CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044407	Actinomadura sp. WMMB499 chromosome, complete genome	13 crisprs	WYL,cas4,csa3,DinG,c2c9_V-U4,cas3,DEDDh	2	1	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044407_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_1

794835-794979

Orphan

Consensus_repeat	Method
GCGGAGTGGAGGCCGACGGTCAAACGGCTGCCCTTGCCGGGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_1

>merge|NZ_CP044407|1|794835-794979|CRISPRCasFinder
GCGGAGTGGAGGCCGACGGTCAAACGGCTGCCCTTGCCGGGGGGTGTGGGGGGTCGCCCCCCCACAAAGACCCGTTTGACCGGCGGCCGGAGCGGAGCGCCGGCGGAGTGGAGGCCGACGGTCAAACGGCCGCCCTTGCCGGGGG

>NZ_CP044407|1|1|794835-794979|CRISPRCasFinder
GCGGAGTGGAGGCCGACGGTCAAACGGCTGCCCTTGCCGGGGG	GTGTGGGGGGTCGCCCCCCCACAAAGACCCGTTTGACCGGCGGCCGGAGCGGAGCGCCG
GCGGAGTGGAGGCCGACGGTCAAACGGCCGCCCTTGCCGGGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151008042.1\|784557_785097_-\|PepSY-domain-containing-protein	unknown	unknown	gnl\|CDD\|377032
NZ_CP044407.1\|WP_151008053.1\|800837_801518_-\|DUF3159-domain-containing-protein	unknown	unknown	gnl\|CDD\|371490
NZ_CP044407.1\|WP_151008044.1\|787730_791264_+\|cobaltochelatase-subunit-CobN	unknown	unknown	gnl\|CDD\|235663
NZ_CP044407.1\|WP_151008057.1\|804173_805325_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239607
NZ_CP044407.1\|WP_151008050.1\|797530_798112_-\|YceI-family-protein	unknown	unknown	gnl\|CDD\|377274
NZ_CP044407.1\|WP_151008049.1\|795726_797469_-\|HEAT-repeat-domain-containing-protein	unknown	unknown	gnl\|CDD\|237512
NZ_CP044407.1\|WP_151008048.1\|795065_795758_+\|Tat-pathway-signal-sequence-domain-protein	unknown	unknown	gnl\|CDD\|372911
NZ_CP044407.1\|WP_151008054.1\|801660_803154_-\|bis-aminopropyl-spermidine-synthase-family-protein	unknown	unknown	gnl\|CDD\|366847
NZ_CP044407.1\|WP_151008055.1\|803177_803933_-\|glucose-1-dehydrogenase	unknown	unknown	gnl\|CDD\|187600
NZ_CP044407.1\|WP_151008052.1\|799118_800087_+\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377495
NZ_CP044407.1\|WP_151008046.1\|791903_792989_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274934
NZ_CP044407.1\|WP_151008051.1\|798217_799018_+\|universal-stress-protein	unknown	unknown	gnl\|CDD\|238182
NZ_CP044407.1\|WP_151008043.1\|785358_786060_+\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP044407.1\|WP_151017797.1\|784250_784478_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151008056.1\|803940_804177_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151008045.1\|791283_791907_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274935
NZ_CP044407.1\|WP_151008047.1\|793060_793978_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NZ_CP044407.1\|WP_151008041.1\|783493_783895_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|379275
NZ_CP044407.1\|WP_151017798.1\|786072_787497_+\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|223715
NZ_CP044407.1\|WP_151017799.1\|794058_794811_+\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	unknown	unknown	gnl\|CDD\|274422

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151008042.1\|784557_785097_-\|PepSY-domain-containing-protein	gnl\|CDD\|377032	pfam03413, PepSY, Peptidase propeptide and YPEB domain. This region is likely to have an protease inhibitory function (personal obs:C Yeats). This model is likely to miss some members of this family as the separation from signal to noise is not clear. The name is derived from Peptidase & Bacillus subtilis YPEB.	0.000178619
NZ_CP044407.1\|WP_151008053.1\|800837_801518_-\|DUF3159-domain-containing-protein	gnl\|CDD\|371490	pfam11361, DUF3159, Protein of unknown function (DUF3159). Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. Currently this family of proteins has no known function.	3.40465e-46
NZ_CP044407.1\|WP_151008044.1\|787730_791264_+\|cobaltochelatase-subunit-CobN	gnl\|CDD\|235663	PRK05989, cobN, cobaltochelatase subunit CobN; Reviewed.	0
NZ_CP044407.1\|WP_151008057.1\|804173_805325_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239607	cd03531, Rieske_RO_Alpha_KSH, The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH). The terminal oxygenase component of KSH is a key enzyme in the microbial steroid degradation pathway, catalyzing the 9 alpha-hydroxylation of 4-androstene-3,17-dione (AD) and 1,4-androstadiene-3,17-dione (ADD). KSH is a two-component class IA monooxygenase, with terminal oxygenase (KshA) and oxygenase reductase (KshB) components. KSH activity has been found in many actino- and proteo- bacterial genera including Rhodococcus, Nocardia, Arthrobacter, Mycobacterium, and Burkholderia.	2.69857e-79
NZ_CP044407.1\|WP_151008050.1\|797530_798112_-\|YceI-family-protein	gnl\|CDD\|377274	pfam04264, YceI, YceI-like domain. E. coli YceI is a base-induced periplasmic protein. The recent structure of a member of this family shows that it binds to poly-isoprenoid. The structure consists of an extended, eight-stranded, antiparallel beta-barrel that resembles the lipocalin fold.	3.02736e-48
NZ_CP044407.1\|WP_151008049.1\|795726_797469_-\|HEAT-repeat-domain-containing-protein	gnl\|CDD\|237512	PRK13800, PRK13800, fumarate reductase/succinate dehydrogenase flavoprotein subunit.	2.07318e-18
NZ_CP044407.1\|WP_151008048.1\|795065_795758_+\|Tat-pathway-signal-sequence-domain-protein	gnl\|CDD\|372911	pfam14099, Polysacc_lyase, Polysaccharide lyase. This family includes heparin lyase I, EC:4.2.2.7. Heparin lyase I depolymerizes heparin by cleaving the glycosidic linkage next to an iduronic acid moiety. The structure of heparin lyase I consists of a beta-jelly roll domain with a long, deep substrate-binding groove and an unusual thumb domain containing many basic residues extending from the main body of the enzyme. This family also includes glucuronan lyase, EC:4.2.2.14. The structure glucuronan lyase is a beta-jelly roll.	0.000936119
NZ_CP044407.1\|WP_151008054.1\|801660_803154_-\|bis-aminopropyl-spermidine-synthase-family-protein	gnl\|CDD\|366847	pfam01861, DUF43, Protein of unknown function DUF43. This family includes archaebacterial proteins of unknown function. All the members are 350-400 amino acids long.	5.15057e-26
NZ_CP044407.1\|WP_151008055.1\|803177_803933_-\|glucose-1-dehydrogenase	gnl\|CDD\|187600	cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs. This subgroup includes members identified as 3beta17beta hydroxysteroid dehydrogenase, 20beta hydroxysteroid dehydrogenase, and R-alcohol dehydrogenase. These proteins exhibit the canonical active site tetrad and glycine rich NAD(P)-binding motif of the classical SDRs. 17beta-dehydrogenases are a group of isozymes that catalyze activation and inactivation of estrogen and androgens, and include members of the SDR family. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	1.22728e-86
NZ_CP044407.1\|WP_151008052.1\|799118_800087_+\|CHAP-domain-containing-protein	gnl\|CDD\|377495	pfam05257, CHAP, CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.	2.90078e-10
NZ_CP044407.1\|WP_151008046.1\|791903_792989_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274934	TIGR04036, family_protein, putative luciferase-like monooxygenase, FMN-dependent, CE1758 family. This tightly conserved subfamily of the bacterial luciferase-like monooxygenase (LLM) family, with members showing > 60 % pairwise sequence identity, includes proteins from both species with and species without the ability to make coenzyme F420. Therefore, the like cofactor is FMN rather than F420. The presence of three members in Kineococcus radiotolerans SRS30216 and two in Saccharopolyspora erythraea NRRL 2338 suggest closely related (subfamily) rather than exactly conserved (equivalog) function. Gene neighborhoods around members are not conserved. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP044407.1\|WP_151008051.1\|798217_799018_+\|universal-stress-protein	gnl\|CDD\|238182	cd00293, USP_Like, Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.	4.7905e-06
NZ_CP044407.1\|WP_151008043.1\|785358_786060_+\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.3543e-86
NZ_CP044407.1\|WP_151008045.1\|791283_791907_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|274935	TIGR04037, predicted_flavoprotein, LLM-partnered FMN reductase, CE1759 family. This family represents a distinct clade within pfam03358. That family includes enzymes such as the NADH-dependent FMN reductase MsuE. Members of the present family regularly co-occur in genomes, typically as gene pairs, with members of TIGR04036, a probable FMN-dependent member of the bacterial luciferase-like monooxygenase (LLM) family. At least one member, RF\|YP_001509627.1 from Frankia sp. EAN1pec, is fused to the LLM protein. The function of these gene pairs is unknown.	6.74274e-82
NZ_CP044407.1\|WP_151008047.1\|793060_793978_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	2.23632e-20
NZ_CP044407.1\|WP_151008041.1\|783493_783895_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|379275	pfam13577, SnoaL_4, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.45467e-14
NZ_CP044407.1\|WP_151017798.1\|786072_787497_+\|HAMP-domain-containing-protein	gnl\|CDD\|223715	COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms].	1.71462e-51
NZ_CP044407.1\|WP_151017799.1\|794058_794811_+\|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme	gnl\|CDD\|274422	TIGR03083, TIGR03083, uncharacterized Actinobacterial protein TIGR03083. This protein family pulls together several groups of proteins, each very different from the others. They share in common three conserved regions. The first is a region of about 38 amino acids, nearly always at the N-terminus of a protein. This region has a bulky hydrophobic residue, usually Trp, at position 29, and a His residue at position 37 that is invariant, so far, in over 150 instances. The second conserved region has a motif [DE]xxxHxxD. The third conserved region contains a hydrophobic patch and a well-conserved Arg residue. Most examples are found in the Actinobacteria, including the genera Mycobacterium, Corynebacterium, Streptomyces, Nocardia, Frankia, etc. The pattern of near-invariant residues against a backdrop of extreme sequence divergence suggests enzymatic activity and conservation of active site residues.	3.56618e-09

