQKVYKEARDGILKQDELVYLKPMKYQNTYAVAAKKSFAKENGLKTISDLKKVENTAKAGFTLEFNDREDGNKGLKSLYGLNLQVSTMEPALRYQAIKSGDIDITDAYSTDSEIKEYDLVTLKDDKALFPPYQGAPLLKKKLLQKHPELKRILNRLAGKISESQMSDMNYQVKVKGKSAKTVAHNYLKKAGLLK
>NZ_CP043405.1|WP_003088372.1|1807821_1808547_-|ABC-transporter-ATP-binding-protein
MIRFKNVSKSYGQEKVLDALDFEVAKGEFFVLIGPSGSGKTTTLKMINRLIEPSQGKIFLNQQAITDLSLRELRLSTGYVLQQIALFPNLTVRENIELIPEMKGWSKAKRLKKTKDLLGKVGLDADKYLERYPRDLSGGEQQRVGILRAIIADPSILLMDEPFSALDPISRKQLQDLTLSLQKELGITVVFVTHDIDEAKKLADRVAVFQKGKIVQLASPKEVEESPANAFVADLFGGDRQ
>NZ_CP043405.1|WP_003088374.1|1808543_1809002_-|MarR-family-transcriptional-regulator
MTKLARGGYLISHINLLNGRLFNKLLAEEEGAVYSGEQGKILSCLWIAEPLTATDIAIKTGLANNTLTKMLQRLETQGLIVSSSHPKDKRKRCYYLTELGKSQEAVGEKVSQALGEIFYKDFSQKEIQQFEKMLTKVMQNLEAASPRWKEKL
>NZ_CP043405.1|WP_003088376.1|1809248_1810097_-|Cof-type-HAD-IIB-family-hydrolase
MSKKIIFLDVDGTLVDYNNRIPQSAIRAIRKARQNGHLVFVSTGRSRAEMQPELWDIGLDGMIGGNGSYVEHDGQVIMHQLISPEDAKAAVDWLYERGLEFYLESNNGLFASEHFRERARETLKIYAMCKGKTSAEVEDQEVDDVMHGLVYGANLYRDDLNKISFVLDSYQDYLDAQKAFPDLKVGTWGGRGEAALFGDLGVKNITKAHAIDALLQHLKADRKDTIAFGDAKVDIPMLEYCEIGVSMGNGGPEILAMADMVTDDVEEDGLFNAFEKLGLLAH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043405_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043405_3

1976419-1977182

TypeII

II-A,II-B

Consensus_repeat	Method
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CRISPRCasFinder
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CRT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	PILER-CR

11 spacers

csn2,cas2,cas1,cas9

The CRISPR arrays of NZ_CP043405_3

>merge|NZ_CP043405|3|1976419-1977182|CRISPRCasFinder,CRT,PILER-CR
ATTTTGGAACCATTCGAAACAACACAGCTCTAAAACTATCCCCACGGGTAAGATCATCAGGTTGTAGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACCAGCCTTTGGCACAATTGCAACAGCTATTGTGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACGCGCCAAAAGCCGATAAGCCAGTAATTGAAGGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACCAGCCTTTGGCACAATTGCAACAGCTATTGTGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACAAAGACATTCAAACTGCTATCCGCTTGTTAGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACGGCAAGCCTTGAAAACTATCTTTTGTATCAGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACCCAGTAGCTATCCTTGATGATATAGTGCACGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACACATAGTTGCCTGTTAGGTCAAAAGCAATAGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACCCAAAAACGTCGATAAATGTATCAAAATCAGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACATCTTTTTAAAACTATTTTCAATGCCAGGGGTTTTGGAACCATTCGAAACAACACAGCTCTAAAACCGCATAGATAGCAGCGTTAGCGTTTTGATGTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC

>NZ_CP043405|3|2|1976419-1977182|CRISPRCasFinder
ATTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	TATCCCCACGGGTAAGATCATCAGGTTGTA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CAGCCTTTGGCACAATTGCAACAGCTATTGT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	GCGCCAAAAGCCGATAAGCCAGTAATTGAAG
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CAGCCTTTGGCACAATTGCAACAGCTATTGT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	AAAGACATTCAAACTGCTATCCGCTTGTTA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	GGCAAGCCTTGAAAACTATCTTTTGTATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAGTAGCTATCCTTGATGATATAGTGCAC
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ACATAGTTGCCTGTTAGGTCAAAAGCAATA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAAAAACGTCGATAAATGTATCAAAATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ATCTTTTTAAAACTATTTTCAATGCCAGGG
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CGCATAGATAGCAGCGTTAGCGTTTTGAT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC

>NZ_CP043405|3|2|1976419-1977182|CRT
ATTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	TATCCCCACGGGTAAGATCATCAGGTTGTA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CAGCCTTTGGCACAATTGCAACAGCTATTGT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	GCGCCAAAAGCCGATAAGCCAGTAATTGAAG
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CAGCCTTTGGCACAATTGCAACAGCTATTGT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	AAAGACATTCAAACTGCTATCCGCTTGTTA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	GGCAAGCCTTGAAAACTATCTTTTGTATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAGTAGCTATCCTTGATGATATAGTGCAC
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ACATAGTTGCCTGTTAGGTCAAAAGCAATA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAAAAACGTCGATAAATGTATCAAAATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ATCTTTTTAAAACTATTTTCAATGCCAGGG
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CGCATAGATAGCAGCGTTAGCGTTTTGAT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC

>NZ_CP043405|3|1|1976619-1977182|PILER-CR
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CAGCCTTTGGCACAATTGCAACAGCTATTGT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	AAAGACATTCAAACTGCTATCCGCTTGTTA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	GGCAAGCCTTGAAAACTATCTTTTGTATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAGTAGCTATCCTTGATGATATAGTGCAC
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ACATAGTTGCCTGTTAGGTCAAAAGCAATA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CCAAAAACGTCGATAAATGTATCAAAATCA
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	ATCTTTTTAAAACTATTTTCAATGCCAGGG
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC	CGCATAGATAGCAGCGTTAGCGTTTTGAT
GTTTTGGAACCATTCGAAACAACACAGCTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043405.1\|WP_003088674.1\|1972753_1974541_-\|LPXTG-cell-wall-anchor-domain-containing-protein	unknown	unknown	gnl\|CDD\|369832
NZ_CP043405.1\|WP_003088666.1\|1968646_1969315_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043405.1\|WP_003088672.1\|1970563_1972402_-\|elongation-factor-4	unknown	unknown	gnl\|CDD\|235462
NZ_CP043405.1\|WP_003088678.1\|1975293_1976187_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|119397
NZ_CP043405.1\|WP_150880971.1\|1984317_1985610_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376564
NZ_CP043405.1\|WP_003088691.1\|1979015_1979885_-\|type-II-CRISPR-associated-endonuclease-Cas1	cas1	cd09720_cas1_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|187851
NZ_CP043405.1\|WP_003088668.1\|1969368_1969980_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP043405.1\|WP_003090819.1\|1967349_1968522_-\|DUF2974-domain-containing-protein	unknown	unknown	gnl\|CDD\|371412
NZ_CP043405.1\|WP_003088670.1\|1970061_1970538_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP043405.1\|WP_003088659.1\|1965645_1966038_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133384
NZ_CP043405.1\|WP_003088683.1\|1977717_1977924_-\|type-II-toxin-antitoxin-system-HicA-family-toxin	unknown	unknown	gnl\|CDD\|377942
NZ_CP043405.1\|WP_003088660.1\|1966079_1967123_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|176247
NZ_CP043405.1\|WP_003088699.1\|1985953_1986511_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|377026
NZ_CP043405.1\|WP_003088676.1\|1974705_1974969_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197775
NZ_CP043405.1\|WP_003088686.1\|1978022_1978685_-\|type-II-A-CRISPR-associated-protein-Csn2	csn2	cd09758_csn2_CAS-II-A	gnl\|CDD\|213408
NZ_CP043405.1\|WP_003088704.1\|1989510_1990149_-\|TIGR01906-family-membrane-protein	unknown	unknown	gnl\|CDD\|226884
NZ_CP043405.1\|WP_126417973.1\|1978674_1979004_-\|CRISPR-associated-endonuclease-Cas2	cas2	COG3512_cas2_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226043
NZ_CP043405.1\|WP_003088701.1\|1986634_1989166_-\|ABC-transporter-ATP-binding-protein/permease	unknown	unknown	gnl\|CDD\|213222
NZ_CP043405.1\|WP_003088697.1\|1979884_1983997_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	cas9	COG3513_cas9_CAS-II-A:CAS-II-B:CAS-II-C	gnl\|CDD\|226044
NZ_CP043405.1\|WP_003088681.1\|1977337_1977715_-\|antitoxin-HicB	unknown	unknown	gnl\|CDD\|374224

Protein	Function_ID	Function_description	E-value
NZ_CP043405.1\|WP_003088674.1\|1972753_1974541_-\|LPXTG-cell-wall-anchor-domain-containing-protein	gnl\|CDD\|369832	pfam08363, GbpC, Glucan-binding protein C. This domain is found in the Streptococcus Glucan-binding protein C (GbpC) and also in surface protein antigen (Spa)-family proteins which show sequence similarity to GbpC.	1.48192e-84
NZ_CP043405.1\|WP_003088672.1\|1970563_1972402_-\|elongation-factor-4	gnl\|CDD\|235462	PRK05433, PRK05433, GTP-binding protein LepA; Provisional.	0
NZ_CP043405.1\|WP_003088678.1\|1975293_1976187_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	1.0936e-22
NZ_CP043405.1\|WP_150880971.1\|1984317_1985610_-\|IS110-family-transposase	gnl\|CDD\|376564	pfam01548, DEDD_Tnp_IS110, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes an amino-terminal region of the pilin gene inverting protein (PIVML) and of members of the IS111A/IS1328/IS1533 family of transposases. The C-terminus is represented by family pfam02371.	2.35873e-33
NZ_CP043405.1\|WP_003088691.1\|1979015_1979885_-\|type-II-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|187851	cd09720, Cas1_II, CRISPR/Cas system-associated protein Cas1. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas1 is the most universal CRISPR system protein thought to be involved in spacer intergration. Cas1 is metal-dependent deoxyribonuclease, also binds RNA; Shown to possess a unique fold consisting of a N-terminal beta-strand domain and a C-terminal alpha-helical domain.	6.32563e-128
NZ_CP043405.1\|WP_003088699.1\|1985953_1986511_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|377026	pfam03358, FMN_red, NADPH-dependent FMN reductase.	2.47877e-23
NZ_CP043405.1\|WP_003090819.1\|1967349_1968522_-\|DUF2974-domain-containing-protein	gnl\|CDD\|371412	pfam11187, DUF2974, Protein of unknown function (DUF2974). This bacterial family of proteins has no known function.	5.96308e-77
NZ_CP043405.1\|WP_003088670.1\|1970061_1970538_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.95173e-17
NZ_CP043405.1\|WP_003088659.1\|1965645_1966038_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133384	cd01109, HTH_YyaN, Helix-Turn-Helix DNA binding domain of the MerR-like transcription regulators YyaN and YraB. Putative helix-turn-helix (HTH) MerR-like transcription regulators of Bacillus subtilis, YyaN and YraB, and related proteins; N-terminal domain. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.10648e-48
NZ_CP043405.1\|WP_003088681.1\|1977337_1977715_-\|antitoxin-HicB	gnl\|CDD\|374224	pfam15919, HicB_lk_antitox, HicB_like antitoxin of bacterial toxin-antitoxin system. This is a family of HicB-like antitoxins.	6.27905e-18
NZ_CP043405.1\|WP_003088660.1\|1966079_1967123_-\|zinc-dependent-alcohol-dehydrogenase-family-protein	gnl\|CDD\|176247	cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like. This group contains proteins identified as alcohol dehydrogenases and glutathione-dependant formaldehyde dehydrogenases (FDH) of the zinc-dependent/medium chain alcohol dehydrogenase family. The MDR family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes, or ketones. FDH converts formaldehyde and NAD to formate and NADH. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. The medium chain alcohol dehydrogenase family (MDR) has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit.	3.39167e-180
NZ_CP043405.1\|WP_003088676.1\|1974705_1974969_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	5.6022e-08
NZ_CP043405.1\|WP_003088686.1\|1978022_1978685_-\|type-II-A-CRISPR-associated-protein-Csn2	gnl\|CDD\|213408	cd09758, Csn2, CRISPR/Cas system-associated protein Csn2. Csn2 is a Nmeni subtype-specific Cas protein, which may function in the adaptation process which mediates the incorporation of foreign nucleic acids into the microbial host genome. Csn 2 may interact directly with double-stranded DNA. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA. Csn2 has been predicted to be a functional analog of Cas4 based on anti-correlated phyletic patterns; also known as SPy1049 family.	1.63741e-115
NZ_CP043405.1\|WP_003088704.1\|1989510_1990149_-\|TIGR01906-family-membrane-protein	gnl\|CDD\|226884	COG4478, COG4478, Predicted membrane protein [Function unknown].	1.67763e-55
NZ_CP043405.1\|WP_126417973.1\|1978674_1979004_-\|CRISPR-associated-endonuclease-Cas2	gnl\|CDD\|226043	COG3512, COG3512, CRISPR-associated protein, Cas2 homolog [Defense mechanisms].	1.05348e-46
NZ_CP043405.1\|WP_003088701.1\|1986634_1989166_-\|ABC-transporter-ATP-binding-protein/permease	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	3.1365e-104
NZ_CP043405.1\|WP_003088697.1\|1979884_1983997_-\|type-II-CRISPR-RNA-guided-endonuclease-Cas9	gnl\|CDD\|226044	COG3513, COG3513, Predicted CRISPR-associated nuclease, contains McrA/HNH-nuclease and RuvC-like nuclease domain [Defense mechanisms].	0
NZ_CP043405.1\|WP_003088683.1\|1977717_1977924_-\|type-II-toxin-antitoxin-system-HicA-family-toxin	gnl\|CDD\|377942	pfam07927, HicA_toxin, HicA toxin of bacterial toxin-antitoxin,. HicA_toxin is a bacterial family of toxins that act as mRNA interferases. The antitoxin that neutralizes this is family HicB, pfam15919.	1.2281e-15

>NZ_CP043405.1|WP_003088678.1|1975293_1976187_+|helix-turn-helix-domain-containing-protein
MGRGKLTPQDLEDMKVISSNIQRLLTESGMNQSQLASVLNIPKSSLNEYVKGRTLPKAGNIQKIADYFGLQKSDIDPRFSKSSSSSVLEQISYMARQLNSPRQQKLLDFGKQLLADQKQATGLAAQKHLADSQSSSAAGGAKYQEIVDKFITDEIKHQDNIHLDNIKKAKDLYQALGHSYKSIVLYGEVSAGTGVWVGHEKQETIKYPAPIPKHDIALRVNGNSMEPLFYNGEVIFVKKTQEIYHGQFIVVIVNNEAYLKKLYKKDHEIRLISINPHYDDIILQEDDDIEIIGTVIS
>NZ_CP043405.1|WP_003088676.1|1974705_1974969_-|helix-turn-helix-transcriptional-regulator
MKGDVTVEKLTLRALRVNYSLSPKEVADCLGIEQQTLLKYEEDSSDIPIHLANALADYYGINLDSVFLGPESDLKQKFKESKLKNIT
>NZ_CP043405.1|WP_003088674.1|1972753_1974541_-|LPXTG-cell-wall-anchor-domain-containing-protein
MKSKTARITLLSGLALAAFGTTNVLAEDAAASQAPSTTANTNVNSNAAETAPADASQQAQSPSVTVTKTETVGNTTVTTSDVTSQELEDAKAAAQNANLNVTETPAVKQPSVAAADADNKAQAQKINQAVADYDKAKTQYAQDQKQYQQDLADYNTQKSEYDAKKKAYDDYQQQVASGQGAGRVEKAQGLIFESEPKATVTIQGVTDYLDKAARAAHQADDILEQFNTDKYTDSEFTLNNPYDPNEDTWFKMAVGDTIAVTYENIVNSSYNKQKISKVVTTYKLNSSTNKDGTAIVELFHDPTKTIFIGAQTSNTGRNDKISVTMQITFFDENGKAIDLSDNRSIMSLSSLNHWTADYGDHVEKVELGNNEFIQIPGSSISLHGNEIYSINDNQYKKNGATFDGDGDDGWDAVNADGDPRSATAYYGAGAMTYKGEPFTFTVGGNDQGLPTSIWFATNSTVAVPENPGEEPKKPSEPNLEKPTVTWHKNFVVESKQEDVPPVIPPETPEKPVTPQTTPPTRPNTPTPDAPKSSVPNKPTSFRPARKDEVRVREREYQPSLPQTGDDNQTAMFALGLVSTAFAAATAIAAHRRKDQ
>NZ_CP043405.1|WP_003088672.1|1970563_1972402_-|elongation-factor-4
MDTEKLKKRQEKIRNFSIIAHIDHGKSTLADRILEKTETVSSREMQAQLLDSMDLERERGITIKLNAIELNYTAKDGETYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLEILPVINKIDLPAADPERVRAEIEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVPAPAGDVEAPLKALIFDSVYDAYRGVILQIRVIDGMVRPGDKIKLMSNGKTFDVTEVGIFTPKAISRDFLATGDVGYLAASIKTVADTRVGDTVTLANRPAEAPLHGYKQLNPMVFAGIYPIDSGKYNDLREALEKLQLNDASLQFEPETSQALGFGFRCGFLGLLHMDVIQERLEREFNIDLIMTAPSVVYHVNTTDNEVLEVSNPSEFPDPTKIDTIEEPYVKAQIMVPQEYVGAVMELSQRKRGDFVTMDYIDDNRVNVIYQIPLAEIVFDFFDKLKSSTRGYASFDYEISEYRKSQLVKMDILLNGDKVDALSFIVHKEFAYERGKLIVEKLKKIIPRQQFEVPVQAAIGQKIVARSDIKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGSVEVPQEAFLSVLSMDDDDNKKK
>NZ_CP043405.1|WP_003088670.1|1970061_1970538_-|GNAT-family-N-acetyltransferase
MPIRLAQITDIPDLQKLLNQIFQVHQRVRPDLFQDTEQGSKYSEEELKDLLQDASKPIFVYVDDKGRVLGHLFLIIKASKEPSVSKPLKTLFIDDLCVSEEVRGQKIGQKLFDFALKYAKELGCYDLTLNVWNDNEGALAFYERQGLKARETKMEKIL
>NZ_CP043405.1|WP_003088668.1|1969368_1969980_-|hypothetical-protein
MPRRRASRRKSRRKTVFSILLLGLLLIIIGLAVYFVSAYFKNSDKTSGSKTQTHVVNPKKDPEEKQETTTSSQAPASSFDLAALAAGDYTSAVGTWTNELGDSLKFNATGLESATVQNVTEFTLTPGQAASDTIYQASLSSADGTVVYNLLFVKGGAAIPAEFFTEGYSDTSDTSRDRLYISSQTTFGSDDFSKGVLYKSDQQ
>NZ_CP043405.1|WP_003088666.1|1968646_1969315_+|hypothetical-protein
MSKTLIFRILIALAGIIGVSIQITQSGWGMLLYYTTLSNALVFSFLIYLIIQEIMAPQKPFTLQLLRLKGGVTMIIIMTFMVYHFILAPKVRAYDYYTLRNFLVHYVLPLGMIADTLIVDRPRVYRWFDPLIWTVFPLVYFALALINGLIVKWEVPGSADSPFPYFFINVTKYGFKSVLINALSIALIYLFLSYSLVCIKYFIGSKKRAVQNQTARLKISSN
>NZ_CP043405.1|WP_003090819.1|1967349_1968522_-|DUF2974-domain-containing-protein
MANFIDYVKANTEQSFADLPLNEVDIACLNELGYLPLGEWLQQPSLTRDSLCLKDYLDKEALVHFKHDFLVTKERLLLLDSLLSSQRFADLSLSCYVNEVSPEFERQFAAMVLSLPSLKHTQVIFRGTDDSLIGWQEDFRMTYMREIPAQRMASRYLADFLKDFDGQAVVSGHSKGGNLAVYASSHLLSSYQEKISAVYMLDAPGLHQSVLSSFGYGNIQSKILAIRPKESIVGIMLRAGVDAKIVDSVSFGINQHNVANWQVDLQLGQFIKVSKGTDFSLALEKTFQTWNEELSSQELKIFFDTFFNLFMDNGIDSLNDFLGRNRDIPQKLGHVMTDYFQDLDDDKRRLMRKSLAVLVSHFAGHSLKNTKESVNRRLPDFLKHFQLPMK
>NZ_CP043405.1|WP_003088660.1|1966079_1967123_-|zinc-dependent-alcohol-dehydrogenase-family-protein
MKVATFIEPGKMTVTEAPKPKLQKDTDAIIKIVRACVCGSDLWWFRGISQRENGSFAGHEAIGIVQEVGAAVTDVKAGDFVIVPFTHGCGHCAACRAGFDGNCTNQEPGGNAGYQGEYLRYTNANWALVKIPGQPSNYSDEQLNSLLSLADVMATGYHAAKTAEVKAGDTVVVMGDGAVGLCAVIGAKLLGAGRIIAMSRHADRQALAKEFGATDIVAERGDEGVARVLDLTEGNGADAVLECVGTDLSVDTATKICRPGAIIGRVGVPHNSEIATNALFWKNIGLRGGIASVTTYDREILLEAVLNGDIHPGRVFTKRFGLDDIQAAYEAMDKREAVKSLIVISED
>NZ_CP043405.1|WP_003088659.1|1965645_1966038_-|MerR-family-transcriptional-regulator
MNIKKVSELTGVSADTIRYYERIGLIPPVPRHKSGVRNFTEHEIGILEFVRCFRKAGMSVESLIEYIALLEKGEGTEEARLALLIEQREEMDARIYELNQARERLNYKIENYENQIQKREHELFDENKES
>NZ_CP043405.1|WP_003088681.1|1977337_1977715_-|antitoxin-HicB
MLKSYPAIFHKEKKGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPSPSDIREVSVDDGFVTMIQADPSPYLRNNKAIRKNVTVPEWLVRLADRDQVNYSEVLTKALEKKLQL
>NZ_CP043405.1|WP_003088683.1|1977717_1977924_-|type-II-toxin-antitoxin-system-HicA-family-toxin
MPLTGKELARLAVKNGWEEVRVRGSHHHFKKNGVSCIVTIPIHGNQSLKVGLEKKILKDLGLLEQRRK
>NZ_CP043405.1|WP_003088686.1|1978022_1978685_-|type-II-A-CRISPR-associated-protein-Csn2
MKLNFPILDEPIELGKSTILAIEDVQVFAQLVKNFYQYEEDGELKLFDEKLKSLKTPELMLVTDILGYDVNAPSLMKLVHADLENQFNEKPEVKSMVEKLANTITELIAYECLENELDLEYDEITILELIKALGVKVETRSDTIFEKIFEILQVYKYLSKKKLLVFINSLSYFQKEEIVQILEYIHLSHMTVLFLEPHQVDGFSQYILDEDYFLITESGN
>NZ_CP043405.1|WP_126417973.1|1978674_1979004_-|CRISPR-associated-endonuclease-Cas2
MRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSIYSKLLLNNSANTAMIARLKENNPKKGSITLLTVTEKQFSRMIYLNGKRDTSVASSDSRLVFLGEAFPDET
>NZ_CP043405.1|WP_003088691.1|1979015_1979885_-|type-II-CRISPR-associated-endonuclease-Cas1
MAGWRTVVVNTHSKLSYKNNHLIFKDAYQTEMIHLSEIDILLLETTDIVLSTMLIKRLVDENILVIFCDDKRLPTATLMPYYARHDSSLQLNNQISWAEEIKRDVWTNIIAQKILNQSCYLGECSYFEKSQSIMELYHGLEPFDPSNREGHSARIYFNTLFGNDFSREQDNDINAGLDYGYTLLLSMFAREVVVSGCMTQFGLKHANQFNQFNFASDIMEPFRPIVDRIVYENRNSSFVKIKRELFSMFSDTYLYKNKEMYLTNIVSDYTKKVIKALNNDGKGVPEFRI
>NZ_CP043405.1|WP_003088697.1|1979884_1983997_-|type-II-CRISPR-RNA-guided-endonuclease-Cas9
MKKPYSIGLDIGTNSVGWAVITDDYKVPAKKMKVLGNTDKNYIKKNLLGALLFDSGNTAEDRRLKRTARRRYTRRRNRLLYLQDIFSDEMNKVDESFFHRLEDSFLVSEDKRGDHHPIFGNVVDEVKYHEQFPTIYHLRKYLADTPEKADLRLVYLALAHMIKFRGHFLIDDPKLDVKNTDSQELFSQFLTAYDVTQEDSHLADVKINISDIITEKMNKSRKVEALLFHFPSQKKNSFFGNLVSLVFGLLPNFKTNFNLAEDAKLQLSKDSYDEDLENLLGQIGDEYTDVFVAARKLYDSILLSGILTVNDLSTKAILSASMVRRYEEHNKDLAKLKAFVKANFTHDVFKEVFSDASKNGYAGYIEGKTSQEDFYKYVKNLIGKVDGSADFIEKIDREDFLRKQRTFDNGSIPHQVHLAEMKAILRRQGEYYPFLKEHAEKIQQILTFRIPYYVGPLDRHGHSDFAWASFNSEEKVTPWNFEEIIDKNKSAQAFIERMTNQDLYLPNEKVLPKHSPLYEKYTVYNELTKIKYVTETGTAKFFDANLKQEIFDGLFKKERKVTKRKLLTFLEKNFDEFRIVDIQGLDKETETFNASYGIYQDLLKIIKDKAFMDDSENADILEDIVLTLTLFEDREMIKQRLAKYADLFDKKVIDNLARRRYTGWGRLSAKLLNGIRDKRSRKTIMDYLVDDGRSNRNLMQLITDDNLTFKDEIAKAQYSDNSDDLHQVVQDLAGSPAIKKGILQSVKIVDELVKVMGYEPEQIVVEMARENQTTAKGRRNSQQRYKRLEEAIKNLDRDLNYKILKEHPTDNQALQNDRLFLYYLQNGRDMYTGESLDINRLSDYDIDHIIPQAFIKDNSIDNRVLVSSAKNRGKSDDVPSEDVVNRMRPFWNKLLNCGLISQRKYSNLTKKELTPNDKAGFIKRQLVETRQITKHVARILDEHFNKEFDEDKKRIRKVKVVTLKSNLVSNFRKEFELYKVREINDYHHAHDAYLNAVVAKALLMKYPKLEPEFVYGEYPKYNSYRERKTATQRMFFYSNIMNMFKSKVKLADERIIERPMIEVNDETGEIAWDKTKHIATVKKVLSYPQINIVKKVEEQTGGLTNETIYPRGSFDKLLNRKNTLEASKYGGFGSPTVAYCVLVVADSKNENGKVKKLKLGSELLGITILEKNDFENNSLDFLSRKGYQGVQEKKIIKLPKYSLFEFQDGSRRMLSSVMANDNKRGDLQKANEMILPAYLVKLLYHAKHINSVGEPAHKNYINEHCSEFQDLLNYIRQFADKFVDVDKNLSKIRSLSKSMAEYSVSEICSSFVNLLTLTALGAPADFKFFGTTIPRKRYGSPQSILSATLIHQSITGLYETRIDLSKLGED
>NZ_CP043405.1|WP_150880971.1|1984317_1985610_-|IS110-family-transposase
MLSKYVGRQTSRIENDITKTRNHSRQRGNSMRVVFGIDVSKVSSEVAILVNGEKVHGYTMPNDAIGFARLLGDLKTVHKPEIIFEATGVYSRRLQAFLEDNGYAYTRLNPLEAKKQLDSLRVRKTDQIDAEKLAQSQFVLNRKPTYVQEEVYQNLRDLSRFYQNLTEDIVRAKNRLHKVLQVTFPELENILATPTGEQYWKLVMTFPCKELVLDRDGNELLDSIRQSTSKRISDKRVVYLAEKLTALANQSYCAVKKTSPMFEEIRYYAQELLRLSERRKAVLDQMVTLAKPLPEYEILLSIPGIAETTATSIIGELGDIRRFHSANQINAFIGIDLRHYESGNFLAQEHITKRGNPYARKILFKCIHNIASASHTNPCHIADFYEKRKRQSQTTSTKPHTIASIHRLIRTMYYLITHNKLYDYTSTQNQ
>NZ_CP043405.1|WP_003088699.1|1985953_1986511_-|NAD(P)H-dependent-oxidoreductase
MKLLGITDASTSFSYNYLLLSFIQERFGLAFDFEWLELEKLPLFNQDDSRDKYPILQKLTDSILAADGLILAAEEYNHSLTPNLKSMLEWFSYQQSPFENKAVMLVGASLNEHIPQKAQEDLKRVLAAPGLKAWVMADKPFFLKTAPRAFDENGQIKDPDLIARLSNNFQHFIRFIHLTDSFKEK
>NZ_CP043405.1|WP_003088701.1|1986634_1989166_-|ABC-transporter-ATP-binding-protein/permease
MLELKHITKIYDTAGIKRTALDDISINFRASEFVSVLGQSGSGKTTLLNIVGGLDQYTSGDLLINGKSTKDFKDKNWDRYRNNTIGFVFQSYNLISHQTALANVELALTLSGVSKSERSSRALEVLKRVGLEDHIHKRPSQMSGGQVQRVAIARALVNNPDILLADEPTGALDSETSLQIMNLLKEIAQERLVIMVTHNPNLAEKYSNRIIRVLDGRIIDDSNPYNDKDLDQSAVDFKKTKMSFMTALSLSFNNLLTKKGRTFLTAFAGSIGIIGIALILSLSNGAQKYISKTQEDTLVAYPLSIEKSSNENFMGLFAAGNEDSNSSKKKSEKKTLKTDNILKNMISTQVVDNDLASFKAYIKKHSRKFRKVTKDIQYSYKLSPRIYQTNTSKGVRPVNPSNLSKEVKNAGSNIQVLLSNLNVWQELSSSPKMLSSQYQVVDGHLPQKYNEVVLIAEENNKIDDYVLYSLGIKDVSELNSSKELKHIKESSYQYSDLVGRTYKLVINSDVYQKEGGIWVDRSDNDTYMKKLVNAAETIKIVGIVKPQKGTASGSSNAGVGYSQKLTSYLSEKINASSIAKEQLANKKRNIFTGQDFSSSSKPFSSANLSAEQRAALASMSAEELADYVNRYNENATATYDDNLEKIGIIDTANPETINFYADSFENKEALKDLISDYNKQVKKDKQKSKVINYTDTVGLMMSSVTTMINAVTYILVGFVAISLVVSSIMIGIITYISVLERTKEIGILRAMGASKKDVMRIFTAETVIEGAIAGILGILITLLLNIPINMIVNNLLDINNISSLPVWSAVVLIAISILLTVFAGILPSRVAAKKDPVEALRTE
>NZ_CP043405.1|WP_003088704.1|1989510_1990149_-|TIGR01906-family-membrane-protein
MKDKIHFAFSLLFLLAFSILATIYLVWLLYPLEISCLGLEKVVYMKSSQIQHNFNRLMLYLTSPFHWQLAMPDFPSSKDGLHHFEQVKWLFHLAQVCFLLTLPSFLLFMRNSIQKGYGILYKQALKIAALIPIILTLIAVAIGFDSFFTLFHQVLFAGDETWLFNPYTDSVIYILPETFFLHCFILFFLLYESSFCALLWQIRKKSKKREIV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043405_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043405_4