>NZ_CP044407.1|WP_151017799.1|794058_794811_+|maleylpyruvate-isomerase-family-mycothiol-dependent-enzyme
MDITRIAEGLREHTAGLADAASGPAPDTTVPTCPEWTLRDLVGHVGQAHRWAADMFRTGGTTVAVELPRDAPADQAEWAAWLRAGAAEAVAAQAANAGPVAHPVMGEAPSAMWLRRMLNDTSVHHADAAITAGVPFAIAADLAADEITETFAHLTAPAAAQFKPELAELRGAGETLCLRADEPSVPGWLITRGPDAAIVEYGARDADMTIAGPVRDLMLVFARRLAPEDAAVKVTGDRALLDHWLAHTAV
>NZ_CP044407.1|WP_151008047.1|793060_793978_-|MerR-family-transcriptional-regulator
MTDVTSIAIGDLSALTGVPVRTIRFYCDEGILAPVRSAGGHRRFDPAAAERLRLVRRLRVLGLGLPAITAVLAGDRSLDEAVAAERTALDAELSALAWRRASLRAVEDADPAGRAARLDLLAAVQDGPRAHEALLDFWRGRILAPVPDELVRMHLELTVPAPPPDPTPGQVVAYAGMVALAGDRELFRMLRERGRRNAERVVDEPTLLDGMREAVEMAMPLVLAGREPEPGPALDHFVAAHAAGRDERDSPEFRRELLPAVAAEQDPRMRRYWALHGEVAAAPAVPGAVVLWLIDALDRGVAAPA
>NZ_CP044407.1|WP_151008046.1|791903_792989_-|LLM-class-flavin-dependent-oxidoreductase
MQFGIFSVGDVTMDPTTGRTPTEAERIKAMVAIALKAEEVGLDVFASGEHHNPPFVPSSPTTMLGYIAARTERLVLSTATTLITTSDPVKIAEDFAMLQHLADGRVDLMMGRGNTGPVYPWFGQDIRNGIPLAIENYHLLHRLWREDVVDWEGSFRTPLQSFTSTPRPLDGVPPFVWHGSIRSPEIAEQAAYYGDGFFANHIFWPTTHFQQLIGLYRRRYEHYGHGSADQAIVGLGGQVFMRKNSQDAVREFRPYFDNAPVYGHGPSLEDFTAETPLTVGSPQQVIDRTLTFRDHFGDYQRQLFLMDHAGLPLKTVLEQLDILGEEVVPVLRKEFESLRPAHVPATAPTHAARAANKEESR
>NZ_CP044407.1|WP_151008045.1|791283_791907_-|NAD(P)H-dependent-oxidoreductase
MTTRTLAVVSAGLGRPSSTRLLADRLAGAAADGLRAEHEADVVLEPVELRDHAHAMVDATLTGFPSGEFRAAVETVAGADGLVAVTPVFNASYGGLFKTFFDVLDRDALDGTPALIGATGGTERHSLALDFAVRPLLAYLRANVVPTAVYAASADWGSGDRGLGDRIRRAGAELAALVAGRPAPAAEDPYENPVPFEDLLGSVDRAG
>NZ_CP044407.1|WP_151008044.1|787730_791264_+|cobaltochelatase-subunit-CobN
MILLLSTSDTDLLSARASGADFRLANPARVSVEDLPGLVEGTDLVVVRLLGGRRAWEEGLDALLAGPRPVVVISGEQVPDAELMGLSTVPAGVAAEAHAYLAHGGPENLDELFRFLSDTVLLTGFGFAPPVETPTWGVLERDAADGDGPVVGVLYYRAHHLAGNTAFVDDLCRAIEAKGGRALPVFCASLRTAETGLLETLGRVDALVVTVLAAGGTKPALAGAGGDDEAWDVGALAELDVPILQGLCLTSERAAWEENDDGLSPLDTATQVAVPEFDGRLITVPFSFKETDEDGLSVYVADAERAARVAGIAVRHGALRHVAPQDKRVALMLSAYPTKHARIGNAVGLDTPASVVRLLAAMREAGYDVGDALPGEGDALMHALIEAGGQDADWLTEEQLERNPVRVPRAEYEAWYRTLPEGLREGIERHWGPPPGELFVAGDDIVLAALTSGNVVVMVQPPRGFGENPVAIYHDPDLPPSHHYLAAYRWLADEFGAHAVVHVGKHGNLEWLPGKAAGMSAECGPDAALGDLPLIYPFLVNDPGEGTQAKRRAHATLVDHLIPPMARAESYGDIARLEQLLDEHANVAAMDPAKLPAIRAQIWTLIRAARLDHDLGLDDRPHDAEFDDFLLHVDGWLCEVKDVQIRDGLHVLGAAPEGGSRIDLVLAMLRARQLWGGSQALPGLREALGLDENSTERTQVDAFEERARALVATMEERGWDPAAAGEIAEGKAAEILRFAAEEIVPRLERTPDEIGMVLHALDGGYVPAGPSGSPLRGLINVLPTGRNFYSVDPKAVPSRLAYDTGRAMADSLLARYRDETGEWPRSVGLSVWGTSAMRTSGDDIAEVLALLGVRPVWDEASRRVTGLEAVPPAELGRPRIDVTVRISGFFRDAFPHAVAMLDDAVLLVAALDEPDDDNFVRAHVRADTAAHGDERRATMRVFGSRPGAYGAGILPLIDSRNWRDDSDLAEVYAVWGGYAYGRGMDGVPARGDMESAYRRISVAAKNTDTREHDIADSDDYFQYHGGMIATVRALTGKAPKAYIGDSTRPDAVRTRTLDEETSRVFRARVVNPRWLAAMRRHGYKGAFELAATVDYLFGYDATAGVVADWMYEKLAQTYALDQENREFFEKSNPWALHGITERLLEAADRGMWEHPEQSTLDALKRLYLEVEGDLEDG
>NZ_CP044407.1|WP_151017798.1|786072_787497_+|HAMP-domain-containing-protein
MGSVRARTTVGATAVVAAALAAAGLIVVSLLKANLAGHADLRAEMTAREAAAKLASGTPWNRLNLDDAEERPVQIVDAYGHVRAVSEDLDAVSGAGGPPTAHGPSPATVLAAENDGDDLDEEDPRPGRVSEEVRHATGRATVDGRTADYRFAVLEATTPAGETVTISAGASLATSRDAVATVGRAMLVGLPLLLAVAAGVTWLVTRRALRPVAAIRGELVEITASGDLTRRVPVPGSRDEVAELAGTTNQTLAALERAVTRQRGFVADAAHELRTPIASLRTQLEVAAVHPRLLDVTELTYDVVRLQDLAADLLLLARLDAGEPPASPEPVDLADLVRDELRRRPTGTRALAFEADVADAPSVPGSRVRLARVLANLLDNAERHAATRIRVALGARDGATVLRVADDGAGVPPDDRERIFERFVRLDEARSRDDGGAGLGLAITHDLVRAHGGEITVRDAPEGGAQFEVRLPTA
>NZ_CP044407.1|WP_151008043.1|785358_786060_+|response-regulator
MRLLIIEDEKRLARPLAQGLAAEGFAVDTAHDGVTGLNRALENDYDLILLDIMLPGMNGYRVCSALRAAGTDTPILMLTAKDGEYDHAEGLDTGADDYLTKPFSYVVLLAHIRALLRRRTRGPAPLIELGDLTIDPAARRVLRGDVQVELTAKEFALLEHLATHAGLVVSKAQILEHVWDGAFEGDPNIVEVYVSSLRRKLDAPFGRRSITTVRGAGYRLAANGGAARSGGSG
>NZ_CP044407.1|WP_151008042.1|784557_785097_-|PepSY-domain-containing-protein
MATSVAADRDGGDPRFAVRVTALRAADAALKAVPGGHIEGLEVDYDGGRLVWEADVLAADGARRELYLDTRDGHVLADQIDRAEASVDGDDCTDGKPGNGESAPAVQAAALRSAVPAIRAARVALEEVPGTMTSVDFEYHRTAHAWEIDITADDGTEHKLKVDAASGWLISNIAGESDD
>NZ_CP044407.1|WP_151017797.1|784250_784478_+|hypothetical-protein
MRDIQTVTEKWRFHCLCCLHAWEDLYEVRHCGHATAWQLGGLPAQPPWADPICPECHSLRVKAITAGLMAHPGPT
>NZ_CP044407.1|WP_151008041.1|783493_783895_+|nuclear-transport-factor-2-family-protein
MALSCEDRMAISELLALYGHLCDSGELDRLHEVFTIDVTYDVTALGGGVLEGTAACAEAGRALGDANPVGHHVTNIVLTEDGAGRVRALSKGIGVNADGTAGSVTYDDTVVRVRGHWRIGHRKVSLRRTPLVA
>NZ_CP044407.1|WP_151008048.1|795065_795758_+|Tat-pathway-signal-sequence-domain-protein
MADGWRLVWDAVPGRDGLEAFASVEDDRAGSHPGVPHIRALGTMYRFDIHYPGDVDRSPDRQRQEVKGMRAGARKPVVGRGETWWFTWSWYLTGALRATTSFTHVHQFFAGGKGGAPVLVTSLRRRGGRDLLELNAIHAGVVVGETDLRPLRSRWIDVELEARFAADGGVRWRVSSEDGVAVDIARDGLDLWNGKGDIAPKWGIYRSLKDAARLSDAHLLIKDLRAYRPG
>NZ_CP044407.1|WP_151008049.1|795726_797469_-|HEAT-repeat-domain-containing-protein
MIDERTARPAAKLAELGAELGPPLPENRVAAFEERNGIRLPDAYRRFVTTVGNGGAGPYRGLLALDPDLRDPQLAGTFRYGPDDLPGMWSWETTEWAYWDMYCGTVPLARQHDIEWEYHETAEPESRLVLSGPGRGRVVMVDASGDWFPPIHHPAPDFLAWYEEWLDDPRSRVHRYGSDFDRPGARLHDLRAADPDEAVWAAHRMAATMGNRVTEQAPPNFCEGLAGAALDAPSARVRGAAAWALGRVRRDVGRYALPLLRGRDPRVRRIAIRQVAASAEVDRADAEASIRGLLADADPDVRAAAASALRDVAVLRALLTGPDRRARRAALGEVPVLLHRLPDGRDVLVRAARPLLRDPHPDVRAAAVTAIGAAREHVPWAGPMLHAALTDPSAPVRRAAAGRLLRSGDPSALQAAPVLLADPDPVIRHETLYRLGRDGPVRDRAAGVRALLADPDPQVRAAALHALLEAGAPPPEDEWAPLLTDPCGPVRHRALRSTLRAVRHGGPGPGGPVHEALHRTLAAPDRELRSTTSFALERTCTAECRPVLAAALAAEDDRVIRHTLGKILDAISRDGTPAGP
>NZ_CP044407.1|WP_151008050.1|797530_798112_-|YceI-family-protein
MGAEVSDLEAGSWTVDPVHSEITFTVRHLMTTVRGSFTEFGGEVEIGDDPLDSRAHAEIRMASIDTRSEERDAHVRSADFLDVDHHPVMTFVGHGVQRAAIGRRARNPRYHVDGELTIKDVTRPVRLLTEFHGVSPDPWGGIRAGFTATTSISRSDFGIEFNVPLQGDKVMLGDTISIALEIQAVLATADSPA
>NZ_CP044407.1|WP_151008051.1|798217_799018_+|universal-stress-protein
MIGEHVLAGYVHDTGGREALDLGRAIVAVTGGRLSVAHVHAPDRPGAASEAQAVLEQIAGLLEEEPAELHAQEGRSVARGLTALAGRIGADVIVVGSPEGGAHGRIGVGAAADHLLHSATEAVMLAPSGYTPRDGLDRITVMYVRRPQCDEAVVRAAVAAERLGVPLRLVTLSLGDDPERLRDDQALAIRLALESAEVPAEDVTAELAEGPDVAAAVADVVWADGELLICASSEDAAAHRVFLGEVALKVLRAAPCPVTVLPRGYF
>NZ_CP044407.1|WP_151008052.1|799118_800087_+|CHAP-domain-containing-protein
MDPIGEKLLEVAEQELGYTEKGDGYTKFGDWWTENIDDDHNPYFTTAPWCDMFLAWAADKAGVTEQAGQFAATPDHAKWFEEHDAWGDEPEPGAIVFYDWNGSDDIDQIDHVGIVEKVDGKTLHTIEGNADGYKLMRKTRDMDQVVGFGYPGKVQVAQKYTPKHAAPAPKVDQLANPRAATGSHEKDRSPAQQQLPVQEVALGSVLALILCGTAALAVGRAAAARTPTTSPIRVRKRGRHHKPATPAALPAGVTPADLDAAEAGTTIMPALSLAAAHEAEDREFWGRIAHLEEDTELAFWNSLHADTTDSSPDEYATGLKFR
>NZ_CP044407.1|WP_151008053.1|800837_801518_-|DUF3159-domain-containing-protein
MALTTLNVADDVLDTPADETPERPVDVKRAMLDAVGGPWGIVASAIPTVVFATAVAFVSLPVGIGIAIAVALVVAGVQLRRGQPLSSASGGLIGVAAAGGVSALTGSANDFFLIGIWVSLALGLVTLASLLVRRPLTGVVWNAVHGGAHAWRADRSVRRAHDIATLAVAAMGLVRFAVQEWLYLADSTGGLAVADTVLGFPLTGLVAVVVVWAFRRSTKRLLKPRT
>NZ_CP044407.1|WP_151008054.1|801660_803154_-|bis-aminopropyl-spermidine-synthase-family-protein
MDEPGTDDSAAPPAVDGMDPVRVHAALALLTDGWRTRAELVRGTAAPRRSIEALLRTVPVERSGDRYRLPPTAGLSALLAAHPSVPADPVGHLLPAHAAAVERLADLIARAPRGRRALDHVSATPETVVRRALFLGARFWLPGSHLLCVGDHDLTSLAVGLIHPHVRTTVVDIDDRILAYIDAEAAKLGLDVRTRWADLRLGLPPSARDHDLAITDPPYTPDGVGLFVARAVEGLRDPATGRVLLAYGAGDLTPALALKVQNALSELNLLSEAIYPDFNRYFGAEAIGSAADLYVLRPTTKTLPAAVARADRFAAAIYTHGPQSIEATAAPDPGPVADLDPDVLVGPWPKDVLPNVPRVRLATWLGKPYAATVRRAAIALPPGLEPALVRVLLATRAERVRVFTTADIAEPAEILAPVYELTARGTHVDAVRRAPSGTLARTLLDRAHGKAANAWRDALTRQGLTKREARGEVARIAPWTQDATVLELPAHRLKSIT
>NZ_CP044407.1|WP_151008055.1|803177_803933_-|glucose-1-dehydrogenase
MARLDGKIALITGGARGIGAAHVRRFVAEGAKVVFGDLLHDRGEALAAETGAVYVPLDVTDHDAWTNAVQTTVDRFGGLSVLVNNAGILRYRLLADMTEQQLRQVLDVNLIGPWLGVKAVVEPMKASGGGSIVNTSSIEGYAAAAGLSAYAASKFGVRGVTKAAAQELGRFGIRVNSVHPGGIATELALDPGVAEGVDIDADAFFKALPIPRWGEPDDVAGAAVYLASDESAYCTGTEILVDGGLLSGPGY
>NZ_CP044407.1|WP_151008056.1|803940_804177_-|hypothetical-protein
MSAHPVDCRTCGTRVLVEKITPPHTSVQWTTDAAAACGEIAPRAAAGEHPARVPHCTALRASIDRAVAEGRVTIAFPE
>NZ_CP044407.1|WP_151008057.1|804173_805325_-|Rieske-2Fe-2S-domain-containing-protein
MNHRVIEAAPPPERFARGWHCLGLADSFKDGKPHAVEAFGTTLVVFQGESGGLNVLNGYCPHMGGNLTKGTVKGDAIACPFHDWRWGGDGRCAGIPYAKRVPRVARTASWPTLEENGQLFVWNDPQGNPPPPDVTIPRIEGAFSDEWSNWTWNTLRVENSHCREIVDNVVDMAHFFYVHYALPTYFKNVFEGHVATQYFDGTSRDDAHLGMIPGPADQKIDQRSEAAYYGPSYMIDYLWNEAEGVTVETVLINCHYPITSSSFMLQWGAIVKKFPGMSGEEADAMAAQVAEGVGLGFLQDVEIWKNKAPIDNPLLCDQDGPVYQLRRWYEQFYVDVEDVTPEMTNRFEFEIDTARAVESWQAEVAENLANGVSYSMIPASRRA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_2

2735068-2735168

Orphan

Consensus_repeat	Method
GCGATGCAGCAATCGCACGCGAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_2

>merge|NZ_CP044407|2|2735068-2735168|CRISPRCasFinder
GCGATGCAGCAATCGCACGCGAGATCCGTTGAAGGAAGGCCCTCCAGGGCCTGACGCCGAGGATCTTGCAAGGAACACGCGATGCAGCAATCGCACGCAAG

>NZ_CP044407|2|2|2735068-2735168|CRISPRCasFinder
GCGATGCAGCAATCGCACGCGAG	ATCCGTTGAAGGAAGGCCCTCCAGGGCCTGACGCCGAGGATCTTGCAAGGAACAC
GCGATGCAGCAATCGCACGCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151009384.1\|2742187_2743543_-\|phosphomannomutase/phosphoglucomutase	unknown	unknown	gnl\|CDD\|236557
NZ_CP044407.1\|WP_151009369.1\|2722866_2723760_+\|DUF4429-domain-containing-protein	unknown	unknown	gnl\|CDD\|373084
NZ_CP044407.1\|WP_034519120.1\|2742008_2742191_-\|Trm112-family-protein	unknown	unknown	gnl\|CDD\|225391
NZ_CP044407.1\|WP_151009380.1\|2736769_2737111_+\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133378
NZ_CP044407.1\|WP_151009382.1\|2737802_2739392_-\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226951
NZ_CP044407.1\|WP_151009374.1\|2729580_2729916_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|237189
NZ_CP044407.1\|WP_151009373.1\|2728377_2729364_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|181818
NZ_CP044407.1\|WP_151009385.1\|2743801_2744173_-\|DUF3499-family-protein	unknown	unknown	gnl\|CDD\|378788
NZ_CP044407.1\|WP_151017980.1\|2740869_2741943_-\|bifunctional-phosphoglucose/phosphomannose-isomerase	unknown	unknown	gnl\|CDD\|181536
NZ_CP044407.1\|WP_151009372.1\|2726991_2727771_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|376808
NZ_CP044407.1\|WP_151009378.1\|2733535_2734792_-\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|235488
NZ_CP044407.1\|WP_151009377.1\|2732960_2733536_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151009383.1\|2739919_2740873_-\|cation-diffusion-facilitator-family-transporter	unknown	unknown	gnl\|CDD\|223131
NZ_CP044407.1\|WP_151009386.1\|2744386_2744803_+\|metallopeptidase-family-protein	unknown	unknown	gnl\|CDD\|240574
NZ_CP044407.1\|WP_151009381.1\|2737112_2737787_-\|response-regulator	unknown	unknown	gnl\|CDD\|225107
NZ_CP044407.1\|WP_151009379.1\|2735217_2736648_-\|adenosylhomocysteinase	unknown	unknown	gnl\|CDD\|377487
NZ_CP044407.1\|WP_151009376.1\|2731290_2732865_-\|BBE-domain-containing-protein	unknown	unknown	gnl\|CDD\|223354
NZ_CP044407.1\|WP_151009370.1\|2723814_2724837_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224525
NZ_CP044407.1\|WP_151009371.1\|2724937_2726581_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP044407.1\|WP_151009375.1\|2730030_2731248_+\|SpoIIE-family-protein-phosphatase	unknown	unknown	gnl\|CDD\|369272