2078561-2078645

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
ACCCCCGCGTGTGCGGGTAAAAC	CRISPRCasFinder

1 spacers

DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of NZ_CP043405_4

>merge|NZ_CP043405|4|2078561-2078645|CRISPRCasFinder
ACCCCCGCGTGTGCGGGTAAAACATCTGTTCCTACTTTGCGACTTGTGAAAAAGAGAGGATCACCCCCGCGTGTGCGGGTAAAAC

>NZ_CP043405|4|3|2078561-2078645|CRISPRCasFinder
ACCCCCGCGTGTGCGGGTAAAAC	ATCTGTTCCTACTTTGCGACTTGTGAAAAAGAGAGGATC
ACCCCCGCGTGTGCGGGTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043405.1\|WP_003088883.1\|2077945_2078218_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP043405.1\|WP_003088877.1\|2068977_2069748_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP043405.1\|WP_003088886.1\|2078218_2078497_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP043405.1\|WP_003091169.1\|2091113_2092031_+\|neutral-zinc-metallopeptidase	unknown	unknown	gnl\|CDD\|282131
NZ_CP043405.1\|WP_003088905.1\|2086436_2088119_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP043405.1\|WP_003088870.1\|2066816_2067749_-\|tagatose-6-phosphate-kinase	unknown	unknown	gnl\|CDD\|237405
NZ_CP043405.1\|WP_003088878.1\|2070101_2070260_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187558
NZ_CP043405.1\|WP_126417939.1\|2092434_2095074_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|223650
NZ_CP043405.1\|WP_003088896.1\|2082453_2083395_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP043405.1\|WP_003088897.1\|2083396_2084038_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP043405.1\|WP_003088880.1\|2070488_2074121_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NZ_CP043405.1\|WP_003088881.1\|2074110_2077356_-\|ATP-dependent-nuclease-subunit-B	unknown	unknown	gnl\|CDD\|274291
NZ_CP043405.1\|WP_003088900.1\|2084777_2085851_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP043405.1\|WP_081600747.1\|2088119_2090822_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP043405.1\|WP_003088903.1\|2085840_2086437_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP043405.1\|WP_003088876.1\|2068292_2068718_-\|galactose-6-phosphate-isomerase-subunit-LacA	unknown	unknown	gnl\|CDD\|181505
NZ_CP043405.1\|WP_003088867.1\|2065833_2066814_-\|tagatose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|183502
NZ_CP043405.1\|WP_003088875.1\|2067763_2068279_-\|galactose-6-phosphate-isomerase-subunit-LacB	unknown	unknown	gnl\|CDD\|181506
NZ_CP043405.1\|WP_003088898.1\|2084037_2084763_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NZ_CP043405.1\|WP_003088894.1\|2081549_2082452_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|378244

Protein	Function_ID	Function_description	E-value
NZ_CP043405.1\|WP_003088883.1\|2077945_2078218_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.34118e-18
NZ_CP043405.1\|WP_003088877.1\|2068977_2069748_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.23891e-83
NZ_CP043405.1\|WP_003088886.1\|2078218_2078497_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	1.49557e-41
NZ_CP043405.1\|WP_003091169.1\|2091113_2092031_+\|neutral-zinc-metallopeptidase	gnl\|CDD\|282131	pfam04228, Zn_peptidase, Putative neutral zinc metallopeptidase. Members of this family have a predicted zinc binding motif characteristic of neutral zinc metallopeptidases (Prosite:PDOC00129).	4.72485e-136
NZ_CP043405.1\|WP_003088905.1\|2086436_2088119_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	7.66285e-84
NZ_CP043405.1\|WP_003088870.1\|2066816_2067749_-\|tagatose-6-phosphate-kinase	gnl\|CDD\|237405	PRK13508, PRK13508, tagatose-6-phosphate kinase; Provisional.	0
NZ_CP043405.1\|WP_003088878.1\|2070101_2070260_-\|hypothetical-protein	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.67516e-17
NZ_CP043405.1\|WP_126417939.1\|2092434_2095074_-\|FtsX-like-permease-family-protein	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.99983e-15
NZ_CP043405.1\|WP_003088896.1\|2082453_2083395_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	9.1934e-131
NZ_CP043405.1\|WP_003088897.1\|2083396_2084038_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	1.91064e-72
NZ_CP043405.1\|WP_003088880.1\|2070488_2074121_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP043405.1\|WP_003088881.1\|2074110_2077356_-\|ATP-dependent-nuclease-subunit-B	gnl\|CDD\|274291	TIGR02774, putative_ATP-dependent_exonuclease_subunit_B, ATP-dependent nuclease subunit B. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RecAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. The partner may be designated AddB, as in Bacillus and in alphaproteobacteria, or RexB as in Streptococcus and Lactococcus. Note, however, that RexB proteins lack an N-terminal GxxGxGK[ST] ATP-binding motif found in Bacillus subtilis and related species, and this difference may be important; this model represents specifically RexB proteins as found in Streptococcus and Lactococcus. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP043405.1\|WP_003088900.1\|2084777_2085851_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	3.02907e-159
NZ_CP043405.1\|WP_081600747.1\|2088119_2090822_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	8.07659e-89
NZ_CP043405.1\|WP_003088903.1\|2085840_2086437_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	7.04145e-36
NZ_CP043405.1\|WP_003088876.1\|2068292_2068718_-\|galactose-6-phosphate-isomerase-subunit-LacA	gnl\|CDD\|181505	PRK08621, PRK08621, galactose-6-phosphate isomerase subunit LacA; Reviewed.	4.1844e-82
NZ_CP043405.1\|WP_003088867.1\|2065833_2066814_-\|tagatose-bisphosphate-aldolase	gnl\|CDD\|183502	PRK12399, PRK12399, tagatose 1,6-diphosphate aldolase; Reviewed.	0
NZ_CP043405.1\|WP_003088875.1\|2067763_2068279_-\|galactose-6-phosphate-isomerase-subunit-LacB	gnl\|CDD\|181506	PRK08622, PRK08622, galactose-6-phosphate isomerase subunit LacB; Reviewed.	3.23468e-124
NZ_CP043405.1\|WP_003088898.1\|2084037_2084763_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	2.17457e-44
NZ_CP043405.1\|WP_003088894.1\|2081549_2082452_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.36311e-36