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151009384.1\|2742187_2743543_-\|phosphomannomutase/phosphoglucomutase	gnl\|CDD\|236557	PRK09542, manB, phosphomannomutase/phosphoglucomutase; Reviewed.	0
NZ_CP044407.1\|WP_151009371.1\|2724937_2726581_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	4.25053e-96
NZ_CP044407.1\|WP_034519120.1\|2742008_2742191_-\|Trm112-family-protein	gnl\|CDD\|225391	COG2835, COG2835, Uncharacterized conserved protein [Function unknown].	5.8138e-16
NZ_CP044407.1\|WP_151009380.1\|2736769_2737111_+\|MerR-family-transcriptional-regulator	gnl\|CDD\|133378	cd00592, HTH_MerR-like, Helix-Turn-Helix DNA binding domain of MerR-like transcription regulators. Helix-turn-helix (HTH) MerR-like transcription regulator, N-terminal domain. The MerR family transcription regulators have been shown to mediate responses to stress including exposure to heavy metals, drugs, or oxygen radicals in eubacterial and some archaeal species. They regulate transcription of multidrug/metal ion transporter genes and oxidative stress regulons by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	1.11352e-07
NZ_CP044407.1\|WP_151009382.1\|2737802_2739392_-\|sensor-histidine-kinase	gnl\|CDD\|226951	COG4585, COG4585, Signal transduction histidine kinase [Signal transduction mechanisms].	4.88827e-37
NZ_CP044407.1\|WP_151009374.1\|2729580_2729916_+\|SDR-family-oxidoreductase	gnl\|CDD\|237189	PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional.	4.2789e-60
NZ_CP044407.1\|WP_151009373.1\|2728377_2729364_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|181818	PRK09393, ftrA, transcriptional activator FtrA; Provisional.	2.12408e-121
NZ_CP044407.1\|WP_151009385.1\|2743801_2744173_-\|DUF3499-family-protein	gnl\|CDD\|378788	pfam12005, DUF3499, Protein of unknown function (DUF3499). This family of proteins is functionally uncharacterized. This protein is found in bacteria. Proteins in this family are typically between 125 to 163 amino acids in length.	1.06649e-54
NZ_CP044407.1\|WP_151017980.1\|2740869_2741943_-\|bifunctional-phosphoglucose/phosphomannose-isomerase	gnl\|CDD\|181536	PRK08674, PRK08674, bifunctional phosphoglucose/phosphomannose isomerase; Validated.	1.07337e-90
NZ_CP044407.1\|WP_151009372.1\|2726991_2727771_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|376808	pfam02525, Flavodoxin_2, Flavodoxin-like fold. This family consists of a domain with a flavodoxin-like fold. The family includes bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC:1.6.99.2. These enzymes catalyze the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species. This enzyme uses a FAD co-factor. The equation for this reaction is:- NAD(P)H + acceptor <=> NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy. The family also includes acyl carrier protein phosphodiesterase EC:3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP. This family is related to pfam03358 and pfam00258.	6.56674e-56
NZ_CP044407.1\|WP_151009378.1\|2733535_2734792_-\|adenosylhomocysteinase	gnl\|CDD\|235488	PRK05476, PRK05476, S-adenosyl-L-homocysteine hydrolase; Provisional.	0
NZ_CP044407.1\|WP_151009369.1\|2722866_2723760_+\|DUF4429-domain-containing-protein	gnl\|CDD\|373084	pfam14472, DUF4429, Domain of unknown function (DUF4429). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and viruses, and is approximately 90 amino acids in length. This domain is often found in two tandem copies.	9.66309e-27
NZ_CP044407.1\|WP_151009383.1\|2739919_2740873_-\|cation-diffusion-facilitator-family-transporter	gnl\|CDD\|223131	COG0053, MMT1, Predicted Co/Zn/Cd cation transporters [Inorganic ion transport and metabolism].	1.03416e-45
NZ_CP044407.1\|WP_151009386.1\|2744386_2744803_+\|metallopeptidase-family-protein	gnl\|CDD\|240574	cd12954, MMP_TTHA0227_like_1, Minimal MMP-like domain found in a group of hypothetical proteins from alphaproteobacteria and actinobacteria. The subfamily includes some uncharacterized bacterial proteins which show high sequence similarity with Thermus thermophilus hypothetical protein TTHA0227. However, they do not contain the conserved HExxH (x could be any amino acid) motif. They may not have any zinc metallo-peptidase activity.	1.53855e-27
NZ_CP044407.1\|WP_151009381.1\|2737112_2737787_-\|response-regulator	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	3.59124e-72
NZ_CP044407.1\|WP_151009379.1\|2735217_2736648_-\|adenosylhomocysteinase	gnl\|CDD\|377487	pfam05221, AdoHcyase, S-adenosyl-L-homocysteine hydrolase.	0
NZ_CP044407.1\|WP_151009376.1\|2731290_2732865_-\|BBE-domain-containing-protein	gnl\|CDD\|223354	COG0277, GlcD, FAD/FMN-containing dehydrogenases [Energy production and conversion].	2.88238e-21
NZ_CP044407.1\|WP_151009370.1\|2723814_2724837_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	3.46049e-84
NZ_CP044407.1\|WP_151009375.1\|2730030_2731248_+\|SpoIIE-family-protein-phosphatase	gnl\|CDD\|369272	pfam07228, SpoIIE, Stage II sporulation protein E (SpoIIE). This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.	1.73695e-42

>NZ_CP044407.1|WP_151009378.1|2733535_2734792_-|adenosylhomocysteinase
MSDIADGSLAYEGVKRIEWADRGMPVLRQIRERFAAERPLDGVRVAACMHVTTETAGLIRTLQAGGANVALASSNPLSTRDDVAAALAEEFGAQVYARAGIDREGYYGHIHQALETGPDLVLDDGCDLVNTLHTDRQDLLGTVKAGCEQTTTGVIRLHQMVQEGVLRFPVVAVNDTATKHMFDNRYGTGQSTLDGIVRATNTLLAGKTIVIAGFGYCGRGLAERARGLGARVVITEIDPVKALDAALQGFTVQPMAEAAPHGDVFITVTGNRDVVNADHLAVMKDGAILANSGHFDVEIDVRALDAMAVAVHRGVRPQADEFVLADGRRLVLLAEGRLVNLAAAEGHPAAVMDMSFADQALTCAWLATAHESLAPAVHDVPAEIDGQVARLKLASMSVVIDALTPDQEDYLHSWRIGS
>NZ_CP044407.1|WP_151009377.1|2732960_2733536_-|hypothetical-protein
MPAGVYLHLEEELEERFHCAPGPGGWRYTSTRPGLRTDIVVDSRWRQIRVELVTPGWWVRGGVTGPDVAWVRASGDTGTEHTEHALGFMSGSPGFLVAVARALDLADGAETDVRLVTFTGPSLAPLTAPWRWRRAGTSVHDTDTEPLPVTGYEVTDLSTGEIIQVHLAGDVVLDAPGIELTGLESPPNLSE
>NZ_CP044407.1|WP_151009376.1|2731290_2732865_-|BBE-domain-containing-protein
MSHPPVPPAITVNPPDVRYPALSRGFNQRWIAQPEYVRMVTSAQGAVTALSEAINQVPEDDARTRVTVRSGGHCYEDFVCGDDVRVILDVSPMCDMYYDPALEAWCVEAGATNWHAYSHLYPLSGRALPGGSCYSVGLGGHITGGGYGLLSRQAGLTVDYLYAVEVAVVTEARTVELVTATRDDPDPDRRDLWWAHTGGGGGNFGVVTRFWFRDPPVPPRKVLLTARSWKWDDFDRDSFTRLLDAYGAWFADHQNPATATGRLFALLALNHRAAGTINLTVQVDAESDDDDDEGTAAMLDFLQAVDSDSVPDSGPMLYSAAEHAAVPDAWSPRLMPWLTATQALNGSGQNRCGKYKSAYVRRPFTGAQIDAMWAYLGNEHYKHYKNKEALIQIDSYGSAINATPRDTAAPQRDSIMKMQYQVYWNRPTDEDPGDEAENLAWIRDTYQATFADTGGVPIIGGNTDGCYINYPDVDLSDPDWNTSDQPWSKLYYKNAYPRLQRVKARWDPLNVFRNAQSIESDVPD
>NZ_CP044407.1|WP_151009375.1|2730030_2731248_+|SpoIIE-family-protein-phosphatase
MTDPAGAFADGARRFENAHAIHDEAFTETDVEDVLDAVLERVRESLGVDTAVALLLDRQQRHLVATAAKGIEEEVSQAVHVPVGEGFAGRVAAERRPVYIADVSSANVFNPLLVQRGLHSLLGVPLVADGALVGVLHVGTLAPRRFTADETEFLQLAADRAALAVRRRLTRAEHAGALELQRSLVPSALPALPGLEMAARYRPGKASVGGDWYDVFSLPSGEVGVVMGDVAGHGFGAAVVMGRLRSALRAYALETADPAKVLDKLNNKVVHFEPDATATVLYAVWDPALDRVRISSAGHWPPVLALPGGPVRPVRMKPGVLIGLDSDVPRETATVDLPPGALLCLYTDGLVERRGGSVADGIDALCEAAYAGPPEAVGAAVMAALIGRRLPEDDVALLILRRALG
>NZ_CP044407.1|WP_151009374.1|2729580_2729916_+|SDR-family-oxidoreductase
MTSGQHLGPMPSEVAYAAAKAALEGVTVTLADQLANRGIRLNTVNPGPVDTGYLTEDMWRTVAPMFPSGRYGEPDDPARLITWLVTDEARWITGQVINTEGGFGRWRPRGA
>NZ_CP044407.1|WP_151009373.1|2728377_2729364_+|helix-turn-helix-domain-containing-protein
MVFGDGGPHRLAVLVRDGVLPMELGLVHQLFGSARSADGAPLYDVVSCGVEAGAIRTDADFTVGAPHGLEALGEAGTVLVPASHALDETRPADGPVPAALRDAHARGARVASVCTGAFVLAAAGLLDGRRATTHWLSCERFAARFPAVRVDPAVLYVDEGSVLTSAGEAAGIDLALHMIRRDHGAAVAADVARRTVVPPHREGGQAQYIARPVPSAPGPSTDAARTWALERLDRPVTLAEMAARASMSVRTFTRRFRDETGMSAAAWLTLQRVERARQLLERTDLPVDRVAERAGFGTGTSLRTHMRATLGVSPSAYRATFRGPPTSE
>NZ_CP044407.1|WP_151009372.1|2726991_2727771_-|NAD(P)H-dependent-oxidoreductase
MNILWTFAHPEARSFNGVLRDHGVDTLRRQGHQVRESDLYAMGWNPVVGPDDFGHDPRERLVVGEASERALTGGTLSPDIRAEQDKLAWADALVLQFPLWWHGMPAILKGWFDRVFVQGFAFGLPGARRYGDGGLAGRRALVVTTAGARTTGFGPRGIHGDAEQLLFPLLHGTLFYSGMTVLPPLVIGGADRARTAGDAAARLDERLRDLATAAPIPYRPEHGGDYDDDLVLHPHLAPGRAGLSVHRAAEDSAVLRPAG
>NZ_CP044407.1|WP_151009371.1|2724937_2726581_+|ATP-binding-cassette-domain-containing-protein
MGHVEVGHVRHTLPDGRVLLDDASFRVGEGVTAALVGPNGAGKTTLLRLVAGDLAPQEGTVAHSGGLGVMRQFVGNVRDDSSVHDLLLSVAPPRVRDAAATVEAAELAMMERDDEPTQLRYANALAGWGDAGGYEIEVLWDACCVAALGVPYDSCRWREVRTLSGGEQKRLVLEALLRGPDEVLLLDEPDNYLDVPGKQWLEERLRETPKTVLIVSHDRELLDGAADRIVTVEAGRVWVHGGRFATYAEARRDRNERLEELRRRWDEERAKLKQLVMTLKNKATFNDGLASRYQAAQTRLRKFEEAGPPEVPPRDQSIKMRLRGGRTGKRAVICEGLELTGLMKPFDTEVWYGERTAVLGSNGSGKSHFLRLLASVAETVPRGTAPVAPVPHAGVGRLGARVVPGLFAQTHARPDLDGRTPCEIVMTEHARLRDAAMAALARYELTVCAEQPFETLSGGQQARLQILLLELGGATLLLLDEPTDNLDLASAEALQEGLESFEGTVLAVTHDRWFARSFDRFLVFGGDGSVYESSEPVWDESRVTRAR
>NZ_CP044407.1|WP_151009370.1|2723814_2724837_+|substrate-binding-domain-containing-protein
MADRRPTLEDVAALAGVGRGTASRAINGSARVSERARAAVLRAVRDLGYVPDAAARTLAGGRAAPSGTLALVLAEEPGRRFEQPFLGRLLDGITAAADAARTAVALHYAPSGGERAALARRLREPRTDGVLLLSTLPREPLAGVLERAGVPTVTAGRPAGVAPGEAGDAGYVDADNRGGSRRATEHLVGGGRRRIATIAGPPERSVGADRLAGYRRALGDRPELVAFGDFTEAGGMLAMRRLLDRRADLDAVFAASDVMAAGALRELERQGRRVPDDVAVVGFEDAAPRRPTRPMLTTVHQPTERMGRAMVEMLLASLGTAPEDREPVICRTGLVLRRTA
>NZ_CP044407.1|WP_151009369.1|2722866_2723760_+|DUF4429-domain-containing-protein
MAEVTGSEGRWTFDGDLLRIVPGNGRGVHRLRRILGELEVPVEAVAGIAYEPGKKGGVLRVRLRQGADPLLQAAGNALDDASDPYRLHVDKDVSSLAEYFVDEVRNALQIERVATGPVDRYLLPGPSVPLRASGGEGSVTFDGETVRLDWSWMAEHAKQKAGPKQFTLVDVVKVELHPSVGLDEGHLRFHLKDQPAPPKAKHDPYCLTLWGTRKEGAAAIAVAAAVVARLPHPGAPPAEDVPALPAGGASAGPEPSGSADDHDVLLRRLRELGDLHREGILTEEEFATAKQALLRRF
>NZ_CP044407.1|WP_151009379.1|2735217_2736648_-|adenosylhomocysteinase
MDYKVADLSLADFGRREIRLAEHEMPGLMATRKEYADTKPLRGAKIMGSLHMTIQTAVLIETLVELGADVRWVSCNIFSTQDHAAAAVVVGKDGTKDDPKGVPVFAWKGETLEEYWWCTDQALQWPDGTGPNMILDDGGDATLLVHKGAEYEKAGAVPTATEDDPEEWGVILETLRRTIAATPNRWTETAAAIKGVTEETTTGVHRLYEMAKAGTLAFPAINVNDSVTKSKFDNKYGCRHSVLDGLNRATDVLIGGKVAVVCGYGDVGKGCADALKGQGARVIVTEIDPICALQAAMDGYQVTTLEDVVETADIFVTTTGNFNIITADHMSRMKHQAIVSNIGHFDNEIDMAGLARIDGIERIEIKPQVHEWRFADGHSILVLAEGRLMNLGCATGHPSFVMSNSFTNQVIAQIELFAKTDEYPVGVYVLPKHLDEKVARLHLDALGVKLTELTKEQAAYIGVHVEGPYKPDHYRY
>NZ_CP044407.1|WP_151009380.1|2736769_2737111_+|MerR-family-transcriptional-regulator
MRITEAARRLGTSPRMLRYRETLGLLPATREPARGGHRRFGDAELRAVALALALEKRYDVGPAELAFGLRVLAEPEVQARVRELGERIGRLSAPPTRALDFEKEKAMRLLRRR
>NZ_CP044407.1|WP_151009381.1|2737112_2737787_-|response-regulator
MIKVLIVDDQTIVRAGFAALLAAQEDITVTGEAGDGREAVRLAEQNRPDVVVMDIRMPGMDGIEATRRILALPGAENVRVLVLTTFDVDEYVYDALAVGASGFLLKDATADELVSAVRVVARGDSLLAPQVTGRLIREFTKQRRNRPQAPAELSTLTARESEVLVLIAGGLSNSEIAQRLVVSEHTVKTHVARVFTKLGLRDRAQAVMLAYESGVVVPGESTAG
>NZ_CP044407.1|WP_151009382.1|2737802_2739392_-|sensor-histidine-kinase
MTSDDDTRTGPDPARFGPALAHHAWRLSGRIVAGVGQLLLWILTGLGRLLRPLAVRVAARLTGAGREQPPGPYGPYGPYGPHGAHPAAGRTAPLPRWANAWGEAVRSWYFAPLTGLALTAAALAELAPRAETPLSLAGGFAVASTLPLVWRGEYLRPVAAVVLGAFAASLLTGQTVLFTTGFAALYTLYALGRRLPRQSTGVLAVGSVVTVAVVYLTTFTLDDVPWPAAVIAVLAAIGLGDARSVVETAGRTESAAAERANETLTRLTAVQREQAVMRERARIARELHDVVAHSVSMIAVQAETAPYTMQNLSPEAREGYTEIARTAREALVEMRRLLSVLRADAKPEPDAANSPQPRLDRLPDLIEQHRGAGGRVDLAVHGDPRDMSATVELSAYRIVQEALTNARRHAPGAEVRVDLMFLPDRVAVRVRDDGRSAPAAPEHGSSDPTMVLNREDIASRTSVLNPGEADRTRLEETPSAGHGLVGMRERATMLGGRFSAGPATEGGFLVEAELPLHREEPGDGGGRPR
>NZ_CP044407.1|WP_151009383.1|2739919_2740873_-|cation-diffusion-facilitator-family-transporter
MSADGGTKAILAALAANAGIAVSKFVAFVFTGSSSMLAESIHSVADAGNQGLLLVGQKRSARRRTPKHPFGYGRERYFYAFVVAVVLFTVGAAFSLYEGYHKISHPEEIKSAGWAFGVLTAAIIMEIFSFRTAIVESNRIRGEKSWWEFIRRAKAPELPVVLLEDLAALVGLFLALFGVTMAVVTGDGVWDGVGTVAIGVLLAVVATILAIETKSLLIGEGADPEQEERIVAALESVEEVERVIHIRTQYVGPEEMLIAAKIAVDHDDTAAEVARGIDAAEAKIRGEFPEARLIYLEPALDEARRPEPAEAEAPNPS
>NZ_CP044407.1|WP_151017980.1|2740869_2741943_-|bifunctional-phosphoglucose/phosphomannose-isomerase
MLRQVASSAAQIREAQRAAAEAGVAALAEDGRPRAIVVTGMGGSGISGDVLAAICGVGCPVPVTTVRGYRLPGWVGAADLVIAVSCSGGTEETLAVAADAARRGCRLLFVGGAGSPLAELAERTRAPFVPVRSVGQPRSTLWGLSVPLILAARTLGLADAPDAVLESTAARLEDLAHRCRPSSEPFINPAKRVALELAGDVPLVWGTSTLAGTAAYRLCCQLNENAKYPAVPGELPEANHNQVMAFDGVFARGAASADPDDFFRDRADESEHGLHLVVLRDTEEHPQARKRADASIDMARDRGVAVTELTAEGEHPLERIATLIALADYVTVYLAVALGVDPTPVPAIQELKARIAT
>NZ_CP044407.1|WP_034519120.1|2742008_2742191_-|Trm112-family-protein
MTMKLDSWLLEILACPNCGGDLRADDGAGELVCTGSCGYAYPVRDDIPVLLVDEARTPAS
>NZ_CP044407.1|WP_151009384.1|2742187_2743543_-|phosphomannomutase/phosphoglucomutase
MGDLAKIFKAYDIRGVVPDELDAATAEAAGAAFVRVTGASAVVTAHDMRESSVPLAEAFARGATAQGADVIEAGLGSTDLLYYASGSLDLPGAMFTASHNPAKYNGLKLCRSGARPVGRDTGLTEIRELIEQGVPAHDGAPGTVTRRDLLKGYADHLKTLVDLSGIRRLKVVVDAGNGMGGHTVGAVFEGLPIDLVPMYFELDGTFPNHEANPIEPENLRDLQAKVRETGADIGLAFDGDADRCFVVDERGEIVSPSAVTALVATRELAKHPGSSIVHNLITSAAVPEIISEHGGTPVRTRVGHSFIKQTMAETGAVFGGEHSAHFYFRDFWFADSGMLAALHVLAALGQQDGVLSELLGEYTRYVASGEINSEVGDQAAAAEQVRHAFAGRPGVTVDELDGLTVASDDEGWWFNLRPSNTEPLLRLNAEAGDEKTMAALRDEVLAIVREK
>NZ_CP044407.1|WP_151009385.1|2743801_2744173_-|DUF3499-family-protein
MSPVRTCSRTACKAPAVFTLTYVYRDSTAVLGPLAAYAEPHCYDLCAEHSERLTAPMGWELVRLPVEEETELGEDDLEALADAVREAARPAPGSGQEPVGQGTEVGRRGHLRVLRSEPAGSAE
>NZ_CP044407.1|WP_151009386.1|2744386_2744803_+|metallopeptidase-family-protein
MAGVRRRDRRGRGLRGPLAPPQAPISRTRAERFDDLVEDEVRRLGSRWERELARVEFTVAEVPDLEPRFDGPVPLGRTLPGEGELPVQIVVYRRPLEARAAGEQELGRLIRDLLVEEVADLLGLSPESVDPSYDSPDD

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_3

2987910-2988132

Orphan

Consensus_repeat	Method
CGCGCCCGCGGCCCCGCGGGGCGGCGGC	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP044407_3

>merge|NZ_CP044407|3|2987910-2988132|CRISPRCasFinder
CGCGCCCGCGGCCCCGCGGGGCGGCGGCGCGCCCGCGGCCCCGCGGGGCGGCGGCGCGCCCGCGGCCACGCGGGGCGGCGGCAACGGCCTCGTGGGCATGTGCGAGCGCGTCACGATGCTGGGCGGCGCGATCGAGGCCGGGCCACGGGGCGGCGGATGGTCCATCGTCGTCCACCTGCCCTACGGGCCGCACGACGCGAGCTGAGGCCCGTCGGTCGGCGGC

>NZ_CP044407|3|3|2987910-2988132|CRISPRCasFinder
CGCGCCCGCGGCCCCGCGGGGCGGCGGC	GCGCCCGCGGCCCCGCGGGGCGGCGG
CGCGCCCGCGGCCACGCGGGGCGGCGGC	AACGGCCTCGTGGGCATGTGCGAGCGCGTCACGATGCTGGGCGG
CGCGATCGAGGCCGGGCCACGGGGCGGC	GGATGGTCCATCGTCGTCCACCTGCCCTACGGGCCGCACGA
CGCGAGCTGAGGCCCGTCGGTCGGCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151009559.1\|2986221_2987166_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176103
NZ_CP044407.1\|WP_151009552.1\|2973111_2973603_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224991
NZ_CP044407.1\|WP_151009556.1\|2978109_2978835_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NZ_CP044407.1\|WP_151018012.1\|2972019_2972643_+\|CHAP-domain-containing-protein	unknown	unknown	gnl\|CDD\|377495
NZ_CP044407.1\|WP_151018013.1\|2989194_2990595_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP044407.1\|WP_151009567.1\|3000958_3001720_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP044407.1\|WP_151009562.1\|2990803_2991442_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|235142
NZ_CP044407.1\|WP_151009563.1\|2991630_2992389_+\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187585
NZ_CP044407.1\|WP_151009561.1\|2988298_2989021_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187620
NZ_CP044407.1\|WP_151009551.1\|2971078_2971480_-\|cysteine-dioxygenase	unknown	unknown	gnl\|CDD\|283616
NZ_CP044407.1\|WP_151009553.1\|2973599_2976014_+\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224446
NZ_CP044407.1\|WP_151009564.1\|2992409_2993834_-\|alkaline-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|293742
NZ_CP044407.1\|WP_151009557.1\|2978861_2982545_-\|CDP-glycerol-glycerophosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|367953
NZ_CP044407.1\|WP_151018015.1\|2998817_3000788_-\|acyl-CoA-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|173850
NZ_CP044407.1\|WP_151009558.1\|2982566_2986052_-\|CDP-glycerol-glycerophosphotransferase-family-protein	unknown	unknown	gnl\|CDD\|367953
NZ_CP044407.1\|WP_151009554.1\|2976010_2976868_+\|FAD-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224238
NZ_CP044407.1\|WP_151009566.1\|2997844_2998666_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|372616
NZ_CP044407.1\|WP_151009565.1\|2993845_2994865_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|367110
NZ_CP044407.1\|WP_151009555.1\|2976950_2978048_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176865
NZ_CP044407.1\|WP_151018014.1\|2994923_2997800_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|226415