>NZ_CP043405.1|WP_003088886.1|2078218_2078497_+|type-II-toxin-antitoxin-system-YafQ-family-toxin
MYQVKFTSAFKKSFKRMKKRGMDVSLLDDVIEKLHLGQALEDRYRDHELKGSFKGFRECHIKPDWLLIYLLEDDILTLTLVDTGSHADLFKM
>NZ_CP043405.1|WP_003088883.1|2077945_2078218_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MATVPTQIRIDETVKAQATSLFNDLGIDMSSAVNIFLRQCLLHDGLPFNVELPNYNSKTLEAMAEAKRISHDEAVVAYDNMSDLKKALEA
>NZ_CP043405.1|WP_003088881.1|2074110_2077356_-|ATP-dependent-nuclease-subunit-B
MKLLYTDIQYDMTEILAAEARQAAKESKRVFYLAPNSLSFEKERAVLEALPEEASFAITITRFAQMARYFVLNEPYQREVIDDNGLAMIFYRALAGFSEQDLPVFGRLKQDTNFISQLVDLYKELKASNMTVLELTELNSPEKQEDLIKIFNKAEAILNAGNFDSQSKTAFFTQQLKAGHLDSELKDLLIIVDGFTRFSAEEENLISLLHEKKVPVIIGTYISQKAYRSAFSKGNVYQASLDFMRGLAAKFKTKPEYVRSKQKGLQAFANLSSIFESRHDFSADGRTLTKEDKEHIVIWDAVNQKEEAEHVARAIRRKLYQGYRYKDILVLLGDTDAYQLQVGKIFDKYEIPYYFGKAESMSSHPLVHFIDSLERIKRYNFRAEDVMNVLKSGLYGRLQQEELDKLEYYISYADIKGQSKFFNDFTLDNQGQFDLKQLNQWRSELISPLRQLVKAQKQLGKSLLKKLTVFLEDIALPENFVLLTAESGEIEQEKHEQVWKTFTAILEQFQRIFGGEKLTLDEFLSLLRASMLAADYRTIPAAVDVVTVKAYDLVEPHTNKIVFAMGMTQSNFPKIVQNRSLISDEERARINDITPDNRRFDIVSSENLKKNHFAALSLFNAATEELILSLPQILNETEDSTSSYLLELAEFGVPIVEKGRSGQLSNPEDIGNYKALLSRVIELERASIDQEMTKEEQTFWSVAVRYLRKKLNEQGIVIPEINDSMQTKPLAPSVIKARFPADEPINLSSSALTAFYNNQYLYFLRYVLGLQELETIHPDAKNHGSYLHRVFELVMQDAAAPDDFDGRLNQAIAKANEENSFKMLYEEDEESRYSLDVLEDIARSTASILRDDAQIQVESEEEAFELMLGNAVKIRGFIDRIDRLSDGSLGIIDYKSSRNTFDIQKFYNGLSPQLLTYMEAVNNRSDLPDRQKIFGAMYLHMQEPKLDLSSVKSLDKIPEAIHKELTYRGLFLDEEKAYLADGKYHLNDSVYSQKEIDLLLAYNRELYQKAARQIRSGHFLINPYSQDGKSVQGEQLKAITHFEADRHMPYARKLHQLPRKEKRQGFLHLMQAKQEEENNDF
>NZ_CP043405.1|WP_003088880.1|2070488_2074121_-|helicase-exonuclease-AddAB-subunit-AddA
MTFKNFLSAQEIASLQLEEAESNKQQKRTPEQIEAIYSYGNNILVSASAGSGKTFVMIERIMDKILRGVKIEDLFISTFTVKAAGELKERLEKKLTQHLQTASDPKLKQFLAEELASVQTADIGTMDAFTQKLVNQYGYTLGISPSFRIMQDKSEQDILKNDVFADLFADYMRSENRSVFVKLVKNFAGSRKDSDPFKQLVYKIYDFSQATDNPKSWLTDSFLKGAETYTDFSAIPEQEVAEFLASMEDTAKALRDLTDLEDYKQLTGKGAPTANYKKHLNMIEKLQDWAWNFESLYGREGLGKLANDIADLIPSGDSVTVAKVKYPVFKALQGRLAELRHLETIFAYQAESLPLLRLLQQFVLDFSEQYLQAKMQENAFEFSDIAHFAIEILEENPDIRQLYQNKYHEVMVDEYQDNNHTQERMLELLSNGHNRFMVGDIKQSIYRFRQADPQIFNAKFKDFQEHPEHGKLILLKENFRSQSEVLATANSVFSHLMDEAVGEILYDDSHQLLAGSDRQKEAHPENATQVLLYDTDENEEALSDDDSNQISPSEVKLVAKEIIRLHNEEKVPFEDITLLVASRTRNDGIIQTFDHYGIPLVTDGGEQNYLKSVEIMVMLDTLRSIDNPLNDYALTALLRSPMFAFDEDELTRLALQKTSDSHKENLYEKMQNAINKQGQHPELMTPDLAAKLQAFLDVFGSWRRFARLHSLYDLIWKIYNDRFYYDYVGRLPRAEQRQANLYALALRANNFERTGFKGLSRFIRMIDRVLESQNDLADVEVALPKKAVTLMTIHKSKGLEFNYVFILNIDKKFSIQDMTSPLILSRRNGVGIKYLVDMKEELQEKLLPAVKVNMATLPYQLNKRELRLATLSEQMRLLYVAMTRAEKKLYLVGKGSAEKLADKYSGKSENNHLPAAERESYMTFQDWLLAIQQAFSSENLHFKTVFVTDEDLTEDKIGMVKGERLYNPDDLKDNRQSEDIARALDMLEAVEKLNKDYQAAINLPTVRTPSQVKKFYEPVMDTDGVDIMEKSPAAKLKFKLPDFSEKKAVAAAALGSSLHELMQRLRLSEEVGMNDILQALEELPAEADIKKAIQTDKILAFFQTTDLGKLIQKNADKVRREAPFAMLETDSASGEKFVVRGIIDGYILFENRIILFDYKTDKFTNSQDIKQRYQGQMALYAQALSKSYGISAVEKYLILLGGEQLEVVSV
>NZ_CP043405.1|WP_003088878.1|2070101_2070260_-|hypothetical-protein
MKNTVTGFSNLQTLEAARKVTGKEISAKKADRRLGDPDILIASSEKARKILG
>NZ_CP043405.1|WP_003088877.1|2068977_2069748_+|DeoR/GlpR-transcriptional-regulator
MIKKERLNWILEQLKHQSIITVNDIIKELGVSDMTVRRDLAELEKEHQLIRVHGGAQSINLLNKPEKSNTEKQSEQVSEKKEIAAFTAQRVQDGETIFIGPGTTLEYFAQELLQRNLRIITNSLPVFDILKESPNIDLLLIGGEYRPVTGAFVGSLASSNIASLTFSKAFISANAVYQDSVATYSESEGTIQELALDKALEKYLLVDNQKFDSYDFFVFYKTSDFDYVVTDSKLSDDKQALYNKFTKVLKANTNSQ
>NZ_CP043405.1|WP_003088876.1|2068292_2068718_-|galactose-6-phosphate-isomerase-subunit-LacA
MAIVLGADKAGERLKNLVKDYLQAKGFDVTDVSAEGQDFVDLTLAVAAEVDKADDNLGVVIDAYGAGSFMVATKVKGMIAAEVSDERSAYMTRAHNNARIITMGAEIVGDELAKNIVKGFVEGHYDGGRHQIRVDMLNKMC
>NZ_CP043405.1|WP_003088875.1|2067763_2068279_-|galactose-6-phosphate-isomerase-subunit-LacB
MKIAIGCDHIVTDEKMAVSEFLKSKGYEVLDFGTYDHVRTHYPIFGKKVGEAVSSGQADLGVCICGTGVGISNAANKVPGVRSALVRDMTSALYAKEELNANVISFGGKIVGGLLMNDIIEAFIKAEYKETEENKKLIAKIAHVETSNADQKDPDFFKEFLDKWDRGEYHD
>NZ_CP043405.1|WP_003088870.1|2066816_2067749_-|tagatose-6-phosphate-kinase
MILTVTMNPSIDVSYPLDKLKLDTVNRVSEVTKTPGGKGLNVTRVLAEVGDDVSATGLIGGRLGDYLTEKLTQAGIKHQFFPIHGETRNCIAILHEGLQTEILESGPLIDPDEAEGFLHHFKLILTSFDVVTISGSLPEGLEKTYYAELIGLANLYRKKVVLDCSGAALEAVLKSSEKPAVIKPNSEELSQLLGRDISEDTDSLKDVLLDPLFEGIEWIIVSLGADGAFAKHRDKFYKVDIPKIDVVNPVGSGDSTVAGIASALAHDEDDASLLKKANVLGMLNAQEKMTGHVNMANYDTLYQQIQVKEV
>NZ_CP043405.1|WP_003088867.1|2065833_2066814_-|tagatose-bisphosphate-aldolase
MVLTEQKRKYMEKLSDENGIISALAFDQRGALKRLMAQHQTQEPSVAQMEELKVLVAQELTPYASSMLLDPEYGLPATKALDKNAGLLLAYEKTGYDTTSTKRLPDCLDVWSAKRLKEQGADAVKFLLYYDVDSSDELNQQKQAYIERIGSECVAEDIPFFLEILAYDEKIADAASPEYAKVKPHKVIEAMKVFSNPRFNIDVLKVEVPVNMNYVEGFGNGETVYSKAEAAAFFKQQDQATDLPYIYLSAGVSAKLFQDTLVFAHESGANFNGVLCGRATWAGSVKDYIEQGEEAARQWLRTTGFQNIDELNKVLQKTATSWKEKV
>NZ_CP043405.1|WP_003088894.1|2081549_2082452_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MPLTVITLKSVPQSLRGDLTKWMQEIATGVFVGNFNTKVREQLWERVQDSVGSGEATLSYAYRNEIGYQFATINAQREVVDFDGIPLIRFPLDPEEGRKQDVFGYSDAARFRKARKFASPTKTIQHAVKPYVILDIETDGLDENKNKIIEIGAIKVSGSELKECHYLVQCDNTLPKEIVQLTGITDDMLQQEGVDIELALNGLLNFIGSLDIVGYGVNFDLTFINTKLTDLGYPVITNSVYDLMKYVKSEKLFLENYKLQTVLKSYGIDEKVPHRALLDARLILDLSTKVNKFLTRINQK
>NZ_CP043405.1|WP_003088896.1|2082453_2083395_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MKKQNGAKKTSLRELPKISDRVSFLYVEHAKINRVDSAITIADSRGVVRIPAAMLGVLLLGPGTDISHRAVELIGDTGTSMVWVGERGVRQYAHGRALAHSTKFLEKQAKLFSNTRSRLKVARKMYQMRFPNEDVSALTLQQLRGREGARIRSVYRTYSREYGVPWDKREYSPDDFESGTIVNQALSAANVALYGLVHSIIVALGASPGLGFVHTGHDLSFVYDVADLYKAETTIPLAFKIASESQEDDDIGKIARLKVRDSFVDGKLMTRMVKDIQYLLDIGDEEELLVDIIALWDDKDNLVKHGVSYREGD
>NZ_CP043405.1|WP_003088897.1|2083396_2084038_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYISRVEIDHANRRKIKDLTHVDAYHGWVESSFPAEIEKSIRTRKLWRVDTIKGRNYLIVVSQGKPDLSLLEKYGVSGSAQTKPYDPFLENLKPGDNFQFRVVLNPVISLSNRDHSKRGVVKPHVTVERQMQYLMDRSEKNGFSLREGDFSVVERGYEVLKKSTMKPVRLVKAVYEGVLTITDVELFRKVLTDGIGKKKAYGFGLMTVIPIGK
>NZ_CP043405.1|WP_003088898.1|2084037_2084763_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTILLKFSGPLQAWGTRSHFETRHTDFYPSKSAVIGLIAACLGHRRDEDEKIKQLNEIDFAVRVDQQGNLMRDFHIAQKYKTSGEFERSYVTNRYYLEDAIFVVAISHADDEFMTTIEKGLRNLYFQPFMGRRSCPVPADFVLGTGSENVVNTLHTLEWQADEWYMKKHSGEAGFSLEIYMDSHLTKNNHYQLRQDRVVSFSQKERRFGFRYESRMIVPVQNPFYKKNTDHNVFDFIGEE
>NZ_CP043405.1|WP_003088900.1|2084777_2085851_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTSQSKLFLDIHVIQTLPPSNINRDDTGSPKTAQYGGVRRARVSSQSWKRVMREYFNTNGKQSNVGIRTKEIVQYIADKMMELDSAISNDDALKKADNILNKGGIKTKDFKSKALFFLSDTQAKQLAQAAIDSVNDKKELQKMITSSPAIDIALFGRMVADDPSLNEDASSQVAHAISTHAVQTEFDFFTAVDDLAPEDNAGAGMLGTVEFNSSTLYRYANVAIHDLALQLDDTESVVNAVKLFVEAFANSLPTGKVNTFANQTLPQTLVVTVRTDRPVNLVSAFEKPVKSSEGYVKESIEKLANEFTKVEKMVKKSDLTFYVSLEEVAELSTIGVEKNSLPELLEDLSKELVNLM
>NZ_CP043405.1|WP_003088903.1|2085840_2086437_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MPEESNGTVYSVTKKIVTKLTNQLDTSAGKAMLARLRHSAGKPISEAKEVWPILFENLPETFLSQYDDASYEETAILTAIQLYALYQQGRAQSVFDEVAEKHQNIGYSLKNLRREEDTIAVDRRFNTMITATTFDELTHHLRHLVTLLKAKSPETKIDFARLSADLYWFLRDYPETVRLNWARQYYKHSSKEEEENDN
>NZ_CP043405.1|WP_003088905.1|2086436_2088119_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MGKFNLLNEPWVSVVYDDRGATKEVSLLDLFQNAHNYKDLAGDTKTQDFAVLRVLLAVLHTVFSRFDANGQVYEYLEVDERFRQLEAVDEADLIDYEDDLYDTWVNLWNRGQFPEIVSHYLEKWRDRFYLFDEDYPFFQVRKEDISEEKINKAKAGSVSGKFINRTISESGNKVSLFAPRSSQKKELLGFGEIARWLLAFQGYTGTGDKTKFNNLDNEVKLSKGWLFDIGAIFVKGENLYETLLLNCILPYSQRDNLEHIQRPCWELASKELLEEYLSGKAINNLSSLYTSWSRSVYINPEIGLETPFSVQIVKLPEVPHQDNFLEPFTLWKYNLSGESKGSHTPNKHSVNQSLWRSFALLTTTVDNQRKPGIIDWLDVLKEEIGEQQIILNAVSMQDDGNATSWLPTDEIIDTLSINEFVLTDLHEKGWVTRINDVVEETKTVVSRTYRKFITDIREIRNIKSDAFTSQKVEECYFKIDQPFRQWLSSIQYEDEKDQKVFEWRGELKRLVLEEAKTLLHEGGPRDYIGIVDKDKGTVKNIATAYDHFTYWLNQNVKEGK
>NZ_CP043405.1|WP_081600747.1|2088119_2090822_-|CRISPR-associated-helicase/endonuclease-Cas3
MQHLEDTMNVAGLLWEHWLGEGQRQLIEASLSSSQSNDDFGKQVIQFLAATHDLGKATPAFQTQKGYANSEDLDIQLLEKLERAGFAGISFVDLANPRESHHSIAGQYLLSRYGVHDDLATIVGGHHGKPIDNITDYTNQKAYESNFFQTEKPDSTIYRKWDRAQRDIFEWALEVSGFSSVEELPRVKQPAQVILSGLLIMADWIASNESYFPLISVEENEVGNKVNRLETGFMAWRQSGLWESSIKETRDIFERRFRFVPHDVQRVLSDKILQSQRPGIFILEAPMGIGKTEAALVAAEQLAAKTGRNGLYFGLPTQATSNGIFPRIEKWLESIAAEQNVDDHLSIHLVHGKAALNEKFAEILRSTNINIDESDNGSVVVNEWFSGRKTTALDDFVVGTVDQFLMVALKQKHLALRHLGFSKKVVVIDEVHAYDAYMNQYLLEAVKWMGAYGVPVVILSATLPADRRVELIINYLDGMGRKIRKPERKSLVDKFGSESYPVITYTDGFDIYQETDFPKRDNKNMVISRLQEEDLIETIENQLSGGGIVGLIVNTVRRAQDLAKRLSEKFGEDIVELLHSGFIATDRIRKEQNLLQMIGKGADRPKKKIIVGTQVIEQSLDIDFDVLISDLAPMDLLIQRMGRLHRHDIKRPVNHQRPYFYVLGMTDNLDFESGTSFVYGDYLLIRTQYFLPDTVTIPEDISSLVQKVYRNSDIDFEDENLNKKYQVAKNGHDVKIERQENKAKNYRIADPILVESISHKGNLIGWLKNPNLSESEETSYSQVRDIEETIEVIALKKVESGYGLFGKDKDISDYITDYQLAREVAQNTLRLPQSLSKSYNIDQSIKELENYNNQHLPTWRKSTWLKGALGIIFDENNEFVLNGRKLRYNEKYGISMEEVE
>NZ_CP043405.1|WP_003091169.1|2091113_2092031_+|neutral-zinc-metallopeptidase
MKTDKLKESNNIEDRRGEESGAYGGDGSSIGSNLLLQLLFSRGSWKSKLVILIILLFIGGASGLGSILTGDNTNNSSPYQSSQVTRKKGTDVSSEETKFVSKVLASTEEFWTKKFKEEGLSYKKPKLVFYTDHIRTGCGQGQASAGPFYCSADQKIYLDISFYQELSSKYKAAGDFAMAYVIAHEVGHHVQNELGTMSDYNQKRQGLSETQANALNVRLELQADYYAGAWAKYVEGEGLLDTGDIEEAMRAAHAVGDDTLQKEAYGRTVPDSFTHGTSEQRQNWFNRGYKYGDIKHGDTFSADSL
>NZ_CP043405.1|WP_126417939.1|2092434_2095074_-|FtsX-like-permease-family-protein
MMKKTYWKDIWRSIRKSKARFLSILLLLMLGSFALVGLKVTGPDMKHSAAEYLKKHNTMDLTVIANYGLSRDDKEELNSLKQAQVDYGYMTDVTIKGTDSAVRVYSKADKISTYAINSGRLPKNSQEIALDVTLRDDYKIGDEISFTQSQQDLLKKSTYRIVGFVTSSEIWSKTNMGASTAGDGSLSNYALVSDTAFKSNTYTIARIRYDDLKNLNPFSDTYAKKLIKHQEELDSLLKDNGKKRLENLQAAAQKKVDDSKKQVKTAKDQLAGQKSALSYLSGSQLTAAQKAVAEAEKKISKNEDDIKKAQADIAAMPEPSYSSYNRSTLPGGGGYQTFSSSSDSVSAIGNLFPVVLYLVAVLVTFTTMTRFVDEERTNSGVLKALGYSDRDIIRKFVIYGAVASIIGAVLGILAGHYVLAPIISSSTTSSLTFQQMHYYFYWNYALLALTVAFLSAVLPAFLVAKKELAEKPAQLLLPKPPVKGSKILLEKIPFIWNRLTFTHKVTARNIFRYKQRMLMTVFGVAGSAALLFAGLGIQSSLGKLINNQFNHITPYDLLLVENDEASETEQSALSQAVKSKDISQTMPIFYKQVDEKIAGITDKQSVSLTVSAHENFDHFINLKNIKNGKKLNLTDNGVIITELLARYYHVEAGDSFRFTDENGKKVRLKVAAVAEMNVGHYLFMTDKYYHRKFDERAKNNAYFINLKDSSSANISDKATELLAMDGVSAVSQKSSIVNTVDLVVKSLNGAMTVLIIVSVLLALVILYNLTNINVAERIRELSTIKVLGFYDQEVTMYIYRETISLSLIGILLGLLAGHYLHEIIMAMIGNDNIMFGSIIDSYIYAVPVFTVVFILLILGLMVNRRLKNLNMLEALKSAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP043405_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP043405_5

2081008-2081526

TypeI-E

I-C,I-E,II-B

Consensus_repeat	Method
AGGATCACCCCCGCGTGTGCGGGTAAAAC	PILER-CR
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CRISPRCasFinder
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CRT

8 spacers

DEDDh,cas1,cas6e,cas5,cas7,cse2gr11,cas8e,cas3

The CRISPR arrays of NZ_CP043405_5

>merge|NZ_CP043405|5|2081008-2081526|PILER-CR,CRISPRCasFinder,CRT
AGGATCACCCCCGCGTGTGCGGGTAAAACAAAAAACAAGGTCACAAAACGTCTTTGGATAAAGGATCACCCCCGCGTGTGCGGGTAAAACCTCATCAGTAAATCACCATTAGAAACATTATCAGGATCACCCCCGCGTGTGCGGGTAAAACATCATATAAACCTCTGTTTTATTGCTCATTTTAGGATCACCCCCGCGTGTGCGGGTAAAACCAGTGTTCACTGTAAAGATAGCGCCTGCCCCATAGGATCACCCCCGCGTGTGCGGGTAAAACACCGCATCAGTTGGAACATCTGCAACACGGCCAGGATCACCCCCGCGTGTGCGGGTAAAACTGATACTTAGCTATACGGCATCTATCCTATCTAAGGATCACCCCCGCGTGTGCGGGTAAAACGGTTACATCTGGCAAGTCGACGCTGACGGCACAGGATCACCCCCGCGTGTGCGGGTAAAACAAAATAAAAACTCTTGAAAATCAAGGGTTTTTAGGATCACCCCCGCGTGTGCGGGTAAAAC

>NZ_CP043405|5|2|2081008-2081526|PILER-CR
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAAAACAAGGTCACAAAACGTCTTTGGATAA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CTCATCAGTAAATCACCATTAGAAACATTATC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ATCATATAAACCTCTGTTTTATTGCTCATTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CAGTGTTCACTGTAAAGATAGCGCCTGCCCCAT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ACCGCATCAGTTGGAACATCTGCAACACGGCC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	TGATACTTAGCTATACGGCATCTATCCTATCTA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	GGTTACATCTGGCAAGTCGACGCTGACGGCAC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAATAAAAACTCTTGAAAATCAAGGGTTTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC

>NZ_CP043405|5|4|2081008-2081526|CRISPRCasFinder
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAAAACAAGGTCACAAAACGTCTTTGGATAA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CTCATCAGTAAATCACCATTAGAAACATTATC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ATCATATAAACCTCTGTTTTATTGCTCATTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CAGTGTTCACTGTAAAGATAGCGCCTGCCCCAT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ACCGCATCAGTTGGAACATCTGCAACACGGCC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	TGATACTTAGCTATACGGCATCTATCCTATCTA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	GGTTACATCTGGCAAGTCGACGCTGACGGCAC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAATAAAAACTCTTGAAAATCAAGGGTTTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC

>NZ_CP043405|5|3|2081008-2081526|CRT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAAAACAAGGTCACAAAACGTCTTTGGATAA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CTCATCAGTAAATCACCATTAGAAACATTATC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ATCATATAAACCTCTGTTTTATTGCTCATTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	CAGTGTTCACTGTAAAGATAGCGCCTGCCCCAT
AGGATCACCCCCGCGTGTGCGGGTAAAAC	ACCGCATCAGTTGGAACATCTGCAACACGGCC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	TGATACTTAGCTATACGGCATCTATCCTATCTA
AGGATCACCCCCGCGTGTGCGGGTAAAAC	GGTTACATCTGGCAAGTCGACGCTGACGGCAC
AGGATCACCCCCGCGTGTGCGGGTAAAAC	AAAATAAAAACTCTTGAAAATCAAGGGTTTTT
AGGATCACCCCCGCGTGTGCGGGTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP043405.1\|WP_003088883.1\|2077945_2078218_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	unknown	unknown	gnl\|CDD\|274102
NZ_CP043405.1\|WP_003088877.1\|2068977_2069748_+\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP043405.1\|WP_003088886.1\|2078218_2078497_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	unknown	unknown	gnl\|CDD\|379750
NZ_CP043405.1\|WP_003091169.1\|2091113_2092031_+\|neutral-zinc-metallopeptidase	unknown	unknown	gnl\|CDD\|282131
NZ_CP043405.1\|WP_003088905.1\|2086436_2088119_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	cas8e	cd09729_cas8e_CAS-I-E	gnl\|CDD\|378189
NZ_CP043405.1\|WP_003088870.1\|2066816_2067749_-\|tagatose-6-phosphate-kinase	unknown	unknown	gnl\|CDD\|237405
NZ_CP043405.1\|WP_003088878.1\|2070101_2070260_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|187558
NZ_CP043405.1\|WP_126417939.1\|2092434_2095074_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|223650
NZ_CP043405.1\|WP_003088896.1\|2082453_2083395_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	cas1	cd09719_cas1_CAS-I-E	gnl\|CDD\|274693
NZ_CP043405.1\|WP_003088897.1\|2083396_2084038_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	cas6e	pfam08798_cas6e_CAS-I-E:CAS-IV	gnl\|CDD\|378050
NZ_CP043405.1\|WP_003088880.1\|2070488_2074121_-\|helicase-exonuclease-AddAB-subunit-AddA	unknown	unknown	gnl\|CDD\|274299
NZ_CP043405.1\|WP_003088881.1\|2074110_2077356_-\|ATP-dependent-nuclease-subunit-B	unknown	unknown	gnl\|CDD\|274291
NZ_CP043405.1\|WP_003088900.1\|2084777_2085851_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	cas7	pfam09344_cas7_CAS-I-E	gnl\|CDD\|378153
NZ_CP043405.1\|WP_081600747.1\|2088119_2090822_-\|CRISPR-associated-helicase/endonuclease-Cas3	cas3	cd09639_cas3_CAS-I	gnl\|CDD\|182031
NZ_CP043405.1\|WP_003088903.1\|2085840_2086437_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	cse2gr11	mkCas0194_cse2gr11_CAS-I-E	gnl\|CDD\|378191
NZ_CP043405.1\|WP_003088876.1\|2068292_2068718_-\|galactose-6-phosphate-isomerase-subunit-LacA	unknown	unknown	gnl\|CDD\|181505
NZ_CP043405.1\|WP_003088867.1\|2065833_2066814_-\|tagatose-bisphosphate-aldolase	unknown	unknown	gnl\|CDD\|183502
NZ_CP043405.1\|WP_003088875.1\|2067763_2068279_-\|galactose-6-phosphate-isomerase-subunit-LacB	unknown	unknown	gnl\|CDD\|181506
NZ_CP043405.1\|WP_003088898.1\|2084037_2084763_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	cas5	cd09756_cas5_CAS-I-E	gnl\|CDD\|187886
NZ_CP043405.1\|WP_003088894.1\|2081549_2082452_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|378244

Protein	Function_ID	Function_description	E-value
NZ_CP043405.1\|WP_003088883.1\|2077945_2078218_+\|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin	gnl\|CDD\|274102	TIGR02384, Putative_antitoxin_RelB, addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species. [Cellular processes, Toxin production and resistance, Mobile and extrachromosomal element functions, Other].	6.34118e-18
NZ_CP043405.1\|WP_003088877.1\|2068977_2069748_+\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	1.23891e-83
NZ_CP043405.1\|WP_003088886.1\|2078218_2078497_+\|type-II-toxin-antitoxin-system-YafQ-family-toxin	gnl\|CDD\|379750	pfam15738, YafQ_toxin, Bacterial toxin of type II toxin-antitoxin system, YafQ. YafQ is a family of bacterial toxin ribonucleases of type II toxin-antitoxin systems. The E.coli gene is expressed from the dinB operon. The cognate antitoxin for the E. coli protein is DinJ, in family RelB_antitoxin, pfam02604.	1.49557e-41
NZ_CP043405.1\|WP_003091169.1\|2091113_2092031_+\|neutral-zinc-metallopeptidase	gnl\|CDD\|282131	pfam04228, Zn_peptidase, Putative neutral zinc metallopeptidase. Members of this family have a predicted zinc binding motif characteristic of neutral zinc metallopeptidases (Prosite:PDOC00129).	4.72485e-136
NZ_CP043405.1\|WP_003088905.1\|2086436_2088119_-\|type-I-E-CRISPR-associated-protein-Cse1/CasA	gnl\|CDD\|378189	pfam09481, CRISPR_Cse1, CRISPR-associated protein Cse1 (CRISPR_cse1). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This entry, represented by CT1972 from Chlorobaculum tepidum, is found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse1.	7.66285e-84
NZ_CP043405.1\|WP_003088870.1\|2066816_2067749_-\|tagatose-6-phosphate-kinase	gnl\|CDD\|237405	PRK13508, PRK13508, tagatose-6-phosphate kinase; Provisional.	0
NZ_CP043405.1\|WP_003088878.1\|2070101_2070260_-\|hypothetical-protein	gnl\|CDD\|187558	cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs. UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	1.67516e-17
NZ_CP043405.1\|WP_126417939.1\|2092434_2095074_-\|FtsX-like-permease-family-protein	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	3.99983e-15
NZ_CP043405.1\|WP_003088896.1\|2082453_2083395_-\|type-I-E-CRISPR-associated-endonuclease-Cas1	gnl\|CDD\|274693	TIGR03638, cas1_ECOLI, CRISPR-associated endonuclease Cas1, subtype I-E/ECOLI. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the ECOLI subtype of CRISPR/Cas system.	9.1934e-131
NZ_CP043405.1\|WP_003088897.1\|2083396_2084038_-\|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE	gnl\|CDD\|378050	pfam08798, CRISPR_assoc, CRISPR associated protein. This domain forms an anti-parallel beta strand structure with flanking alpha helical regions.	1.91064e-72
NZ_CP043405.1\|WP_003088880.1\|2070488_2074121_-\|helicase-exonuclease-AddAB-subunit-AddA	gnl\|CDD\|274299	TIGR02785, ATP-dependent_helicase/nuclease_subunit_A, helicase-exonuclease AddAB, AddA subunit, Firmicutes type. AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages. These DNA recombination proteins act before synapse and are particularly important for DNA repair of double-stranded breaks by homologous recombination. The term AddAB is used broadly, with AddA homologous between the Firmicutes (as modeled here) and the alphaproteobacteria, while the partner AddB proteins show no strong homology across the two groups of species. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP043405.1\|WP_003088881.1\|2074110_2077356_-\|ATP-dependent-nuclease-subunit-B	gnl\|CDD\|274291	TIGR02774, putative_ATP-dependent_exonuclease_subunit_B, ATP-dependent nuclease subunit B. DNA repair is accomplished by several different systems in prokaryotes. Recombinational repair of double-stranded DNA breaks involves the RecBCD pathway in some lineages, and AddAB (also called RecAB) in other. The AddA protein is conserved between the firmicutes and the alphaproteobacteria, while the partner protein is not. The partner may be designated AddB, as in Bacillus and in alphaproteobacteria, or RexB as in Streptococcus and Lactococcus. Note, however, that RexB proteins lack an N-terminal GxxGxGK[ST] ATP-binding motif found in Bacillus subtilis and related species, and this difference may be important; this model represents specifically RexB proteins as found in Streptococcus and Lactococcus. [DNA metabolism, DNA replication, recombination, and repair].	0
NZ_CP043405.1\|WP_003088900.1\|2084777_2085851_-\|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC	gnl\|CDD\|378153	pfam09344, Cas_CT1975, CT1975-like protein. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family is represented by CT1975 of Chlorobium tepidum.	3.02907e-159
NZ_CP043405.1\|WP_081600747.1\|2088119_2090822_-\|CRISPR-associated-helicase/endonuclease-Cas3	gnl\|CDD\|182031	PRK09694, PRK09694, CRISPR-associated helicase/endonuclease Cas3.	8.07659e-89
NZ_CP043405.1\|WP_003088903.1\|2085840_2086437_-\|type-I-E-CRISPR-associated-protein-Cse2/CasB	gnl\|CDD\|378191	pfam09485, CRISPR_Cse2, CRISPR-associated protein Cse2 (CRISPR_cse2). Clusters of short DNA repeats with non-homologous spacers, which are found at regular intervals in the genomes of phylogenetically distinct prokaryotic species, comprise a family with recognisable features. This family is known as CRISPR (short for Clustered, Regularly Interspaced Short Palindromic Repeats). A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This family of proteins, represented by CT1973 from Chlorobaculum tepidum, is encoded by genes found in the CRISPR/Cas subtype Ecoli regions of many bacteria (most of which are mesophiles), and not in Archaea. It is designated Cse2.	7.04145e-36
NZ_CP043405.1\|WP_003088876.1\|2068292_2068718_-\|galactose-6-phosphate-isomerase-subunit-LacA	gnl\|CDD\|181505	PRK08621, PRK08621, galactose-6-phosphate isomerase subunit LacA; Reviewed.	4.1844e-82
NZ_CP043405.1\|WP_003088867.1\|2065833_2066814_-\|tagatose-bisphosphate-aldolase	gnl\|CDD\|183502	PRK12399, PRK12399, tagatose 1,6-diphosphate aldolase; Reviewed.	0
NZ_CP043405.1\|WP_003088875.1\|2067763_2068279_-\|galactose-6-phosphate-isomerase-subunit-LacB	gnl\|CDD\|181506	PRK08622, PRK08622, galactose-6-phosphate isomerase subunit LacB; Reviewed.	3.23468e-124
NZ_CP043405.1\|WP_003088898.1\|2084037_2084763_-\|type-I-E-CRISPR-associated-protein-Cas5/CasD	gnl\|CDD\|187886	cd09756, Cas5_I-E, CRISPR/Cas system-associated RAMP superfamily protein Cas5. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas5 is a RAMP superfamily protein; Subunit of the Cascade complex.	2.17457e-44
NZ_CP043405.1\|WP_003088894.1\|2081549_2082452_-\|type-I-E-CRISPR-associated-endoribonuclease-Cas2	gnl\|CDD\|378244	pfam09707, Cas_Cas2CT1978, CRISPR-associated protein (Cas_Cas2CT1978). This entry represents a minor branch of the Cas2 family of CRISPR-associated protein which are found in IPR003799. Cas proteins are found adjacent to a characteristic short, palindromic repeat cluster termed CRISPR, a probable mobile DNA element.	5.36311e-36