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151009559.1\|2986221_2987166_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176103	cd08411, PBP2_OxyR, The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The C-terminal domain also contains the redox-active cysteines that mediate the redox-dependent conformational switch. Thus, the interaction between the OxyR-tetramer and DNA is notably different between the oxidized and reduced forms. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	7.17573e-76
NZ_CP044407.1\|WP_151009552.1\|2973111_2973603_+\|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	2.40971e-78
NZ_CP044407.1\|WP_151009556.1\|2978109_2978835_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.06871e-21
NZ_CP044407.1\|WP_151018012.1\|2972019_2972643_+\|CHAP-domain-containing-protein	gnl\|CDD\|377495	pfam05257, CHAP, CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.	1.21117e-07
NZ_CP044407.1\|WP_151018013.1\|2989194_2990595_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	1.1654e-99
NZ_CP044407.1\|WP_151009567.1\|3000958_3001720_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	5.67606e-39
NZ_CP044407.1\|WP_151009562.1\|2990803_2991442_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|235142	PRK03624, PRK03624, putative acetyltransferase; Provisional.	5.44972e-09
NZ_CP044407.1\|WP_151009563.1\|2991630_2992389_+\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187585	cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs. PTCR is a classical SDR which catalyzes the NADPH-dependent reduction of ketones on steroids and prostaglandins. Unlike most SDRs, PTCR functions as a monomer. This subgroup also includes human carbonyl reductase 1 (CBR1) and CBR3. CBR1 is an NADPH-dependent SDR with broad substrate specificity and may be responsible for the in vivo reduction of quinones, prostaglandins, and other carbonyl-containing compounds. In addition it includes poppy NADPH-dependent salutaridine reductase which catalyzes the stereospecific reduction of salutaridine to 7(S)-salutaridinol in the biosynthesis of morphine, and Arabidopsis SDR1,a menthone reductase, which catalyzes the reduction of menthone to neomenthol, a compound with antimicrobial activity; SDR1 can also carry out neomenthol oxidation. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.2348e-83
NZ_CP044407.1\|WP_151009561.1\|2988298_2989021_-\|SDR-family-oxidoreductase	gnl\|CDD\|187620	cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs. 1,3,6,8-tetrahydroxynaphthalene reductase (4HNR) of Magnaporthe grisea and the related 1,3,8-trihydroxynaphthalene reductase (3HNR) are typical members of the SDR family containing the canonical glycine rich NAD(P)-binding site and active site tetrad, and function in fungal melanin biosynthesis. This subgroup also includes an SDR from Norway spruce that may function to protect against both biotic and abitoic stress. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.03803e-86
NZ_CP044407.1\|WP_151009551.1\|2971078_2971480_-\|cysteine-dioxygenase	gnl\|CDD\|283616	pfam05995, CDO_I, Cysteine dioxygenase type I. Cysteine dioxygenase type I (EC:1.13.11.20) converts cysteine to cysteinesulphinic acid and is the rate-limiting step in sulphate production.	0.00240579
NZ_CP044407.1\|WP_151009553.1\|2973599_2976014_+\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	0
NZ_CP044407.1\|WP_151009564.1\|2992409_2993834_-\|alkaline-phosphatase-family-protein	gnl\|CDD\|293742	cd16018, Enpp, Ectonucleotide pyrophosphatase/phosphodiesterase, also called autotaxin. Ecto-nucleotide pyrophosphatases/phosphodiesterases (ENPPs) hydrolyze 5'-phosphodiester bonds in nucleotides and their derivatives, resulting in the release of 5'-nucleotide monophosphates. ENPPs have multiple physiological roles, including nucleotide recycling, modulation of purinergic receptor signaling, regulation of extracellular pyrophosphate levels, stimulation of cell motility, and possible roles in regulation of insulin receptor (IR) signaling and activity of ecto-kinases. The eukaryotic ENPP family contains at least five members that have different tissue distribution and physiological roles.	1.91458e-35
NZ_CP044407.1\|WP_151009557.1\|2978861_2982545_-\|CDP-glycerol-glycerophosphotransferase-family-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	4.12662e-113
NZ_CP044407.1\|WP_151018015.1\|2998817_3000788_-\|acyl-CoA-dehydrogenase-family-protein	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	5.40361e-96
NZ_CP044407.1\|WP_151009558.1\|2982566_2986052_-\|CDP-glycerol-glycerophosphotransferase-family-protein	gnl\|CDD\|367953	pfam04464, Glyphos_transf, CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.	1.6426e-116
NZ_CP044407.1\|WP_151009554.1\|2976010_2976868_+\|FAD-binding-domain-containing-protein	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	4.66825e-75
NZ_CP044407.1\|WP_151009566.1\|2997844_2998666_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	1.27078e-09
NZ_CP044407.1\|WP_151009565.1\|2993845_2994865_+\|CoA-transferase	gnl\|CDD\|367110	pfam02515, CoA_transf_3, CoA-transferase family III. CoA-transferases are found in organisms from all lines of descent. Most of these enzymes belong to two well-known enzyme families, but recent work on unusual biochemical pathways of anaerobic bacteria has revealed the existence of a third family of CoA-transferases. The members of this enzyme family differ in sequence and reaction mechanism from CoA-transferases of the other families. Currently known enzymes of the new family are a formyl-CoA: oxalate CoA-transferase, a succinyl-CoA: (R)-benzylsuccinate CoA-transferase, an (E)-cinnamoyl-CoA: (R)-phenyllactate CoA-transferase, and a butyrobetainyl-CoA: (R)-carnitine CoA-transferase. In addition, a large number of proteins of unknown or differently annotated function from Bacteria, Archaea and Eukarya apparently belong to this enzyme family. Properties and reaction mechanisms of the CoA-transferases of family III are described and compared to those of the previously known CoA-transferases.	2.8988e-89
NZ_CP044407.1\|WP_151009555.1\|2976950_2978048_+\|SRPBCC-family-protein	gnl\|CDD\|176865	cd07823, SRPBCC_5, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	4.0319e-48
NZ_CP044407.1\|WP_151018014.1\|2994923_2997800_+\|AAA-family-ATPase	gnl\|CDD\|226415	COG3899, COG3899, Predicted ATPase [General function prediction only].	3.03752e-40

>NZ_CP044407.1|WP_151009559.1|2986221_2987166_-|LysR-family-transcriptional-regulator
MAISRPTVAQLRAFLALAEHLHFRDAAAALRMSQPALSGAVAALEEGLETRLVERTTRKVMLTPAGERVARRAELVLAELDRLVEDVRAVRGPLVGPLRVGVIPTVAPYLLPVVLPRIAKDFPRLELSVHEEQTDQIVAELLAGRLDVVVMALPSPVLGVRELPLYDEDFVLVAPASQDLAVPGDGVAREVLGELDVLLLNEGHCLRDQAMDVCREVGARAVAATYATSLATLVQLVSGGLGVTLVPETALPVETRRAPDLALHRFRDPAPFRRVGLGYRATSPRAGEFEALAQSVRAAIAEQGGESPGFRPSA
>NZ_CP044407.1|WP_151009558.1|2982566_2986052_-|CDP-glycerol-glycerophosphotransferase-family-protein
MSPKLSVVVPFHNTEEYLRECLESLAGQSFRDLEVIMVDDGSTDNGAVLAKEMCERDGRFRLVAREQEGPGPARNAGVRQARGRYLAFADADDIVAPGAYMRLVGSLERTGSDLACGNVERTDGGRRWQSVLHQGVFAERRSATHVASQPLLIRDRTPWNKVYRRTFWDSAALEFPSGFYEDPPVTVRAHALAKAVDVLPDTVYYWRKRQGSITEERYDWENVSQRLRSARLVRDGLASYAPQLLNVYDEHALVDVELRVLLEALPRTDGERRPELVEMGGELAERIAPRVLKRLPALSRLQLHLLARRMLPELEEVRRFVAVGGPGDAPRVRRGLRHRWFAEYPFFEDEALGLPAHLYDVTDELAPVAAIDRATWVDGRLRLEGHAYVRHLDSSTVDGSRIRLWLVAANRRGLLKVPVRRVRRPDVTAGSRQSEVSYDWSGFVAEIDPSTLRIFGRWRDVDWIPCVEIVSNGVRRRRTLGNPAQTPRLWPDDLECVPGVRVQGVAARHRFVVQVRRTPAAVTGCRTDGGDLVLDGWSDEPLGEDVRVTATARGGGETVAGVLEAGRDGRGFRARLPVAELTGRPGDWDVALPGGARPHVTRQAAGAAFGVPGGELEIARTRRSTLRIVFREPAPVVERVTWAPDGVVTLHGACPDPSGRADALLLRRRRSSEEHRVPLRWDGARFTASFAPARMPMLGLSRPLVPGRWDVLVDGGGDGGGDGGGDGAEGERPVAVRRHALRDLPDPHETGLHRVTVRAYKTDRLQFRVETALDEDERGEYAQRRLRSGHYRRHLNLPVRELAVFDAYRGRQYSCNPRGIYDELRRRGTDVECVWVTANGQFGRPPSARVVLSGTREYYEALARARYIFGNWSQQPWFVKREDQTYVQCWHGTPLKKLGYDVKEMPFKRTEGVDWMEHDVRHWDLLLSQNAFSVPLFRRAFGYDGEVLESGYPRNDILHSPHRDDIAAAVRRRLGIPKGKRVVLYAPTWRDDFHLAVGKRAFRLEFDVDRFRRALGRDHVLLLRTHYLVTDRPKWVPGDCVLDVSVYPDISELYLISDVLVTDYSSAMFDFAGTGRPMVFFAYDLERYRDHVRGFYFDFDAEAPGPLLPTTQDVVDALGEPDAIDAGYRSARAAFAARYCPHDDGRAASRVLDRVLSIPAH
>NZ_CP044407.1|WP_151009557.1|2978861_2982545_-|CDP-glycerol-glycerophosphotransferase-family-protein
MSPKTNPETNSETGPKTGAADTVDTADTVETVETGPNPEVTAEPAAGDGVALSVVVPFRDVGGFLAECLDSIAGQTLRDLQVVMVDDGPADGPADGGAAIAAEFAARDDRFVLVRGDGEGPGPARNLGARHATGRYLAFVDGDDAIPPYAYELLVGMLESTGSDIAGGNLERLDGERTEPSGPHAEAYAETLRATHVTRRLSLLRDRTIGNKVFRRSFWEANKFRFPPGLYEDLPVALATHALASAVDTVPATVYYWRRRPGSLTDRATDPALLNDRHAALDIVQQLFAEHAPSLLPAFHAQVVDVDMHAFVRALPAATPQERERLVELGARIVGEAGPAAAEGLDAIRRLELHLLRERMPRELLEVLAFQEGGLADVPVEARGRFRQRWYARYPFFGDPERAIPDEVYDVTDEFELRADVDRVGWDGDTLIVEGWAHFDRLEVSDVRDSRIRVWMRNVKTGREVGVPVERVRRPEATARSGLSRVCVDWAGFAVRIEPEYLLDGDEWRSGTWELYAEVATAGRRAVQRLDAVEPAVRWTAARQVDELVAVQPAVDDDGFVVHVKRSRAVVTEYRRSGDTLLLTGWTKRALGPNASVIAVRRHGGAPSSHQVRGEVTLRPAAVLQTVEGTGFGFTATLPLADLMPGDASDRPYRAHLRDVLEWDVRLTGEGGPLRLTVAPALTEARFLWRGREYVLTRTSFGNLRGIERTPRPVATAARWDGSGRLTISGEFADPQDRPAHLLVRRPETGETHRVPVTWDGGRFTAAFTPAETAAFGRDIPLAAGTWEVLAPTPAGDVAVVAERSAVPSLPGWHAVGGREFEVAVEQTDALRLRTRPALADDERGPHAQRVLRSRDYPVYLRSPLADVAVFDGYAGTAYSCNPRAIFEELTRRKPETECVWVSRDGQFTVDGEARIVQYGSREHYRLLARARYIVTNYGVPRWFTKRPGQTYLQTWHGTPFKRLAYDLAEMPHQRTEKHDWMEHEVPHWDFLLSPSPYATQIMRRAFRYGGEILETGFPRNDILSSPDVDALGTHVRKELGIPEGKKVVLYAPTWRDDQSHTPGRRGFRMELDVETMRRVLGDDHVLLVRMHHLVTDRHLPPSDDFVMDVSGYPDITDLYMAADVLVTDYSSAAFDFAVLGRPMVFYAHDLERYRDHVRGCYLDLEAEAPGPVVARSVDVAEAVRAAPESEAEHADAYDRFLVTYCPHDDGGATARVLERVFAGLRG
>NZ_CP044407.1|WP_151009556.1|2978109_2978835_+|methyltransferase-domain-containing-protein
MPSGGPVDTIEVRRVAGRGLEDANWWCRERRAILAGELLRFSAPGAAVDVGAGAGAAARLLGEHGWHATAIDLDPDAVAVARAHGVEAYVGDARYLQLPGEGFDLALALEVLEHVEEDRRAVAELARVLRPGGTALVSVASDMALWSARDVSAGRVRRYGRRGLVELLEGAGLLVERVWSRGVLVRPVPRLLRHRMSRRDDLAPLHPALNGALRVSAAVERRLPVRSWPGTCLFARTRRPG
>NZ_CP044407.1|WP_151009555.1|2976950_2978048_+|SRPBCC-family-protein
MSMELDHDFTVPVPVDQAWSVLLDVERIAPCMPGATLDAVDGDEYRGRMKVRVGAMTITYRGTVKIVAADEAAREVTLEASAKEARGSGTAAATVRAALREEDGTTRVTVRTELNVTGRPAQFGRNILAEVGAKIITRFAKNLATEIESPTAPDTAAQSGAPNAPSPKDDTSAKDGPSTKGQTPAKDDTSTTAGTPAKGGATANGGASTKDETPAQGEASAQGEASAQDGATAKGETPAKDGPSTTAGTPAKGAATAERGASTKDETPAKGGAAADGGASAVSTGGAAEPEVAGAEVARPVTGAPKPEAPEPDARVARVRGARFDDEAIDLLEVAGPSLAKRAVPALGGLVLLLLVIRLLARRRK
>NZ_CP044407.1|WP_151009554.1|2976010_2976868_+|FAD-binding-domain-containing-protein
MIPATFDYTRPATVDDAVAALADAGEDAKILAGGQSLMPLLRMRLAFPEILIDLDRVDALREIRDDGDALVIGAMATHHQVIGDPLVRAHAPLLVRATETVADPAVRHRGTFAGSLAHADPAGDLPAVALALDAVLLARSPRGEREIPAAEFFVDWMTSALEPDEILTGVRVPKLGDGWGVHYEKFHRTAQAWAIVGVACAVRRENGTVAEARVALTNVGPAPVRASAVEAAAAGRTVSADALRAAAEPAAEGLAPPADLHGSSEYRSHLARVLTARALTAAAAV
>NZ_CP044407.1|WP_151009553.1|2973599_2976014_+|molybdopterin-dependent-oxidoreductase
MTATDDRPAEIGSARRRSEDARLVTGRTRWTDNIAPAGTLHVAFLRSPHAHARIERVDAAAATDLPGVVAAFSGADLAGEQGSLPCAWVVTEDMRHPEHPPMAVREVRYAGEPVACVVARDRASAVDALEAIDVDYAPLPAVVDMEAAVADGADLVHGDLGTNESYTWVFENGDLDAAMRDAPVVLERRYVQQRLIPTAMEPRSVVCVPEGDEFTLYSATQIPHILRLMLATVTGIPEHRLRVVAPDVGGGFGSKLQVYGEEVVALLLARRLGRPVKWTESRSEGNMTVHHGRDQIQRLTLAAGEDGRIRGLKVDLLADMGAYLMLVTPGIPLLGAFMFNGIYKMDAYSFTCTGVFTTKTPTDAYRGAGRPEATYAIERLMDELAAELGLDPIEVRRRNWIGHDEFPYDTIAGLTYDSGNYEAATEQALRLLEYDKLRAEQADRRERRDPVQLGIGVSTFTEMCGLAPSRVLGSLSYGAGGWEHASVRMLPSGKVEVVTGSSAHGQGHETAWAQIAADRLGVPFEDVKVLHGDTAVSPKGMDTYGSRSLAVGGVALYSACDKVVEKAKRVAAHLLEASEDDVEFTAGRFGVRGVPDSGTTIQEVATAAFAAHDLPDGVEPSLDSDATFDPDNFSFPHGTHLCAAEVDTETGMVRIRKYVAVDDIGKVVNPLIVEGQVHGGLAQGIAQALYEEAVYDADGNLTTTTMADYLIPSAADLPEFVTDRTETPATSNPLGVKGVGEAGTIASTPAVVNAIVDALRPFGVSDVPMPCTPERVWRALRGETAHETAEPGAGGGLGSAGGAA
>NZ_CP044407.1|WP_151009552.1|2973111_2973603_+|2Fe-2S-iron-sulfur-cluster-binding-domain-containing-protein
MPRIRVEVDGATYEDDVEPRLLLVHYLRERLGKVGTPVGCDTTNCGACTVLLDGLSVKSCSVLAVQADGRDVTTIEGLGAGGPHPLQRAFHEEHGLQCGFCTPGMIMSALDLLRENPDPSDEEIREGLEGNLCRCTGYQNIVRSVRRAAGDMRRPAQEPEVAS
>NZ_CP044407.1|WP_151018012.1|2972019_2972643_+|CHAP-domain-containing-protein
MAAAAGGPQAIIAEARKSLGMSGRPNTITREYASRHGDAFLSAPWCDMAVTYWARHSGTAEAVLPAGDRAYTPWHAGDFQKIGRWHSGTTARVNAAKPGDIVFFDWGESNTIGAIDHVGVVERVLGGGRVQTIEGNTGDACKRRVRGSGVIAGYGRPAYNEEDDMPDYVSVGVDTPQELPRASGSPSNGGRSTPTRDTTTGTGAAPP
>NZ_CP044407.1|WP_151009551.1|2971078_2971480_-|cysteine-dioxygenase
MVPDLTMRGQDDPHGRAVTARPPTIGRLAARVHALAARPAEWWRLIGFDDSAPARIRLDDADGVPVWLTTWPPGHGATVDARVSTLIAGELAEIVITPDGVTERPLRANRVRVHAGSRALTNPGPAYAVSLHA
>NZ_CP044407.1|WP_151009561.1|2988298_2989021_-|SDR-family-oxidoreductase
MMLTDRTALVTGGSRGIGRAIVERLAADGARVVFSYREGKDAADELVRELGGRAVAVRADQEDTGTIDALFEPVGDSLDLVVNNAAVNPHGPIAEMSGDDFDRVMTVNAKYPLLVMRRAEPLMPDGGRIVNVSTLNTVLPAPGHALYSASKAALEQLTAVAAREFGPRGITVNSVSPGATDTDLFRETNPPGAAEQVVGFTALGRLGRPDDIAGVVAFLAGPDSGWITGQNLRATGGLVF
>NZ_CP044407.1|WP_151018013.1|2989194_2990595_-|protein-kinase
MGAVWRAHDADLDREVAVKELHVPEQIADDERSVWFARMDREARAAARLRHPGIVTVYDRVRGDDGRPWIVMELVHGRSLDRVLAEEGPLPARRVAAIGLAMLDALSAAHAQGIVHRDVKPANVLLEGERVLLTDFGIAAMEGDATLTRSGAVLGTPAYMSPEQVEGRPVTPASDLWSLGAALYAAVEGRPPFTAPTHGALFVAIATRDPAPPRCGGPLAEALVKLLNRDPSERPSPARVRALLGAAAGGGPTRTDPVPGPAGRVSEQVATAADGVRARKGSVRGALACTWITVAVTLYTSRSQDVFVPYWAPYLLTGLVGSALLLSFGLWRPAPRRAILATVAVINVGLTSGALVGGYWRDDIMQVAIPSAVAWVGGAVALMFAFSAANPLLTARISPAGSRRGVLMLIAVAEGVVMTAWPWALFGALGMEVHLPVDGKGISLFVGPLGFVFVAWIASRFFGARH
>NZ_CP044407.1|WP_151009562.1|2990803_2991442_+|GNAT-family-N-acetyltransferase
MTTGPLSVRPARADDPAEVDRIYDICLRTAAAGKDATGRFAEPRLVGDVFAGPYLAHSPDLAWVLAPGGAEGPPSPPVGYFLAVADTESFERDLEDAWWPRLRTRRAHRPVEPDTPDAWLRAHIDDPPPTPTDITARYPAHFHVDLLPEAQGGGNGRRLMSTAIDALRARGVPGVHLGVSTRNTNAIGFYTHVGFHVLLDGPDSKILGMPLS
>NZ_CP044407.1|WP_151009563.1|2991630_2992389_+|SDR-family-NAD(P)-dependent-oxidoreductase
MNAHRKVALVTGANKGIGRTTAEALAGLGMTVLVGARDVGRGEEAAAAVRAGGGDAHAVALDVTAAGTVREAARRIEERFGHLDVLVNNAGITGSGNVSPQDATDQIPSSVDLEMVRAVFETNVFGVIAVTNAMLPLLRRSPVPRVVNVGSHAGSLGLTSDPDGPFAALLPSAAYTPSKAAVNALTVQYANELRKDGILVNAVAPGFVDTDSNGHTGHLTPAQGAAVVVRLATLGADGPTAGFFGEEGPIPW
>NZ_CP044407.1|WP_151009564.1|2992409_2993834_-|alkaline-phosphatase-family-protein
MQATAWSTRGCLTGPARPVRPAAFTGPHGVDHAGAIALGSATAMRISKALAAGTSALLAAALCTATAAPAAAEPRHRPSKPLADHVLFLALDGFDAEYVGDAPMPNLDKLLRRGGLATSTGVMTSITNPSWSSVATGAWPERHRNTAYWYDAESGTARGQQREMAVPTIGQAVREQGGTILSAQWFTLQNYGTAYGDPEGIYTQPGGACPRRVDDAVAVLEGRPVDSGGTAVTAPKIPDLIAVYCDTLDSIGHDGGAEDPRIPEALRMIDEQIGRLVEAVQEAGIYGRTTFVITGDHGMTTFTGGLNTEVVEAVAEAGYKLEYLGSGQRPAPDTDAVMVVGGVGSLHLVGDAAGSRRAERRIAAALRDVPHVRAVYDERDQRRMRMSPNHGELVVEPEPGWSLGAAPASPKGSHGSTGDLRVPLVIAGAGVRPHAAAWRPRHVDVAPTMAALLGIRPPSGVQGRVLGEVLQRRH
>NZ_CP044407.1|WP_151009565.1|2993845_2994865_+|CoA-transferase
MGLLDGLRVLDLTMWRPGPYATQLLGRLGADVVKVEPPGGEPMRAFRDHFDVLNRHKRSVELDLKTGAGLARCRELARDAEVFVEGFRPGVADRLGVGYERLREGAPALVYCSISGYGAEGPLSAVPGHDVNYRAYAGALGQDATSAGAELAVADMAAATMAAFAITAAVVRARATGAGERIDLGMADVLADWVETSPDMSGADAPVPGYGVYPTKDGRTITLGVVSEQPLWAAVCRALGLERHADVPFLQRFERLEELDGEIADAVAGLTRDEAVTRLSREGAPVAPVLTRAEMLAHEHFRARGIGTGPVRTTNCTTPSHGKVPELDEHRGEGWRLTG
>NZ_CP044407.1|WP_151018014.1|2994923_2997800_+|AAA-family-ATPase
MSPVLVGRSDELRRLEDALAAAPGAVLIGGEAGLGKTRLIREFAGSVGDRARVLVGGCLELGSDGLPFAPFTTVLRGLVRDIGIDGVAGLVPRGDTGALARLLPEFGEPERDAASGEERARLFELVLTLLERLAERAPVVLVIEDAHWADRSTRDLLAFLTRNLGDAPVLVVVTYRTDELHRGHPLRTLLAGLERVERVRRLEPARLSRAETAALVTALLGDEPPAGLVDRIARRSEGNPLFIEALLDDDGTLACELPESLRDLLLAGVQRLPEETQEVLRDASGGGTRIEHALLAAVTGLDDAALTRTLRPAVAANVLVVDGDGYAFRHALIREAVHDDLLPGEHTRLHTRYAEALENEPALVPDGRLWVELSHHWKSAHNAVWALVASWRAASYARKALAYAECLAMLSRVMELWELVPDAPERIGAPLERVLEKAARTANLAGEYERGIKLASAALREIGESDDDPDVRERRAELLALRGRMRYQMARSGFIEDVRAAAATLPPDRRTVLRARVLSTLATYIRFTTNIDEGRAAAAESYAIARELGDPVAEAHALCTLFCTDIDYADGSMLAEVADAAARSGDHGALMRHAVLRSHFLEGSGLHAEAAEVARLGKETASRFGLARTDGTFLCINEAEPLVSLGRWDEALAVMEHALAQEPSVTTRTSLLVMSGEIALFRGEPDTARERLARTNQVANVHTAWLKTQDYFSTQRLRARLALADGDPAAALEAVLRVVERPGLPDDARYAWPALVLGATACAQLGAGVDDDLKRIEERATALPCLGPLQDTYRRTFEAELGRARGAADRDAWDAAAAAWEGIGNPFEHATALVRAAEAALAAGDHDAASVRLDTAAGLARGLRAEPLAALVADLRRRTRSPRNGTAPLGLTPREFEVLRLVAEGRSNRDIAAALFISAKTASVHVSNILGKLGVASRGEAAATAHRLSLFREAGAAR
>NZ_CP044407.1|WP_151009566.1|2997844_2998666_-|methyltransferase-domain-containing-protein
MQQTGQKKSIAGSLLNLIGSGSKRSPAAPQPAPDGDVVQPAAGEGQLENHLGGDEARNYRKYEYDTVAPHVGRSMLEVGSGLGHFSEQFAGRLDYLVVSDNDPYCVGELRTRYEGNDDVEVIDLALPADIEIRQKVDTVVMMNVLEHIKDDVQALRDLAAVTLPGGRIVIWVPGYMQLYGDFDRKVGHVTRYTPKTLEKSVREAGLVPEVLKPINFLGGIAWWFAVRRGGAGYPDPKLVKIYDRTVVPFTRTIERFVKPPFGQTVLCVARVPE
>NZ_CP044407.1|WP_151018015.1|2998817_3000788_-|acyl-CoA-dehydrogenase-family-protein
MRTAEQGTRRAAGHDAGQVDERTARKVAEEARESEWRLPSFGKQLFLGDFRLDLVHPHPRPGDEDRAKGDAFLEKLTEFCANEVDPHRIERDAQIPDETLRGLRDLGAFGMKIPERYGGLGLGQFHYGRALMVAASVSPAIGALLSAHQSIGVPQPVKMFGTDEQKEAWLPRCATQLTAFLLTEPDVGSDPARLRATATPDGDEYVLNGVKLWTTNGVVADLVVVMARVPKSDGHRGGISAFVVEMDTPGITVENRNRFMGLRGIENGVTRFHDVRVPKANMIGKEGAGLKIALATLNTGRLSLPAMCAGSGKWATKIAREWSAERVQWGRPVGRHEEVARKVSFIAATAYAMEAVHDLSARLADDERNDIRIEAALAKLWSSEMACKVADELVQVRGGRGYETAESLAARGERGVPVEQLVRDLRINRIFEGSSEIMHLLIAREAVDAHLSVAGDIIDPETSAAGKARAAARAGGFYARWLPTLVTGAGQRPGSYAEFGPLAKHLRYAERAARKLARSIFYAAGRWQGGLEQRQGFLGRMVDIGAELYAISAVCVRAHADASGKGPLQDGGEGPGKSALLLADAFCKQSRVRVEELFDGLWRNTDETDVRLARAVLDGAFTWVEDGVLDPSIPGPLIAASEPGPSRLEDVHRKVT
>NZ_CP044407.1|WP_151009567.1|3000958_3001720_+|helix-turn-helix-domain-containing-protein
MDETRRPTLIASVQRALHLMEAVSSHPGGAPAKQLAREAGLPLATTYHLLRTLAHEGYATRLSDGVWVLGDRIGSLHGKSRAQQLLARIRPALVGLRDELGAAAYFAMHVDGEIKLIDIVDGPRTPRVDVWVGFDEAPHATALGKCLIAQLDEDRRRDYLDRHTLADLTPHTITEPRRLLRTLRSSTGLSIDREEYALGTGCAAVPVTDATGTVRAALAISCRPAKLTRIERSADRLKATAARLQRTITLPVP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_4

3668746-3668880

Orphan

Consensus_repeat	Method
GGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of NZ_CP044407_4

>merge|NZ_CP044407|4|3668746-3668880|CRISPRCasFinder
GGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGACGTGTTTGCCTGCACCACCCTCGGCGTCAGGCCCCAGGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC

>NZ_CP044407|4|4|3668746-3668880|CRISPRCasFinder
GGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC	GTGTTTGCCTGCACCACCCTCGGCGTCAGGCCCCA
GGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151010077.1\|3676360_3676669_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235500
NZ_CP044407.1\|WP_151010070.1\|3666485_3667226_-\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	unknown	unknown	gnl\|CDD\|379346
NZ_CP044407.1\|WP_151010062.1\|3659613_3660096_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379324
NZ_CP044407.1\|WP_151010063.1\|3660120_3660360_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|153418
NZ_CP044407.1\|WP_151010065.1\|3660843_3661116_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010078.1\|3677073_3678288_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293805
NZ_CP044407.1\|WP_151010064.1\|3660405_3660660_-\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|153418
NZ_CP044407.1\|WP_151010073.1\|3669400_3670426_-\|aspartate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|237845
NZ_CP044407.1\|WP_151010076.1\|3672683_3674378_+\|metallophosphoesterase	unknown	unknown	gnl\|CDD\|365906
NZ_CP044407.1\|WP_151010067.1\|3663253_3663883_-\|WYL-domain-containing-protein	WYL	pfam13280_WYL_CAS-I:CAS-III	gnl\|CDD\|379100
NZ_CP044407.1\|WP_151018072.1\|3670588_3670909_+\|PspC-domain-containing-protein	unknown	unknown	gnl\|CDD\|377200
NZ_CP044407.1\|WP_151010080.1\|3680464_3681391_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|132257
NZ_CP044407.1\|WP_151010068.1\|3664273_3665467_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|377658
NZ_CP044407.1\|WP_151010071.1\|3667346_3668375_+\|enterochelin-esterase	unknown	unknown	gnl\|CDD\|225256
NZ_CP044407.1\|WP_151010066.1\|3661519_3663250_+\|BCCT-family-transporter	unknown	unknown	gnl\|CDD\|376718
NZ_CP044407.1\|WP_151010074.1\|3670913_3672182_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP044407.1\|WP_151010079.1\|3678348_3679446_-\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|235874
NZ_CP044407.1\|WP_151010075.1\|3672288_3672630_-\|metallopeptidase-family-protein	unknown	unknown	gnl\|CDD\|240572
NZ_CP044407.1\|WP_151010072.1\|3669127_3669346_+\|DUF2277-family-protein	unknown	unknown	gnl\|CDD\|378364
NZ_CP044407.1\|WP_151010069.1\|3665539_3666361_-\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|226188