>NZ_CP043405.1|WP_003088886.1|2078218_2078497_+|type-II-toxin-antitoxin-system-YafQ-family-toxin
MYQVKFTSAFKKSFKRMKKRGMDVSLLDDVIEKLHLGQALEDRYRDHELKGSFKGFRECHIKPDWLLIYLLEDDILTLTLVDTGSHADLFKM
>NZ_CP043405.1|WP_003088883.1|2077945_2078218_+|type-II-toxin-antitoxin-system-RelB/DinJ-family-antitoxin
MATVPTQIRIDETVKAQATSLFNDLGIDMSSAVNIFLRQCLLHDGLPFNVELPNYNSKTLEAMAEAKRISHDEAVVAYDNMSDLKKALEA
>NZ_CP043405.1|WP_003088881.1|2074110_2077356_-|ATP-dependent-nuclease-subunit-B
MKLLYTDIQYDMTEILAAEARQAAKESKRVFYLAPNSLSFEKERAVLEALPEEASFAITITRFAQMARYFVLNEPYQREVIDDNGLAMIFYRALAGFSEQDLPVFGRLKQDTNFISQLVDLYKELKASNMTVLELTELNSPEKQEDLIKIFNKAEAILNAGNFDSQSKTAFFTQQLKAGHLDSELKDLLIIVDGFTRFSAEEENLISLLHEKKVPVIIGTYISQKAYRSAFSKGNVYQASLDFMRGLAAKFKTKPEYVRSKQKGLQAFANLSSIFESRHDFSADGRTLTKEDKEHIVIWDAVNQKEEAEHVARAIRRKLYQGYRYKDILVLLGDTDAYQLQVGKIFDKYEIPYYFGKAESMSSHPLVHFIDSLERIKRYNFRAEDVMNVLKSGLYGRLQQEELDKLEYYISYADIKGQSKFFNDFTLDNQGQFDLKQLNQWRSELISPLRQLVKAQKQLGKSLLKKLTVFLEDIALPENFVLLTAESGEIEQEKHEQVWKTFTAILEQFQRIFGGEKLTLDEFLSLLRASMLAADYRTIPAAVDVVTVKAYDLVEPHTNKIVFAMGMTQSNFPKIVQNRSLISDEERARINDITPDNRRFDIVSSENLKKNHFAALSLFNAATEELILSLPQILNETEDSTSSYLLELAEFGVPIVEKGRSGQLSNPEDIGNYKALLSRVIELERASIDQEMTKEEQTFWSVAVRYLRKKLNEQGIVIPEINDSMQTKPLAPSVIKARFPADEPINLSSSALTAFYNNQYLYFLRYVLGLQELETIHPDAKNHGSYLHRVFELVMQDAAAPDDFDGRLNQAIAKANEENSFKMLYEEDEESRYSLDVLEDIARSTASILRDDAQIQVESEEEAFELMLGNAVKIRGFIDRIDRLSDGSLGIIDYKSSRNTFDIQKFYNGLSPQLLTYMEAVNNRSDLPDRQKIFGAMYLHMQEPKLDLSSVKSLDKIPEAIHKELTYRGLFLDEEKAYLADGKYHLNDSVYSQKEIDLLLAYNRELYQKAARQIRSGHFLINPYSQDGKSVQGEQLKAITHFEADRHMPYARKLHQLPRKEKRQGFLHLMQAKQEEENNDF
>NZ_CP043405.1|WP_003088880.1|2070488_2074121_-|helicase-exonuclease-AddAB-subunit-AddA
MTFKNFLSAQEIASLQLEEAESNKQQKRTPEQIEAIYSYGNNILVSASAGSGKTFVMIERIMDKILRGVKIEDLFISTFTVKAAGELKERLEKKLTQHLQTASDPKLKQFLAEELASVQTADIGTMDAFTQKLVNQYGYTLGISPSFRIMQDKSEQDILKNDVFADLFADYMRSENRSVFVKLVKNFAGSRKDSDPFKQLVYKIYDFSQATDNPKSWLTDSFLKGAETYTDFSAIPEQEVAEFLASMEDTAKALRDLTDLEDYKQLTGKGAPTANYKKHLNMIEKLQDWAWNFESLYGREGLGKLANDIADLIPSGDSVTVAKVKYPVFKALQGRLAELRHLETIFAYQAESLPLLRLLQQFVLDFSEQYLQAKMQENAFEFSDIAHFAIEILEENPDIRQLYQNKYHEVMVDEYQDNNHTQERMLELLSNGHNRFMVGDIKQSIYRFRQADPQIFNAKFKDFQEHPEHGKLILLKENFRSQSEVLATANSVFSHLMDEAVGEILYDDSHQLLAGSDRQKEAHPENATQVLLYDTDENEEALSDDDSNQISPSEVKLVAKEIIRLHNEEKVPFEDITLLVASRTRNDGIIQTFDHYGIPLVTDGGEQNYLKSVEIMVMLDTLRSIDNPLNDYALTALLRSPMFAFDEDELTRLALQKTSDSHKENLYEKMQNAINKQGQHPELMTPDLAAKLQAFLDVFGSWRRFARLHSLYDLIWKIYNDRFYYDYVGRLPRAEQRQANLYALALRANNFERTGFKGLSRFIRMIDRVLESQNDLADVEVALPKKAVTLMTIHKSKGLEFNYVFILNIDKKFSIQDMTSPLILSRRNGVGIKYLVDMKEELQEKLLPAVKVNMATLPYQLNKRELRLATLSEQMRLLYVAMTRAEKKLYLVGKGSAEKLADKYSGKSENNHLPAAERESYMTFQDWLLAIQQAFSSENLHFKTVFVTDEDLTEDKIGMVKGERLYNPDDLKDNRQSEDIARALDMLEAVEKLNKDYQAAINLPTVRTPSQVKKFYEPVMDTDGVDIMEKSPAAKLKFKLPDFSEKKAVAAAALGSSLHELMQRLRLSEEVGMNDILQALEELPAEADIKKAIQTDKILAFFQTTDLGKLIQKNADKVRREAPFAMLETDSASGEKFVVRGIIDGYILFENRIILFDYKTDKFTNSQDIKQRYQGQMALYAQALSKSYGISAVEKYLILLGGEQLEVVSV
>NZ_CP043405.1|WP_003088878.1|2070101_2070260_-|hypothetical-protein
MKNTVTGFSNLQTLEAARKVTGKEISAKKADRRLGDPDILIASSEKARKILG
>NZ_CP043405.1|WP_003088877.1|2068977_2069748_+|DeoR/GlpR-transcriptional-regulator
MIKKERLNWILEQLKHQSIITVNDIIKELGVSDMTVRRDLAELEKEHQLIRVHGGAQSINLLNKPEKSNTEKQSEQVSEKKEIAAFTAQRVQDGETIFIGPGTTLEYFAQELLQRNLRIITNSLPVFDILKESPNIDLLLIGGEYRPVTGAFVGSLASSNIASLTFSKAFISANAVYQDSVATYSESEGTIQELALDKALEKYLLVDNQKFDSYDFFVFYKTSDFDYVVTDSKLSDDKQALYNKFTKVLKANTNSQ
>NZ_CP043405.1|WP_003088876.1|2068292_2068718_-|galactose-6-phosphate-isomerase-subunit-LacA
MAIVLGADKAGERLKNLVKDYLQAKGFDVTDVSAEGQDFVDLTLAVAAEVDKADDNLGVVIDAYGAGSFMVATKVKGMIAAEVSDERSAYMTRAHNNARIITMGAEIVGDELAKNIVKGFVEGHYDGGRHQIRVDMLNKMC
>NZ_CP043405.1|WP_003088875.1|2067763_2068279_-|galactose-6-phosphate-isomerase-subunit-LacB
MKIAIGCDHIVTDEKMAVSEFLKSKGYEVLDFGTYDHVRTHYPIFGKKVGEAVSSGQADLGVCICGTGVGISNAANKVPGVRSALVRDMTSALYAKEELNANVISFGGKIVGGLLMNDIIEAFIKAEYKETEENKKLIAKIAHVETSNADQKDPDFFKEFLDKWDRGEYHD
>NZ_CP043405.1|WP_003088870.1|2066816_2067749_-|tagatose-6-phosphate-kinase
MILTVTMNPSIDVSYPLDKLKLDTVNRVSEVTKTPGGKGLNVTRVLAEVGDDVSATGLIGGRLGDYLTEKLTQAGIKHQFFPIHGETRNCIAILHEGLQTEILESGPLIDPDEAEGFLHHFKLILTSFDVVTISGSLPEGLEKTYYAELIGLANLYRKKVVLDCSGAALEAVLKSSEKPAVIKPNSEELSQLLGRDISEDTDSLKDVLLDPLFEGIEWIIVSLGADGAFAKHRDKFYKVDIPKIDVVNPVGSGDSTVAGIASALAHDEDDASLLKKANVLGMLNAQEKMTGHVNMANYDTLYQQIQVKEV
>NZ_CP043405.1|WP_003088867.1|2065833_2066814_-|tagatose-bisphosphate-aldolase
MVLTEQKRKYMEKLSDENGIISALAFDQRGALKRLMAQHQTQEPSVAQMEELKVLVAQELTPYASSMLLDPEYGLPATKALDKNAGLLLAYEKTGYDTTSTKRLPDCLDVWSAKRLKEQGADAVKFLLYYDVDSSDELNQQKQAYIERIGSECVAEDIPFFLEILAYDEKIADAASPEYAKVKPHKVIEAMKVFSNPRFNIDVLKVEVPVNMNYVEGFGNGETVYSKAEAAAFFKQQDQATDLPYIYLSAGVSAKLFQDTLVFAHESGANFNGVLCGRATWAGSVKDYIEQGEEAARQWLRTTGFQNIDELNKVLQKTATSWKEKV
>NZ_CP043405.1|WP_003088894.1|2081549_2082452_-|type-I-E-CRISPR-associated-endoribonuclease-Cas2
MPLTVITLKSVPQSLRGDLTKWMQEIATGVFVGNFNTKVREQLWERVQDSVGSGEATLSYAYRNEIGYQFATINAQREVVDFDGIPLIRFPLDPEEGRKQDVFGYSDAARFRKARKFASPTKTIQHAVKPYVILDIETDGLDENKNKIIEIGAIKVSGSELKECHYLVQCDNTLPKEIVQLTGITDDMLQQEGVDIELALNGLLNFIGSLDIVGYGVNFDLTFINTKLTDLGYPVITNSVYDLMKYVKSEKLFLENYKLQTVLKSYGIDEKVPHRALLDARLILDLSTKVNKFLTRINQK
>NZ_CP043405.1|WP_003088896.1|2082453_2083395_-|type-I-E-CRISPR-associated-endonuclease-Cas1
MKKQNGAKKTSLRELPKISDRVSFLYVEHAKINRVDSAITIADSRGVVRIPAAMLGVLLLGPGTDISHRAVELIGDTGTSMVWVGERGVRQYAHGRALAHSTKFLEKQAKLFSNTRSRLKVARKMYQMRFPNEDVSALTLQQLRGREGARIRSVYRTYSREYGVPWDKREYSPDDFESGTIVNQALSAANVALYGLVHSIIVALGASPGLGFVHTGHDLSFVYDVADLYKAETTIPLAFKIASESQEDDDIGKIARLKVRDSFVDGKLMTRMVKDIQYLLDIGDEEELLVDIIALWDDKDNLVKHGVSYREGD
>NZ_CP043405.1|WP_003088897.1|2083396_2084038_-|type-I-E-CRISPR-associated-protein-Cas6/Cse3/CasE
MYISRVEIDHANRRKIKDLTHVDAYHGWVESSFPAEIEKSIRTRKLWRVDTIKGRNYLIVVSQGKPDLSLLEKYGVSGSAQTKPYDPFLENLKPGDNFQFRVVLNPVISLSNRDHSKRGVVKPHVTVERQMQYLMDRSEKNGFSLREGDFSVVERGYEVLKKSTMKPVRLVKAVYEGVLTITDVELFRKVLTDGIGKKKAYGFGLMTVIPIGK
>NZ_CP043405.1|WP_003088898.1|2084037_2084763_-|type-I-E-CRISPR-associated-protein-Cas5/CasD
MKTILLKFSGPLQAWGTRSHFETRHTDFYPSKSAVIGLIAACLGHRRDEDEKIKQLNEIDFAVRVDQQGNLMRDFHIAQKYKTSGEFERSYVTNRYYLEDAIFVVAISHADDEFMTTIEKGLRNLYFQPFMGRRSCPVPADFVLGTGSENVVNTLHTLEWQADEWYMKKHSGEAGFSLEIYMDSHLTKNNHYQLRQDRVVSFSQKERRFGFRYESRMIVPVQNPFYKKNTDHNVFDFIGEE
>NZ_CP043405.1|WP_003088900.1|2084777_2085851_-|type-I-E-CRISPR-associated-protein-Cas7/Cse4/CasC
MTTSQSKLFLDIHVIQTLPPSNINRDDTGSPKTAQYGGVRRARVSSQSWKRVMREYFNTNGKQSNVGIRTKEIVQYIADKMMELDSAISNDDALKKADNILNKGGIKTKDFKSKALFFLSDTQAKQLAQAAIDSVNDKKELQKMITSSPAIDIALFGRMVADDPSLNEDASSQVAHAISTHAVQTEFDFFTAVDDLAPEDNAGAGMLGTVEFNSSTLYRYANVAIHDLALQLDDTESVVNAVKLFVEAFANSLPTGKVNTFANQTLPQTLVVTVRTDRPVNLVSAFEKPVKSSEGYVKESIEKLANEFTKVEKMVKKSDLTFYVSLEEVAELSTIGVEKNSLPELLEDLSKELVNLM
>NZ_CP043405.1|WP_003088903.1|2085840_2086437_-|type-I-E-CRISPR-associated-protein-Cse2/CasB
MPEESNGTVYSVTKKIVTKLTNQLDTSAGKAMLARLRHSAGKPISEAKEVWPILFENLPETFLSQYDDASYEETAILTAIQLYALYQQGRAQSVFDEVAEKHQNIGYSLKNLRREEDTIAVDRRFNTMITATTFDELTHHLRHLVTLLKAKSPETKIDFARLSADLYWFLRDYPETVRLNWARQYYKHSSKEEEENDN
>NZ_CP043405.1|WP_003088905.1|2086436_2088119_-|type-I-E-CRISPR-associated-protein-Cse1/CasA
MGKFNLLNEPWVSVVYDDRGATKEVSLLDLFQNAHNYKDLAGDTKTQDFAVLRVLLAVLHTVFSRFDANGQVYEYLEVDERFRQLEAVDEADLIDYEDDLYDTWVNLWNRGQFPEIVSHYLEKWRDRFYLFDEDYPFFQVRKEDISEEKINKAKAGSVSGKFINRTISESGNKVSLFAPRSSQKKELLGFGEIARWLLAFQGYTGTGDKTKFNNLDNEVKLSKGWLFDIGAIFVKGENLYETLLLNCILPYSQRDNLEHIQRPCWELASKELLEEYLSGKAINNLSSLYTSWSRSVYINPEIGLETPFSVQIVKLPEVPHQDNFLEPFTLWKYNLSGESKGSHTPNKHSVNQSLWRSFALLTTTVDNQRKPGIIDWLDVLKEEIGEQQIILNAVSMQDDGNATSWLPTDEIIDTLSINEFVLTDLHEKGWVTRINDVVEETKTVVSRTYRKFITDIREIRNIKSDAFTSQKVEECYFKIDQPFRQWLSSIQYEDEKDQKVFEWRGELKRLVLEEAKTLLHEGGPRDYIGIVDKDKGTVKNIATAYDHFTYWLNQNVKEGK
>NZ_CP043405.1|WP_081600747.1|2088119_2090822_-|CRISPR-associated-helicase/endonuclease-Cas3
MQHLEDTMNVAGLLWEHWLGEGQRQLIEASLSSSQSNDDFGKQVIQFLAATHDLGKATPAFQTQKGYANSEDLDIQLLEKLERAGFAGISFVDLANPRESHHSIAGQYLLSRYGVHDDLATIVGGHHGKPIDNITDYTNQKAYESNFFQTEKPDSTIYRKWDRAQRDIFEWALEVSGFSSVEELPRVKQPAQVILSGLLIMADWIASNESYFPLISVEENEVGNKVNRLETGFMAWRQSGLWESSIKETRDIFERRFRFVPHDVQRVLSDKILQSQRPGIFILEAPMGIGKTEAALVAAEQLAAKTGRNGLYFGLPTQATSNGIFPRIEKWLESIAAEQNVDDHLSIHLVHGKAALNEKFAEILRSTNINIDESDNGSVVVNEWFSGRKTTALDDFVVGTVDQFLMVALKQKHLALRHLGFSKKVVVIDEVHAYDAYMNQYLLEAVKWMGAYGVPVVILSATLPADRRVELIINYLDGMGRKIRKPERKSLVDKFGSESYPVITYTDGFDIYQETDFPKRDNKNMVISRLQEEDLIETIENQLSGGGIVGLIVNTVRRAQDLAKRLSEKFGEDIVELLHSGFIATDRIRKEQNLLQMIGKGADRPKKKIIVGTQVIEQSLDIDFDVLISDLAPMDLLIQRMGRLHRHDIKRPVNHQRPYFYVLGMTDNLDFESGTSFVYGDYLLIRTQYFLPDTVTIPEDISSLVQKVYRNSDIDFEDENLNKKYQVAKNGHDVKIERQENKAKNYRIADPILVESISHKGNLIGWLKNPNLSESEETSYSQVRDIEETIEVIALKKVESGYGLFGKDKDISDYITDYQLAREVAQNTLRLPQSLSKSYNIDQSIKELENYNNQHLPTWRKSTWLKGALGIIFDENNEFVLNGRKLRYNEKYGISMEEVE
>NZ_CP043405.1|WP_003091169.1|2091113_2092031_+|neutral-zinc-metallopeptidase
MKTDKLKESNNIEDRRGEESGAYGGDGSSIGSNLLLQLLFSRGSWKSKLVILIILLFIGGASGLGSILTGDNTNNSSPYQSSQVTRKKGTDVSSEETKFVSKVLASTEEFWTKKFKEEGLSYKKPKLVFYTDHIRTGCGQGQASAGPFYCSADQKIYLDISFYQELSSKYKAAGDFAMAYVIAHEVGHHVQNELGTMSDYNQKRQGLSETQANALNVRLELQADYYAGAWAKYVEGEGLLDTGDIEEAMRAAHAVGDDTLQKEAYGRTVPDSFTHGTSEQRQNWFNRGYKYGDIKHGDTFSADSL
>NZ_CP043405.1|WP_126417939.1|2092434_2095074_-|FtsX-like-permease-family-protein
MMKKTYWKDIWRSIRKSKARFLSILLLLMLGSFALVGLKVTGPDMKHSAAEYLKKHNTMDLTVIANYGLSRDDKEELNSLKQAQVDYGYMTDVTIKGTDSAVRVYSKADKISTYAINSGRLPKNSQEIALDVTLRDDYKIGDEISFTQSQQDLLKKSTYRIVGFVTSSEIWSKTNMGASTAGDGSLSNYALVSDTAFKSNTYTIARIRYDDLKNLNPFSDTYAKKLIKHQEELDSLLKDNGKKRLENLQAAAQKKVDDSKKQVKTAKDQLAGQKSALSYLSGSQLTAAQKAVAEAEKKISKNEDDIKKAQADIAAMPEPSYSSYNRSTLPGGGGYQTFSSSSDSVSAIGNLFPVVLYLVAVLVTFTTMTRFVDEERTNSGVLKALGYSDRDIIRKFVIYGAVASIIGAVLGILAGHYVLAPIISSSTTSSLTFQQMHYYFYWNYALLALTVAFLSAVLPAFLVAKKELAEKPAQLLLPKPPVKGSKILLEKIPFIWNRLTFTHKVTARNIFRYKQRMLMTVFGVAGSAALLFAGLGIQSSLGKLINNQFNHITPYDLLLVENDEASETEQSALSQAVKSKDISQTMPIFYKQVDEKIAGITDKQSVSLTVSAHENFDHFINLKNIKNGKKLNLTDNGVIITELLARYYHVEAGDSFRFTDENGKKVRLKVAAVAEMNVGHYLFMTDKYYHRKFDERAKNNAYFINLKDSSSANISDKATELLAMDGVSAVSQKSSIVNTVDLVVKSLNGAMTVLIIVSVLLALVILYNLTNINVAERIRELSTIKVLGFYDQEVTMYIYRETISLSLIGILLGLLAGHYLHEIIMAMIGNDNIMFGSIIDSYIYAVPVFTVVFILLILGLMVNRRLKNLNMLEALKSAD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP043405_3	3.9\|1976986\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976986-1977015	30	NC_027120	Lactococcus phage 1358, complete sequence	31286-31315	5	0.833
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP041067	Bacillus megaterium strain KNU-01 plasmid pKNU_01_3, complete sequence	29390-29419	6	0.8
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_024215	Lactococcus phage P078, complete genome	36173-36204	6	0.812
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_024208	Lactococcus phage P118, complete genome	36231-36262	6	0.812
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_024214	Lactococcus phage P162, complete genome	37033-37064	6	0.812
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_024203	Lactococcus phage P092, complete genome	35648-35679	6	0.812
NZ_CP043405_5	5.8\|2081466\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081466-2081497	32	NC_048651	Aeribacillus phage AP45, complete genome	51488-51519	6	0.812
NZ_CP043405_3	3.5\|1976722\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976722-1976751	30	MK448885	Streptococcus phage Javan252, complete genome	20289-20318	7	0.767
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	MN693504	Marine virus AFVG_25M410, complete genome	20496-20525	7	0.767
NZ_CP043405_3	3.9\|1976986\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976986-1977015	30	NC_047861	Bordetella phage vB_BbrM_PHB04, complete genome	10048-10077	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	CP016281	Clostridium tyrobutyricum strain W428 plasmid pW428, complete sequence	6967-6996	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP014171	Clostridium tyrobutyricum strain KCTC 5387 plasmid pCTK01, complete sequence	29773-29802	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250021	Prevotella phage Lak-B2, complete genome	321978-322007	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250024	Prevotella phage Lak-B5, complete genome	316000-316029	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250028	Prevotella phage Lak-B9, complete genome	320890-320919	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250023	Prevotella phage Lak-B4, complete genome	323604-323633	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250025	Prevotella phage Lak-B6, complete genome	319192-319221	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250022	Prevotella phage Lak-B3, complete genome	319207-319236	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250027	Prevotella phage Lak-B8, complete genome	322296-322325	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250026	Prevotella phage Lak-B7, complete genome	321354-321383	7	0.767
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK250020	Prevotella phage Lak-B1, complete genome	320873-320902	7	0.767
NZ_CP043405_5	5.1\|2081037\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081037-2081068	32	NC_019538	Aeromonas phage CC2, complete genome	22566-22597	7	0.781
NZ_CP043405_3	3.6\|1976788\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976788-1976817	30	NZ_CP033045	Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence	229531-229560	8	0.733
NZ_CP043405_3	3.7\|1976854\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976854-1976883	30	EU330206	Enterobacteria phage phiEco32, complete genome	9755-9784	8	0.733
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_LR214939	Mycoplasma salivarium strain NCTC10113 plasmid 2	181804-181833	8	0.733
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NC_013940	Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence	83426-83455	8	0.733
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NC_031020	Morganella phage vB_MmoM_MP1, complete genome	70395-70424	8	0.733
NZ_CP043405_5	5.7\|2081405\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081405-2081436	32	MH533020	Acinetobacter phage ABPH49, complete genome	122162-122193	8	0.75
NZ_CP043405_5	5.8\|2081466\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081466-2081497	32	NZ_CP007741	Bacillus methanolicus MGA3 plasmid pBM19, complete sequence	1412-1443	8	0.75
NZ_CP043405_5	5.8\|2081466\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081466-2081497	32	MK215646	Bacillus phage vB_BthM-Goe5, complete genome	1973-2004	8	0.75
NZ_CP043405_5	5.8\|2081466\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081466-2081497	32	MK215646	Bacillus phage vB_BthM-Goe5, complete genome	157198-157229	8	0.75
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	MK977711	Streptomyces phage Evy, complete genome	45926-45955	9	0.7
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	KM652554	Streptomyces phage Jay2Jay, complete genome	46779-46808	9	0.7
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	MN369743	Streptomyces phage Tribute, complete genome	45502-45531	9	0.7
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	MF358541	Streptomyces phage Warpy, complete genome	46292-46321	9	0.7
NZ_CP043405_3	3.8\|1976920\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1976920-1976949	30	MF358542	Streptomyces phage Sushi23, complete genome	46033-46062	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	AP014124	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C41-MedDCM-OCT-S34-C48, * SEQUENCING IN PROGRESS *	6036-6065	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	51264-51293	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP026740	Bacillus megaterium strain YC4-R4 plasmid unnamed4	33045-33074	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP034238	Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence	75078-75107	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	38214-38243	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP010587	Bacillus megaterium Q3 plasmid p1, complete sequence	38588-38617	9	0.7
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	NZ_CP023319	Bacillus megaterium strain A plasmid p2, complete sequence	37086-37115	9	0.7
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	MH617343	Inoviridae sp. isolate ctda12, complete genome	4722-4753	9	0.719
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NZ_CP038617	Arsenophonus nasoniae strain FIN plasmid pArsFIN5, complete sequence	84518-84549	9	0.719
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_019909	Yersinia phage phiR1-RT complete genome	131481-131512	9	0.719
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	NC_028820	Yersinia phage vB_YenM_TG1, complete genome	122242-122273	9	0.719
NZ_CP043405_5	5.3\|2081159\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081159-2081190	32	MH536823	Microbacterium phage Musetta, complete genome	44178-44209	9	0.719
NZ_CP043405_5	5.3\|2081159\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081159-2081190	32	MH371108	Microbacterium phage Fork, complete genome	43458-43489	9	0.719
NZ_CP043405_5	5.3\|2081159\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081159-2081190	32	MH371109	Microbacterium phage Lyell, complete genome	43657-43688	9	0.719
NZ_CP043405_5	5.3\|2081159\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081159-2081190	32	NZ_AP021860	Alteromonas sp. I4 plasmid pAltI4, complete sequence	13125-13156	9	0.719
NZ_CP043405_5	5.5\|2081282\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081282-2081313	32	NC_048047	Caulobacter phage CcrBL9, complete genome	189681-189712	9	0.719
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MT001829	Salmonella phage SE_PL, complete genome	281718-281747	10	0.667
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK773491	Salmonella phage 7t3, complete genome	67018-67047	10	0.667
NZ_CP043405_3	3.10\|1977052\|30\|NZ_CP043405\|CRISPRCasFinder,CRT,PILER-CR	1977052-1977081	30	MK268344	Salmonella phage Munch, complete genome	3673-3702	10	0.667
NZ_CP043405_5	5.2\|2081098\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081098-2081129	32	MN694783	Marine virus AFVG_250M759, complete genome	25106-25137	10	0.688
NZ_CP043405_5	5.5\|2081282\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081282-2081313	32	MH588547	Caulobacter phage CcrSC, complete genome	189929-189960	10	0.688
NZ_CP043405_5	5.7\|2081405\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081405-2081436	32	NZ_CP044425	Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence	392109-392140	10	0.688
NZ_CP043405_5	5.8\|2081466\|32\|NZ_CP043405\|PILER-CR,CRISPRCasFinder,CRT	2081466-2081497	32	NZ_CP021671	Bacillus licheniformis strain SRCM100141 plasmid pBL141-1 sequence sequence	384-415	11	0.656