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151010077.1\|3676360_3676669_+\|SDR-family-oxidoreductase	gnl\|CDD\|235500	PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated.	2.664e-27
NZ_CP044407.1\|WP_151010070.1\|3666485_3667226_-\|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein	gnl\|CDD\|379346	pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase. This domain includes the enzyme Phosphoenolpyruvate phosphomutase (EC:5.4.2.9). This protein has been characterized as catalyzing the formation of a carbon-phosphorus bond by converting phosphoenolpyruvate (PEP) to phosphonopyruvate (P-Pyr). This enzyme has a TIM barrel fold.	3.51844e-79
NZ_CP044407.1\|WP_151010062.1\|3659613_3660096_-\|AAA-family-ATPase	gnl\|CDD\|379324	pfam13671, AAA_33, AAA domain. This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif.	3.63791e-15
NZ_CP044407.1\|WP_151010063.1\|3660120_3660360_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|153418	cd07377, WHTH_GntR, Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators. This CD represents the winged HTH DNA-binding domain of the GntR (named after the gluconate operon repressor in Bacillus subtilis) family of bacterial transcriptional regulators and their putative homologs found in eukaryota and archaea. The GntR family has over 6000 members distributed among almost all bacterial species, which is comprised of FadR, HutC, MocR, YtrA, AraR, PlmA, and other subfamilies for the regulation of the most varied biological process. The monomeric proteins of the GntR family are characterized by two function domains: a small highly conserved winged helix-turn-helix prokaryotic DNA binding domain in the N-terminus, and a very diverse regulatory ligand-binding domain in the C-terminus for effector-binding/oligomerization, which provides the basis for the subfamily classifications. Binding of the effector to GntR-like transcriptional regulators is presumed to result in a conformational change that regulates the DNA-binding affinity of the repressor. The GntR-like proteins bind as dimers, where each monomer recognizes a half-site of 2-fold symmetric DNA sequences.	1.59077e-19
NZ_CP044407.1\|WP_151010073.1\|3669400_3670426_-\|aspartate-semialdehyde-dehydrogenase	gnl\|CDD\|237845	PRK14874, PRK14874, aspartate-semialdehyde dehydrogenase; Provisional.	0
NZ_CP044407.1\|WP_151010078.1\|3677073_3678288_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293805	cd07719, arylsulfatase_AtsA-like_MBL-fold, Pseudoalteromonas carrageenovora arylsulfatase AtsA and related proteins; MBL-fold metallo-hydrolase domain. Arylsulfatase (also known as aryl-sulfate sulfohydrolase, EC 3.1.6.1). Pseudoalteromonas carrageenovora arylsulfatase AtsA may function as a glycosulfohydrolase involved with desulfation of sulfated polysaccharides, which catalyzes hydrolysis of the arylsulfate ester bond, producing the aryl compounds and inorganic sulfate. CD also includes some sequences annotated as ribonucleases. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily.	5.11739e-57
NZ_CP044407.1\|WP_151010064.1\|3660405_3660660_-\|GntR-family-transcriptional-regulator	gnl\|CDD\|153418	cd07377, WHTH_GntR, Winged helix-turn-helix (WHTH) DNA-binding domain of the GntR family of transcriptional regulators. This CD represents the winged HTH DNA-binding domain of the GntR (named after the gluconate operon repressor in Bacillus subtilis) family of bacterial transcriptional regulators and their putative homologs found in eukaryota and archaea. The GntR family has over 6000 members distributed among almost all bacterial species, which is comprised of FadR, HutC, MocR, YtrA, AraR, PlmA, and other subfamilies for the regulation of the most varied biological process. The monomeric proteins of the GntR family are characterized by two function domains: a small highly conserved winged helix-turn-helix prokaryotic DNA binding domain in the N-terminus, and a very diverse regulatory ligand-binding domain in the C-terminus for effector-binding/oligomerization, which provides the basis for the subfamily classifications. Binding of the effector to GntR-like transcriptional regulators is presumed to result in a conformational change that regulates the DNA-binding affinity of the repressor. The GntR-like proteins bind as dimers, where each monomer recognizes a half-site of 2-fold symmetric DNA sequences.	4.39065e-21
NZ_CP044407.1\|WP_151010076.1\|3672683_3674378_+\|metallophosphoesterase	gnl\|CDD\|365906	pfam00149, Metallophos, Calcineurin-like phosphoesterase. This family includes a diverse range of phosphoesterases, including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this superfamily centre around the metal chelating residues.	1.06709e-13
NZ_CP044407.1\|WP_151010067.1\|3663253_3663883_-\|WYL-domain-containing-protein	gnl\|CDD\|379100	pfam13280, WYL, WYL domain. WYL is a Sm-like SH3 beta-barrel fold containing domain. It is a member of the WYL-like superfamily, named for three conserved amino acids found in a subset of the superfamily. However, these residues are not strongly conserved throughout the family. Rather, the conservation pattern includes four basic residues and a position often occupied by a cysteine, which are predicted to line a ligand-binding groove typical of the Sm-like SH3 beta-barrels. A WYL domain protein (sll7009) is a negative regulator of the I-D CRISPR-Cas system in Synechocystis sp. It is predicted to be a ligand-sensing domain that could bind negatively charged ligands, such as nucleotides or nucleic acid fragments, to regulate CRISPR-Cas and other defense systems such as the abortive infection AbiG system.	2.59399e-39
NZ_CP044407.1\|WP_151018072.1\|3670588_3670909_+\|PspC-domain-containing-protein	gnl\|CDD\|377200	pfam04024, PspC, PspC domain. This family includes Phage shock protein C (PspC) that is thought to be a transcriptional regulator. The presumed domain is 60 amino acid residues in length.	4.89111e-22
NZ_CP044407.1\|WP_151010080.1\|3680464_3681391_-\|VOC-family-protein	gnl\|CDD\|132257	TIGR03213, Biphenyl-23-diol_12-dioxygenase_1, 2,3-dihydroxybiphenyl 1,2-dioxygenase. Members of this protein family all have activity as 2,3-dihydroxybiphenyl 1,2-dioxygenase, the third enzyme of a pathway for biphenyl degradation. Many of the extradiol ring-cleaving dioxygenases, to which these proteins belong, act on a range of related substrates. Note that some members of this family may be found operons for toluene or naphthalene degradation, where other activities of the same enzyme may be more significant; the trusted cutoff for this model is set relatively high to exclude most such instances. [Energy metabolism, Other].	7.67791e-78
NZ_CP044407.1\|WP_151010068.1\|3664273_3665467_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|377658	pfam06441, EHN, Epoxide hydrolase N-terminus. This family represents the N-terminal region of the eukaryotic epoxide hydrolase protein. Epoxide hydrolases (EC:3.3.2.3) comprise a group of functionally related enzymes that catalyze the addition of water to oxirane compounds (epoxides), thereby usually generating vicinal trans-diols. EHs have been found in all types of living organisms, including mammals, invertebrates, plants, fungi and bacteria. In animals, the major interest in EH is directed towards their detoxification capacity for epoxides since they are important safeguards against the cytotoxic and genotoxic potential of oxirane derivatives that are often reactive electrophiles because of the high tension of the three-membered ring system and the strong polarization of the C--O bonds. This is of significant relevance because epoxides are frequent intermediary metabolites which arise during the biotransformation of foreign compounds. This family is often found in conjunction with pfam00561.	3.24574e-61
NZ_CP044407.1\|WP_151010071.1\|3667346_3668375_+\|enterochelin-esterase	gnl\|CDD\|225256	COG2382, Fes, Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism].	5.25309e-15
NZ_CP044407.1\|WP_151010066.1\|3661519_3663250_+\|BCCT-family-transporter	gnl\|CDD\|376718	pfam02028, BCCT, BCCT, betaine/carnitine/choline family transporter.	0
NZ_CP044407.1\|WP_151010074.1\|3670913_3672182_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.12959e-49
NZ_CP044407.1\|WP_151010079.1\|3678348_3679446_-\|FAD-dependent-monooxygenase	gnl\|CDD\|235874	PRK06847, PRK06847, hypothetical protein; Provisional.	1.06527e-154
NZ_CP044407.1\|WP_151010075.1\|3672288_3672630_-\|metallopeptidase-family-protein	gnl\|CDD\|240572	cd12952, MMP_ACEL2062, Minimal MMP-like domain found in Acidothermus cellulolyticus hypothetical protein ACEL2062 and similar protein. The subfamily includes an uncharacterized protein from Acidothermus cellulolyticus (ACEL2062) and its homologs from bacteria. Although its biological role remains unclear, ACEL2062 contains a minimal metalloprotease (MMP)-like domain consisting of 3-stranded mixed 2-beta sheets and a HExxHxxGxxD/S (x could be any amino acid) motif. It may belong to a superfamily of bacterial zinc metallo-peptidases, which is characterized by a conserved HExxHxxGxxD motif.	7.91378e-45
NZ_CP044407.1\|WP_151010072.1\|3669127_3669346_+\|DUF2277-family-protein	gnl\|CDD\|378364	pfam10041, DUF2277, Uncharacterized conserved protein (DUF2277). Members of this family of hypothetical bacterial proteins have no known function.	7.83488e-25
NZ_CP044407.1\|WP_151010069.1\|3665539_3666361_-\|DUF2236-domain-containing-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	9.31255e-70