1. spacer 3.9|1976986|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NC_027120 (Lactococcus phage 1358, complete sequence) position: , mismatch: 5, identity: 0.833

ccaaaaacgtcgataaatgtatcaaaatca	CRISPR spacer
cgaaaaacgtcgataaaagtattaaaattc	Protospacer
* *************** ****.*****.

2. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP041067 (Bacillus megaterium strain KNU-01 plasmid pKNU_01_3, complete sequence) position: , mismatch: 6, identity: 0.8

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atcgttttaaacctattttcaataaaagag	Protospacer
*** ******* ***********.  **.*

3. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_024215 (Lactococcus phage P078, complete genome) position: , mismatch: 6, identity: 0.812

--ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aactcat--ataaatcagcataagaaacattata	Protospacer
  *****  .******* *** ***********

4. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_024208 (Lactococcus phage P118, complete genome) position: , mismatch: 6, identity: 0.812

--ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aactcat--ataaatcagcataagaaacattata	Protospacer
  *****  .******* *** ***********

5. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_024214 (Lactococcus phage P162, complete genome) position: , mismatch: 6, identity: 0.812

--ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aactcat--ataaatcagcataagaaacattata	Protospacer
  *****  .******* *** ***********

6. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_024203 (Lactococcus phage P092, complete genome) position: , mismatch: 6, identity: 0.812

--ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aactcat--ataaatcagcataagaaacattata	Protospacer
  *****  .******* *** ***********

7. spacer 5.8|2081466|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_048651 (Aeribacillus phage AP45, complete genome) position: , mismatch: 6, identity: 0.812

aaaataaaaactcttgaaaatcaagggttttt	CRISPR spacer
atttttaaaacccttgaaaatcaagggttttg	Protospacer
*   * *****.*******************

8. spacer 3.5|1976722|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK448885 (Streptococcus phage Javan252, complete genome) position: , mismatch: 7, identity: 0.767

aaagacattcaaactgctatccgcttgtta	CRISPR spacer
caagacattcaaacagctatccgcggtctt	Protospacer
 ************* *********   .*

9. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MN693504 (Marine virus AFVG_25M410, complete genome) position: , mismatch: 7, identity: 0.767

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gcatagttgtctgtcaggtcaaaagagttt	Protospacer
.********.****.********** . *

10. spacer 3.9|1976986|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NC_047861 (Bordetella phage vB_BbrM_PHB04, complete genome) position: , mismatch: 7, identity: 0.767

ccaaaaacgtcgataaatgtatcaaaatca	CRISPR spacer
cttttcacgtcgatcaatgtctcaaaatca	Protospacer
*.    ******** ***** *********

11. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to CP016281 (Clostridium tyrobutyricum strain W428 plasmid pW428, complete sequence) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
agctttgtaaaactattttcaattactgct	Protospacer
* **** ****************  * *

12. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP014171 (Clostridium tyrobutyricum strain KCTC 5387 plasmid pCTK01, complete sequence) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
agctttgtaaaactattttcaattactgct	Protospacer
* **** ****************  * *

13. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250021 (Prevotella phage Lak-B2, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

14. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250024 (Prevotella phage Lak-B5, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

15. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250028 (Prevotella phage Lak-B9, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

16. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250023 (Prevotella phage Lak-B4, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

17. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250025 (Prevotella phage Lak-B6, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

18. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250022 (Prevotella phage Lak-B3, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

19. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250027 (Prevotella phage Lak-B8, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

20. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250026 (Prevotella phage Lak-B7, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

21. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK250020 (Prevotella phage Lak-B1, complete genome) position: , mismatch: 7, identity: 0.767

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atatttttaaaattattttcaatacatgta	Protospacer
** *********.**********.*  * .

22. spacer 5.1|2081037|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_019538 (Aeromonas phage CC2, complete genome) position: , mismatch: 7, identity: 0.781

aaaaaacaaggtcacaaaacgtctttggataa---	CRISPR spacer
aaacaacaagctcacaaaacgtc---gtacaagcc	Protospacer
*** ****** ************   * *.**

23. spacer 3.6|1976788|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP033045 (Bacillus foraminis strain Bac44 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

ggcaagccttgaaaactatcttttgtatca	CRISPR spacer
tgcaggccttgaaaactatcttgtaatttt	Protospacer
 ***.***************** *.  *.

24. spacer 3.7|1976854|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to EU330206 (Enterobacteria phage phiEco32, complete genome) position: , mismatch: 8, identity: 0.733

ccagtagctatccttgatgatatagtgcac	CRISPR spacer
ggaaaagctatccttgatgaaatagtagag	Protospacer
  *. *************** *****. *

25. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_LR214939 (Mycoplasma salivarium strain NCTC10113 plasmid 2) position: , mismatch: 8, identity: 0.733

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atttttttaacactattttcaattaattgt	Protospacer
**.******* ************     *

26. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NC_013940 (Deferribacter desulfuricans SSM1 megaplasmid pDF308, complete sequence) position: , mismatch: 8, identity: 0.733

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ctagacttaaaactatttttaatgccaaag	Protospacer
 *   .*************.*******..*

27. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NC_031020 (Morganella phage vB_MmoM_MP1, complete genome) position: , mismatch: 8, identity: 0.733

atctttttaaaactattttca-------atgccaggg	CRISPR spacer
atctttttaaaactagtttcatatagttat-------	Protospacer
*************** *****       **

28. spacer 5.7|2081405|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH533020 (Acinetobacter phage ABPH49, complete genome) position: , mismatch: 8, identity: 0.75

-ggttacatctggcaagtcgacgctgacggcac	CRISPR spacer
ctgtca-atctgggaagtcgacgctgaaggtta	Protospacer
  **.* ****** ************* **.

29. spacer 5.8|2081466|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP007741 (Bacillus methanolicus MGA3 plasmid pBM19, complete sequence) position: , mismatch: 8, identity: 0.75

aaaataaaaactcttgaaaatcaagggttttt	CRISPR spacer
taaatataaactattgaaaatcaatttgttct	Protospacer
 ***** ***** ***********    **.*

30. spacer 5.8|2081466|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MK215646 (Bacillus phage vB_BthM-Goe5, complete genome) position: , mismatch: 8, identity: 0.75

aaaataaaaactcttgaaaatcaagggttttt	CRISPR spacer
agtgtaaaaactcttgacaatcaatggagtct	Protospacer
*. .************* ****** **  *.*

31. spacer 5.8|2081466|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MK215646 (Bacillus phage vB_BthM-Goe5, complete genome) position: , mismatch: 8, identity: 0.75

aaaataaaaactcttgaaaatcaagggttttt	CRISPR spacer
agtgtaaaaactcttgacaatcaatggagtct	Protospacer
*. .************* ****** **  *.*

32. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK977711 (Streptomyces phage Evy, complete genome) position: , mismatch: 9, identity: 0.7

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gagatgttgcctgtgaggtcaacagcaaat	Protospacer
. .  ********* ******* *****

33. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to KM652554 (Streptomyces phage Jay2Jay, complete genome) position: , mismatch: 9, identity: 0.7

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gagatgttgcctgtaaggtcaacagcaaat	Protospacer
. .  ********* ******* *****

34. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MN369743 (Streptomyces phage Tribute, complete genome) position: , mismatch: 9, identity: 0.7

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gagcggttgcctgtaaggtcaacagcaaat	Protospacer
. ...********* ******* *****

35. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MF358541 (Streptomyces phage Warpy, complete genome) position: , mismatch: 9, identity: 0.7

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gagacgttgcctgtaaggtcaacagcaaat	Protospacer
. .  ********* ******* *****

36. spacer 3.8|1976920|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MF358542 (Streptomyces phage Sushi23, complete genome) position: , mismatch: 9, identity: 0.7

acatagttgcctgttaggtcaaaagcaata	CRISPR spacer
gagcggttgcctgtaaggtcaacagcaaat	Protospacer
. ...********* ******* *****

37. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to AP014124 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C41-MedDCM-OCT-S34-C48, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
atttttttaaaactattttcaacaattctt	Protospacer
**.*******************.. .

38. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ttctttttaaacctattttcaaaagtttga	Protospacer
 ********** ********** . .  *.

39. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP026740 (Bacillus megaterium strain YC4-R4 plasmid unnamed4) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ttctttttaaacctattttcaaaagtttga	Protospacer
 ********** ********** . .  *.

40. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP034238 (Aliivibrio salmonicida strain VS224 plasmid pRVS1-224, complete sequence) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
gactttttaatactatttttaatgctcttt	Protospacer
. ******** ********.*****.

41. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ttctttttaaacctattttcaaaagtttga	Protospacer
 ********** ********** . .  *.

42. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP010587 (Bacillus megaterium Q3 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ttctttttaaacctattttcaaaagtttga	Protospacer
 ********** ********** . .  *.

43. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP023319 (Bacillus megaterium strain A plasmid p2, complete sequence) position: , mismatch: 9, identity: 0.7

atctttttaaaactattttcaatgccaggg	CRISPR spacer
ttctttttaaacctattttcaaaagtttga	Protospacer
 ********** ********** . .  *.

44. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH617343 (Inoviridae sp. isolate ctda12, complete genome) position: , mismatch: 9, identity: 0.719

ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aaaatctgtaaaccaccattagaaacaagagt	Protospacer
   *** *****.**************  * .

45. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP038617 (Arsenophonus nasoniae strain FIN plasmid pArsFIN5, complete sequence) position: , mismatch: 9, identity: 0.719

ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
ggcatcagtaaatcacaattacaaaatctcac	Protospacer
  ************** **** ***  .*  *

46. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_019909 (Yersinia phage phiR1-RT complete genome) position: , mismatch: 9, identity: 0.719

-----ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aaagcttc-----taaatcacctttaaaaacattatt	Protospacer
     .**     ********* ***.*********.

47. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_028820 (Yersinia phage vB_YenM_TG1, complete genome) position: , mismatch: 9, identity: 0.719

-----ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
aaagcttc-----taaatcacctttaaaaacattatt	Protospacer
     .**     ********* ***.*********.