>NZ_CP044407.1|WP_151010071.1|3667346_3668375_+|enterochelin-esterase
MLPWSAELAGRLEEHVVGSELLRGNPLGDPHERPVLVYTPPGYDDEPGRRYPSVYVITGFTGHVGIWRNRTPYRRPFPETADAVFASGEAPPAIVVFVDAWTAHGGSQFLDSPGTGRYHSYLCDEIVPWVDARYRTLDAPEHRAISGKSSGGYGAMITPMLRPDLFGALATHAGDALFEYCYLPEFPQAVRHLRKYDGDIMRWWADFNARVSFTRPEDMVLLNLLGMTLCYSARDDGTPELPFDPVSGVLRQDVWERWLAWDPVRMVPGHAAAMRAQRAIWIDGGTRDEWYLDVGAEAFRRALRDAGVADDTVRFELFDAGHGGIDYRYPMALAWLAHRIAP
>NZ_CP044407.1|WP_151010070.1|3666485_3667226_-|isocitrate-lyase/phosphoenolpyruvate-mutase-family-protein
MTDEARDRAGRLRDLHRPGDPLVLPNVWDAASARVVQEAGFPALATASAAISAMLGYPDGEAAPVDEMFAAAARVVRVAEVPVTVDAEAGYGLPPVELVERLLEMGAAGCNLEDGRGGALVDPEEQAAYLAGVRAAAGDALVINARADTFILQAPDPLDGALARGRRYLEAGADCVYPIMAPAETVKALAEGLPGPVNVNQFPGTSLGELAAAGAARISYGPFPHVHAMEALKEFAGRLRAGEDPV
>NZ_CP044407.1|WP_151010069.1|3665539_3666361_-|DUF2236-domain-containing-protein
MPVTQEQTPKVVIDSISGLALAAAAANVVMQLSRLPVGHGVAKSTVDSGRVDKHPIKRARTTLTYIAVALLGSEDERAAMRREVDRQHRHVNAREPVPYNAFNRDLQLWVAACLYMGTEDIYRILYGEPTGAQREILYRYGARFGTTLQMTEDMWPADRDAFQKYWDASLAEIEMDDLTRGYLRDLAELKFLPAPVPQLFGGFNRFQTVGFLPQPFRDELGYRWTRRDQARFDRLMRVLGGVNRVLPRPLREFPFNVYLWDVRRRIRGGIAIV
>NZ_CP044407.1|WP_151010068.1|3664273_3665467_+|alpha/beta-fold-hydrolase
MDDIRPFTIDIPQDLLDDLDDRLARTRWPDELPGVGWDRGVPAGYLRELAEHWRTGYDWRVHEAALNEHPQFTTVIDGQNVHFLHVRSPEPDAVPLLLLHGWPGTFADFLDVIGPLSDPRAHGADPSAAFHLVVPSLPGFGFSTPLAGPGMSAARMAAVLGELMERLGYARYGVHGYDTGSWVGPELGKAAPDRVTGVHVNGMITFPLGAEGEMDALSDAERERWRRMQDFNDGYLQCNSKRPQTVAYGLHDSPSGQLAWIVEKFKELTMPEDGLPEDAIDRDRILTDVSLYWLTGTAASAAQVYYEEFVNANAWSAEGGAEDGGDWGDDGGGWEPEAATVPTGVLVSAHDVTIRPWAERDHNVVRWTELGKGGHFLAMEEPEAVVDDLRGFFASVR
>NZ_CP044407.1|WP_151010067.1|3663253_3663883_-|WYL-domain-containing-protein
MLPSRLRYRVDTLNAATVRAGAPPGPAADPAALMAIADACRRGESLRIDYRSPRGGDTVRTVEPHRLVSFGRHWYLVAWDPGRDGWRTFRVDRLTPRTPPGPRFVPRPPPDGDVAAYLARTLSARAWPVRATVVLHVPAGEAADRVWPGMGAVEAVDDRTCRLHVGAESPADLVWMITSVGVGFTVADGPPELANALRVQARRCLDAVR
>NZ_CP044407.1|WP_151010066.1|3661519_3663250_+|BCCT-family-transporter
MTDHGTDREPGHDAPPGKTEERARTDWIVYGISAVVALAFVAWGVVWTDSLSDTAQSALDWLLTNVGWLFVLAATGFVVFSLWLAVSKYGRIPLGKEGDEPEFRTISWIAMMFSAGMGIGLMFFGMAEPLIHFVDPPPGTAAAGSEAAIGTSMATTLFHWTLHPWAIYAVLGLAIGYGHYRRGRKQLISSAFAPLLPKGRGEGPAGKTIDILALFATLFGSAASLGIGALQIQTGMQEAGWIESLSQTVLVLIIVVLTICFILSAVSGVAKGIQWLSNINMVLAVILAIFVFVVGPTVFMLQLVPTAVGNYIQDFGQMASRSGATGGADMEEFLSGWTIFYWAWWISWAPFVGMFLARISRGRTIRQFVAGVIIVPSVVSLIWFAIFGGVAIREQQNGANPYGDGSEEQITFNVLAELPWTGITSVLVMILVAIFFVSGADVSSIVMGTLSQRGTTAPSRWIVIFWGGLTGAVAAIMLVIGGDTALQGIQNLTFIGSLPFTIVLIVLCVALAKDLRDDPMTRRQIKGAEVLEEAVVAGSREHKGDFELATRPSGNGGESAEDAAGRTIERPDLGKS
>NZ_CP044407.1|WP_151010065.1|3660843_3661116_+|hypothetical-protein
MDTNRTAPPSARWDGPAYDERGGHWTARLRHTLPDRERATGLETVVYGPTEWACVAEANRQDRLWVEYPLRTDDRDGARARLRFLAGGAG
>NZ_CP044407.1|WP_151010064.1|3660405_3660660_-|GntR-family-transcriptional-regulator
MIDLDGMEPLRDQVAAVIMGRIVDGTYPVGRRIPSNRAIADEFGVSTNTAEAAVKRLRDRGLVQGVHGRGTFVIAKPDAQPPDG
>NZ_CP044407.1|WP_151010063.1|3660120_3660360_-|GntR-family-transcriptional-regulator
MGVDLEGAEPLYRQVAAEVERRIAEGVYPAGKRIPSTAELSEEFGVSRRTITDAFVLLKDRGVVRGVQGRGTFARAADG
>NZ_CP044407.1|WP_151010062.1|3659613_3660096_-|AAA-family-ATPase
MGEVVVLIGLQASGKTTFYRARFAETHVHVSKDLFPKARRKQARQLRLVAEALEAGRDVAVDNTNPSPDEWAPLLDVARRFGARASGYWFPPDVGLSMRRNALRPPEIRVPDVGVYATLKRLRRPGPGDGFDELWTVRPDGRGGFAVAPLEGGADAQRRP
>NZ_CP044407.1|WP_151010072.1|3669127_3669346_+|DUF2277-family-protein
MCRSIKTLRPPFTEVTTDEDVRAAALQYVRKVSGFRAPAAHNAEAFDRAVEEIAASTARLLETLEVRGARSA
>NZ_CP044407.1|WP_151010073.1|3669400_3670426_-|aspartate-semialdehyde-dehydrogenase
MRIGIVGATGQVGSVMREILAERAFPADELRLFASARSAGRKLPWKDGEITVEDAATADYTGLDIVLFSAGKGSSKELAPKVAAAGAVVVDNSSAWRLDPDVPLVVSEVNPHAVANRPKGIIANPNCTTMAAMPVLRPLHDEAGLEALVVSTYQAVSGSGLAGVSELHEQSRKVVENADKLTHDGSAVQFPEPNVYVRPIAFNVLAMAGSIVDDGLNETDEEQKLRNESRKILEIPGLKVSGTCVRVPVFTGHSLQVNARFARPLSPERAAELLAAAPGVELSDVPTPLQAAGQDPTFVGRIRRDETVDNGLSLFCSGDNLRKGAALNTIQIAELIAAEKR
>NZ_CP044407.1|WP_151018072.1|3670588_3670909_+|PspC-domain-containing-protein
MEKSTTGKSLRRIHDGRMIAGVCAGAGRFLGVDANIVRLGLAVFTLFGGAGIALYVIGWLLMPDEGAPKSIAEDLAKKAGDSPAFQDAVQKAKDAVGSKKKDTTSV
>NZ_CP044407.1|WP_151010074.1|3670913_3672182_-|MFS-transporter
MAGRQRRAGRHRRPPEAQATYREVFAVGEFRALWLAQALSFIGDQLAQVALAVLVYERTGNALLTAATYALTYLPPIVGGPLLSGLADVFPRRTVMIVCDVLRAVLVALMAVLALPLGGLCVLVFLTVLLGTPFTAARAAVLPDVLEGDRFVAGTAINNITHQITQMLGFLAGGAIIAAVGAREALALNALTFGVSAVILIAGLRRRPAPKERDAQSLGLWRGMRDGARLVFGDPTLRSLVSFAWLCAFYTIPEGLAAPYAATFDGSAVTVGLLMSAMPMGMVIGAFLFSRFVRPASRLRSMGWMAMLACLPLVGAGLNPPLWAVVLLWALSGAGSAYQLAANAAFVAAVPPSGRGQAFGLAQSGILAGQGVGILVGGAVAEALGPQTVVALAGVLGLSVAAMLTLSWNQVRGAAIAGTHAA
>NZ_CP044407.1|WP_151010075.1|3672288_3672630_-|metallopeptidase-family-protein
MIELSRDAFEDLVGEALDTIPPELTAHMRNVVIVVEDDAPERGLLGLYQGVPLTERGDWYGGVLPDHISIYRREILRICETEEDVVDEVRITVVHEIAHHFGIDDDRLHELGY
>NZ_CP044407.1|WP_151010076.1|3672683_3674378_+|metallophosphoesterase
MAQTRSRLGAGLGRLGGSPAARRVRTALAPTARRTGAGARRTGRVLRSRPSRVAAVVLAGLAAGYIGLLFGGRVVTPVGPTDVQLSLQPSMHGGTALELPPIGALRLDTHWGPLALEARLTEVRPDEAQRLIENDVELTRLTDQIAGQLRDGVQDLLVRAGVLALAASFVATLVLFRSWRRALLGMSSAATGIAAVLLLTWTTFNPRAISEPRYTGLLANAPQVVGDAQNLVDRFSVYREQLAKLVGNVSELYATTSTLPVYEPDPSTIRVLHVSDIHLNPAAWNVIDSVATQFQVNFIIDSGDLMDHGSEPENEFANSIEDLDVPYVFVRGNHDSEGTAEAVADQDNAIVLDDETREIEGLRVYGVGDPRFTPDKSTRGDAVGADQIYAEGAVLAEALRESRANPDIAVVHDPTEGRAFSGLTPLVLSGHTHKRATELLPTGTRLFVQGSTGAAGLRGLEHEEPTPFELSVLYFNRSTKRLQGWDDLRLGGLGLTSANIERKLEPEPDHPIEPRPPAITPPSSPTSPFPSEWPSDWPSRTPSSPPPSPSPFGASPRASDPGGG
>NZ_CP044407.1|WP_151010077.1|3676360_3676669_+|SDR-family-oxidoreductase
MAMPQQLAYAMSKGALDQLTLHLARHLAPRRITVNGVLPGPTDNGSAAFQLPEVREPMSQLSAFKRLGEPEEVADIVVFLATEQAGWITGASLDATGGGLLG
>NZ_CP044407.1|WP_151010078.1|3677073_3678288_-|MBL-fold-metallo-hydrolase
MENGPPPHPLEWRVDLSSAEGRFPSIRLDLAHRDKSTCYPQPSIPEEASIVHECESESQIPTVSRRSLLGTAALLGGAVGATMLHAEPAHARQPTRKGAQLVLLGTAGGPPPFGNRTGIASALVVNGNTYLIDCGRGAVTQYLRAGLTMPSLKAIFITHLHADHIVDYFSFPLLCAGVQPPQPGLGGMVDVYGPGPGGTPSGPITPEDPAPGLAETTRRANETFAASSNAFITSRFGIDPTSMLRVHEQPASPAAFTVMENDDLKVTATLVPHGNVRSYAYRFDTDAGSVTFSGDTALSEALNRLAHRTDVLVHEAVDVSWFRAQGMGEPLIQHMTSVHVDVADIGKVGAASDARKIVLSHLAPGDPTVRSHAAWARAARAGARTAGYTGRVIPGHDLMRIPLG
>NZ_CP044407.1|WP_151010079.1|3678348_3679446_-|FAD-dependent-monooxygenase
MKVLIVGGGIAGTSLAILLARAGVTVELAERHPTWTALGSGITLQGNALRVLRDLGVWDRVKAEGYAFDSVGIRTPTGKLLFESDDIKSGGPDLPASLGMYRPALCAILVEAAQSAGAELTLGRTVTSVDPVAFDDGTTGEYDLVVGADGIRSSVRRMIGIGTEPRPVGMGAWRAHVPRPAQIQRTELMYGGPCYIAGYCPTGENSIYAYLVDKVTDQAVIPRERLADMMRELAQPYGGAWEEIKPTLTDTAPINYTHFEWLLVDEPWHRGNVLLLGDAVHACPPTLAQGAAQCLEDAAVLAELLLARGGPDQTLFEEFRDRRIERVRTVVETSLQIARWQMEPGPGADVPGAMARVAAAMTDRP
>NZ_CP044407.1|WP_151010080.1|3680464_3681391_-|VOC-family-protein
MTEIAKLGYVGVESPDYAEWRTWAPETFACMLGPDGDDGAVRVKIDDADYRLSIHPGQEHRLAYVGWEVLDHRDLDSLEARLEKAGADPRRADRALCEARGVQELVTFTDLYGQPYEAFCYQSSGYRDWDPPRPHQGFVTGDQGLGHVVFVVPDAKEASEWHTDVLGFQTTDIIRLNPPLGDMWFLRSNPRHHSIAFLQMDDMLGLHHIYLECNSLDDVGYAYYDVLGGDQNPDLLMRLGRHIGDQTVSFYIHNPAGFFIEYGWDGLPIPETEARSPRYIDVTKGKRAEMWGHHFVMQPNETVRPYQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_5

4339607-4339758

Orphan

Consensus_repeat	Method
GACTCTTCCAGGAGATCGCGCTTTCACGCACTAAGCGCGTCGCTCTAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_5

>merge|NZ_CP044407|5|4339607-4339758|CRISPRCasFinder
GACTCTTCCAGGAGATCGCGCTTTCACGCACTAAGCGCGTCGCTCTAGCCTGACTTGGCTCACGGGGCGGGACGGAACCAACTGACATCGTGTTGACCTGTGACGACTCTTCCAGGAGATCGCGCTTTCACGCACTAAGCGCGTCGCTCTAG

>NZ_CP044407|5|5|4339607-4339758|CRISPRCasFinder
GACTCTTCCAGGAGATCGCGCTTTCACGCACTAAGCGCGTCGCTCTAG	CCTGACTTGGCTCACGGGGCGGGACGGAACCAACTGACATCGTGTTGACCTGTGAC
GACTCTTCCAGGAGATCGCGCTTTCACGCACTAAGCGCGTCGCTCTAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151010667.1\|4357108_4357648_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010657.1\|4347087_4352166_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010648.1\|4336918_4338577_+\|restriction-endonuclease	unknown	unknown	gnl\|CDD\|223989
NZ_CP044407.1\|WP_151010636.1\|4325647_4327444_-\|prolyl-oligopeptidase-family-serine-peptidase	unknown	unknown	gnl\|CDD\|224423
NZ_CP044407.1\|WP_151010671.1\|4359064_4359352_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010638.1\|4327460_4328447_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|99777
NZ_CP044407.1\|WP_151010634.1\|4324349_4325969_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP044407.1\|WP_151010646.1\|4333354_4334284_+\|DNA-mismatch-endonuclease-Vsr	unknown	unknown	gnl\|CDD\|238136
NZ_CP044407.1\|WP_151010663.1\|4356368_4356806_-\|transposase	unknown	unknown	gnl\|CDD\|379340
NZ_CP044407.1\|WP_151010645.1\|4330475_4331537_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010632.1\|4323919_4324261_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010655.1\|4342540_4346038_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|224125
NZ_CP044407.1\|WP_151010665.1\|4356793_4357045_-\|transposase	unknown	unknown	gnl\|CDD\|379340
NZ_CP044407.1\|WP_151010669.1\|4358224_4359040_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP044407.1\|WP_151010650.1\|4338633_4339200_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010661.1\|4355194_4356043_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010642.1\|4329471_4330119_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010653.1\|4341405_4342551_+\|DUF1837-domain-containing-protein	unknown	unknown	gnl\|CDD\|378078
NZ_CP044407.1\|WP_151010640.1\|4328720_4329422_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151010659.1\|4352190_4355214_-\|caspase-family-protein	unknown	unknown	gnl\|CDD\|238121

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151010655.1\|4342540_4346038_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|224125	COG1204, COG1204, Superfamily II helicase [General function prediction only].	3.72179e-46
NZ_CP044407.1\|WP_151010669.1\|4358224_4359040_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.84604e-16
NZ_CP044407.1\|WP_151010634.1\|4324349_4325969_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.25161e-53
NZ_CP044407.1\|WP_151010636.1\|4325647_4327444_-\|prolyl-oligopeptidase-family-serine-peptidase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	6.96646e-78
NZ_CP044407.1\|WP_151010653.1\|4341405_4342551_+\|DUF1837-domain-containing-protein	gnl\|CDD\|378078	pfam08878, DUF1837, Domain of unknown function (DUF1837). This family of proteins are functionally uncharacterized.	1.15058e-07
NZ_CP044407.1\|WP_151010638.1\|4327460_4328447_-\|hypothetical-protein	gnl\|CDD\|99777	cd06170, LuxR_C_like, C-terminal DNA-binding domain of LuxR-like proteins. This domain contains a helix-turn-helix motif and binds DNA. Proteins belonging to this group are response regulators; some act as transcriptional activators, others as transcriptional repressors. Many are active as homodimers. Many are two domain proteins in which the DNA binding property of the C-terminal DNA binding domain is modulated by modifications of the N-terminal domain. For example in the case of Lux R which participates in the regulation of gene expression in response to fluctuations in cell-population density (quorum-sensing), a signaling molecule, the pheromone Acyl HSL (N-acyl derivatives of homoserine lactone), binds to the N-terminal domain and leads to LuxR dimerization. For others phophorylation of the N-terminal domain leads to multimerization, for example Escherichia coli NarL and Sinorhizobium melilot FixJ. NarL controls gene expression of many respiratory-related operons when environmental nitrate or nitrite is present under anerobic conditions. FixJ is involved in the transcriptional activation of nitrogen fixation genes. The group also includes small proteins which lack an N-terminal signaling domain, such as Bacillus subtilis GerE. GerE is dimeric and acts in conjunction with sigmaK as an activator or a repressor modulating the expression of various genes in particular those encoding the spore-coat. These LuxR family regulators may share a similar organization of their target binding sites. For example the LuxR dimer binds the lux box, a 20bp inverted repeat, GerE dimers bind two 12bp consensus sequences in inverted orientation having the central four bases overlap, and the NarL dimer binds two 7bp inverted repeats separated by 2 bp.	0.00186832
NZ_CP044407.1\|WP_151010659.1\|4352190_4355214_-\|caspase-family-protein	gnl\|CDD\|238121	cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.	0.00102305
NZ_CP044407.1\|WP_151010646.1\|4333354_4334284_+\|DNA-mismatch-endonuclease-Vsr	gnl\|CDD\|238136	cd00221, Vsr, Very Short Patch Repair (Vsr) Endonuclease. Endonucleases in DNA repair that recognize damaged DNA and cleave the phosphodiester backbone. Vsr endonucleases have a common endonuclease topology that has been tailored for recognition of TG mismatches.	7.80848