48. spacer 5.3|2081159|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH536823 (Microbacterium phage Musetta, complete genome) position: , mismatch: 9, identity: 0.719

atcatataaacctctgttttattgctcatttt	CRISPR spacer
tcgacgcgaacctctgctgtattgctcatttt	Protospacer
 . *....********.* *************

49. spacer 5.3|2081159|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH371108 (Microbacterium phage Fork, complete genome) position: , mismatch: 9, identity: 0.719

atcatataaacctctgttttattgctcatttt	CRISPR spacer
tcgacgcgaacctctgctgtattgctcatttt	Protospacer
 . *....********.* *************

50. spacer 5.3|2081159|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH371109 (Microbacterium phage Lyell, complete genome) position: , mismatch: 9, identity: 0.719

atcatataaacctctgttttattgctcatttt	CRISPR spacer
tcgacgcgaacctctgctgtattgctcatttt	Protospacer
 . *....********.* *************

51. spacer 5.3|2081159|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_AP021860 (Alteromonas sp. I4 plasmid pAltI4, complete sequence) position: , mismatch: 9, identity: 0.719

atcatataaacctctgttttattgctcatttt	CRISPR spacer
agagtattaacctctgttttaatgctcttaaa	Protospacer
*  .*** ************* ***** *

52. spacer 5.5|2081282|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NC_048047 (Caulobacter phage CcrBL9, complete genome) position: , mismatch: 9, identity: 0.719

accgcatcagttggaacatctgcaacacggcc	CRISPR spacer
tctgcatcagttggatcgtctgcaacctgatg	Protospacer
 *.************ *.******** .*..

53. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MT001829 (Salmonella phage SE_PL, complete genome) position: , mismatch: 10, identity: 0.667

atctttttaaaactattttcaatgccaggg	CRISPR spacer
tactttttaaaactcttttcaatctttctt	Protospacer
  ************ ******** ..

54. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK773491 (Salmonella phage 7t3, complete genome) position: , mismatch: 10, identity: 0.667

atctttttaaaactattttcaatgccaggg	CRISPR spacer
tactttttaaaactcttttcaatctttctt	Protospacer
  ************ ******** ..

55. spacer 3.10|1977052|30|NZ_CP043405|CRISPRCasFinder,CRT,PILER-CR matches to MK268344 (Salmonella phage Munch, complete genome) position: , mismatch: 10, identity: 0.667

atctttttaaaactattttcaatgccaggg	CRISPR spacer
tactttttaaaactcttttcaatctttctt	Protospacer
  ************ ******** ..

56. spacer 5.2|2081098|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MN694783 (Marine virus AFVG_250M759, complete genome) position: , mismatch: 10, identity: 0.688

ctcatcagtaaatcaccattagaaacattatc	CRISPR spacer
tctaatgttaaatcaccacttgaaacattata	Protospacer
...* .. **********.* **********

57. spacer 5.5|2081282|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to MH588547 (Caulobacter phage CcrSC, complete genome) position: , mismatch: 10, identity: 0.688

accgcatcagttggaacatctgcaacacggcc	CRISPR spacer
tttgcatcagttggatcgtctgcaacctgatg	Protospacer
 ..************ *.******** .*..

58. spacer 5.7|2081405|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP044425 (Paracoccus pantotrophus strain DSM 2944 plasmid pPAN2, complete sequence) position: , mismatch: 10, identity: 0.688

ggttacatctggcaagtcgacgctgacggcac	CRISPR spacer
gaacggatcgggcaagtcgacgctgatgggga	Protospacer
*. .. *** ****************.** .

59. spacer 5.8|2081466|32|NZ_CP043405|PILER-CR,CRISPRCasFinder,CRT matches to NZ_CP021671 (Bacillus licheniformis strain SRCM100141 plasmid pBL141-1 sequence sequence) position: , mismatch: 11, identity: 0.656

aaaataaaaactcttgaaaatcaagggttttt	CRISPR spacer
gaaatgaaaactcttgaaaatgaaaaagcaaa	Protospacer
.****.*************** **... .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

101985 : 110677

Staphylococcus_phage(57.14%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003089116.1\|101985_104145_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	1.2e-258	61.8
WP_003089117.1\|104605_105571_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	2.7e-125	69.5
WP_003089118.1\|105670_106144_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.4e-39	52.0
WP_003089119.1\|106158_107334_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	5.8e-98	48.2
WP_003089121.1\|107326_107935_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.7e-30	36.5
WP_003089123.1\|107940_108996_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	4.9e-40	31.6
WP_003089125.1\|109546_110677_-	acetylornithine transaminase	A0A1V0SKB7	Klosneuvirus	8.8e-27	27.9

DBSCAN-SWA_2

572476 : 584181

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003090064.1\|572476_573115_-	transglycosylase SLT domain-containing protein	Q4Z8Z7	Staphylococcus_phage	6.7e-24	86.2
WP_003090068.1\|573274_574165_-	LysM peptidoglycan-binding domain-containing protein	A0A288TY55	Enterococcus_phage	8.7e-22	78.8
WP_003090070.1\|574349_575144_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_003090072.1\|575136_575979_-	energy-coupling factor transporter ATPase	A0A2H4PQG7	Staphylococcus_phage	7.0e-13	27.0
WP_037611270.1\|575954_576797_-	energy-coupling factor transporter ATPase	G9BWD6	Planktothrix_phage	3.3e-23	32.3
WP_003090075.1\|576800_577343_-	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_003090077.1\|577354_578365_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_003090079.1\|578437_579730_-	insulinase family protein	A0A2H4UVM3	Bodo_saltans_virus	1.8e-07	26.7
WP_003090081.1\|579730_580978_-	insulinase family protein	A0A1X9I714	Streptococcus_phage	4.0e-97	44.2
WP_003091077.1\|581057_581432_+	S4 domain-containing protein YaaA	A0A1X9I5V8	Streptococcus_phage	4.2e-18	61.3
WP_003090084.1\|581434_582526_+	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_003090086.1\|582699_584181_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	5.8e-95	39.6

DBSCAN-SWA_3

628606 : 639045

Microbacterium_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003086982.1\|628606_632332_+	phosphoribosylformylglycinamidine synthase	A6N228	Microbacterium_phage	7.6e-35	25.4
WP_003086980.1\|632466_633906_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.1e-53	32.8
WP_003086979.1\|634147_635173_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	8.1e-64	44.6
WP_003086977.1\|635172_635724_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	6.4e-23	35.8
WP_003086974.1\|636134_637685_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	1.7e-73	47.2
WP_003086973.1\|637896_639045_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XB61	Gordonia_phage	1.1e-11	37.6

DBSCAN-SWA_4

855629 : 916696

Streptococcus_phage(26.67%)

bacteriocin,transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003086831.1\|855629_856307_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003086830.1\|856422_857193_-	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	3.3e-25	32.3
WP_003086829.1\|857284_858352_-	glutamyl aminopeptidase	NA	NA	NA	NA
WP_003086826.1\|858470_858758_+	DUF4651 domain-containing protein	NA	NA	NA	NA
WP_003086824.1\|858754_859084_+	thioredoxin family protein	A0A1V0SD63	Indivirus	1.4e-06	36.8
WP_003086821.1\|859147_859774_+	DUF4479 domain-containing protein	NA	NA	NA	NA
WP_003086820.1\|860166_860562_+	single-stranded DNA-binding protein	A0A1X9I6R5	Streptococcus_phage	5.4e-24	42.4
WP_003086818.1\|861031_861991_+	sugar ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003086816.1\|861990_863316_+	sensor histidine kinase	NA	NA	NA	NA
WP_003086814.1\|863312_863993_+	response regulator transcription factor	NA	NA	NA	NA
WP_003086812.1\|863985_865293_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_003086811.1\|865588_866026_+	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_003086809.1\|866040_866535_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_003086807.1\|866557_867412_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_003086806.1\|867413_868250_+	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_003086804.1\|868267_868564_+	hypothetical protein	NA	NA	NA	NA
WP_003086802.1\|868685_868973_+	co-chaperone GroES	A0A221S322	uncultured_virus	1.3e-11	37.0
WP_003086800.1\|869098_870724_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.3e-153	56.1
WP_003086799.1\|871169_872873_+	hypothetical protein	NA	NA	NA	NA
WP_003086797.1\|873092_873971_-	RluA family pseudouridine synthase	NA	NA	NA	NA
WP_150880997.1\|874014_876285_+	penicillin-binding protein	NA	NA	NA	NA
WP_003086794.1\|876336_876489_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_003086793.1\|876500_876677_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_003086790.1\|876895_877435_+	transcription termination/antitermination protein NusG	NA	NA	NA	NA
WP_003086788.1\|877647_878445_+	patatin family protein	NA	NA	NA	NA
WP_003086786.1\|878580_879039_+	bacterioferritin (cytochrome b1)	NA	NA	NA	NA
WP_150880999.1\|879244_881746_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	0.0e+00	65.5
WP_150881001.1\|881937_882801_+	helix-turn-helix domain-containing protein	A0A1X9I6E0	Streptococcus_phage	1.0e-06	34.7
WP_003086781.1\|883053_885933_+	DUF4135 domain-containing protein	NA	NA	NA	NA
WP_003086779.1\|885943_886768_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.4e-34	40.4
WP_003086777.1\|886757_887474_+	ABC transporter permease	NA	NA	NA	NA
WP_003086775.1\|887473_890089_+	DUF4135 domain-containing protein	NA	NA	NA	NA
WP_003086773.1\|890125_892222_+	peptidase domain-containing ABC transporter	W8CYL7	Bacillus_phage	2.3e-20	25.5
WP_003086771.1\|892320_892509_+	hypothetical protein	NA	NA	NA	NA
WP_003086770.1\|892521_892707_+	plantaricin C family lantibiotic	NA	NA	NA	NA
WP_126417900.1\|892857_894085_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	1.3e-121	55.4
WP_003086764.1\|894281_894407_-	hypothetical protein	NA	NA	NA	NA
WP_003086763.1\|894617_895430_+	amino acid ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003086761.1\|895615_896458_+	MetQ/NlpA family ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_003086760.1\|896714_898088_+	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_003086758.1\|898080_899145_+	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.2e-29	36.0
WP_003086756.1\|899146_899836_+	ABC transporter permease	NA	NA	NA	NA
WP_003086754.1\|899895_900672_+	carbon-nitrogen family hydrolase	NA	NA	NA	NA
WP_003086751.1\|900919_901765_+	S-adenosyl-l-methionine hydroxide adenosyltransferase family protein	NA	NA	NA	NA
WP_003086749.1\|902335_904012_+	ABC transporter ATP-binding protein	A0A2K9L3Z8	Tupanvirus	7.4e-22	24.6
WP_003086747.1\|904004_904775_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_126417896.1\|904771_906122_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.5e-65	53.2
WP_081498706.1\|906290_906551_+	hypothetical protein	NA	NA	NA	NA
WP_003086738.1\|906476_907190_-	16S rRNA (guanine(527)-N(7))-methyltransferase RsmG	NA	NA	NA	NA
WP_003086737.1\|907275_907836_+	LemA family protein	NA	NA	NA	NA
WP_003086736.1\|907845_908745_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_003086735.1\|909199_909736_+	hypothetical protein	NA	NA	NA	NA
WP_003086734.1\|910092_910782_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.1e-27	31.8
WP_003086732.1\|910947_911439_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_003086730.1\|911425_912592_+	replication initiation and membrane attachment protein	NA	NA	NA	NA
WP_003086728.1\|912592_913495_+	primosomal protein DnaI	S5MU12	Brevibacillus_phage	1.4e-27	30.9
WP_003086718.1\|913507_914818_+	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_003086714.1\|915360_915642_-	hypothetical protein	NA	NA	NA	NA
WP_003086713.1\|916279_916459_+\|bacteriocin	bacteriocin	NA	NA	NA	NA
WP_003086708.1\|916495_916696_+\|bacteriocin	ComC/BlpC family leader-containing pheromone/bacteriocin	NA	NA	NA	NA

DBSCAN-SWA_5

1141647 : 1151006

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_150881013.1\|1141647_1143510_+	Stk1 family PASTA domain-containing Ser/Thr kinase	V5L5T2	Insectomime_virus	1.4e-18	34.3
WP_003086440.1\|1143642_1144338_+	transporter	NA	NA	NA	NA
WP_003086442.1\|1144334_1145339_+	sensor histidine kinase	NA	NA	NA	NA
WP_126417906.1\|1145325_1145973_+	response regulator transcription factor	Q8QKV7	Ectocarpus_siliculosus_virus	7.0e-05	35.2
WP_003086446.1\|1146016_1147429_+	Cof-type HAD-IIB family hydrolase	A0A076FI46	Aureococcus_anophage	9.6e-23	37.4
WP_126417907.1\|1147409_1147793_+	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_003086449.1\|1147982_1148909_-	cysteine synthase A	A0A1X9I5F1	Streptococcus_phage	5.0e-137	79.3
WP_003086451.1\|1149003_1149633_-	YigZ family protein	A0A1X9I5T8	Streptococcus_phage	1.1e-63	59.7
WP_003086453.1\|1149704_1151006_+	DEAD/DEAH box helicase	A0A1X9I5S6	Streptococcus_phage	1.5e-134	54.7

DBSCAN-SWA_6

1237243 : 1252406

Streptococcus_phage(84.62%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003087227.1\|1237243_1238008_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.3e-15	27.1
WP_003087232.1\|1238007_1238718_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.1e-19	29.1
WP_003087233.1\|1238686_1238908_+	hypothetical protein	NA	NA	NA	NA
WP_003087234.1\|1238970_1239630_+	CBS domain-containing protein	M1NSC5	Streptococcus_phage	9.2e-69	62.0
WP_003087235.1\|1239713_1240352_+	dTMP kinase	M1PSC7	Streptococcus_phage	6.6e-72	64.9
WP_003087238.1\|1240365_1241241_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	1.1e-77	51.7
WP_003087239.1\|1241237_1242044_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_003087240.1\|1242036_1242369_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	4.7e-29	58.2
WP_003087241.1\|1242374_1243241_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-114	72.1
WP_003087242.1\|1243604_1244840_+	ammonium transporter	NA	NA	NA	NA
WP_003087243.1\|1244856_1245198_+	P-II family nitrogen regulator	NA	NA	NA	NA
WP_003087247.1\|1245427_1246519_+	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.1e-170	79.6
WP_003087248.1\|1246631_1247162_+	GNAT family N-acetyltransferase	M1PSC3	Streptococcus_phage	1.9e-56	58.5
WP_003087249.1\|1247255_1248449_+	phosphoglycerate dehydrogenase	M1NSB9	Streptococcus_phage	2.0e-178	79.6
WP_003087251.1\|1248598_1249114_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	9.7e-50	58.4
WP_003087255.1\|1249131_1249485_+	arsenate reductase family protein	M1PLC0	Streptococcus_phage	3.3e-41	68.7
WP_003087257.1\|1249552_1250182_+	endonuclease III	NA	NA	NA	NA
WP_126417909.1\|1250425_1250653_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_003087260.1\|1250627_1251047_-	VOC family protein	NA	NA	NA	NA
WP_003087261.1\|1251057_1251435_-	hypothetical protein	NA	NA	NA	NA
WP_003087263.1\|1251578_1252406_-	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	1.0e-117	74.4

DBSCAN-SWA_7

1648427 : 1657769

Bacillus_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003088046.1\|1648427_1649255_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.6e-23	30.5
WP_003088053.1\|1649262_1650051_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_003088057.1\|1650832_1651321_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	E7DN65	Pneumococcus_phage	5.6e-47	58.6
WP_126417929.1\|1651334_1652066_-	7-carboxy-7-deazaguanine synthase QueE	A0A1U9WRB6	Streptococcus_virus	1.7e-60	47.3
WP_003088062.1\|1652047_1652494_-	6-carboxytetrahydropterin synthase QueD	J9PV91	Bacillus_phage	2.9e-42	59.9
WP_003088064.1\|1652493_1653147_-	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	2.7e-60	53.8
WP_003088066.1\|1653778_1654207_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003088067.1\|1654216_1656019_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-35	25.6
WP_003088069.1\|1656008_1657769_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.2e-43	27.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP043405

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection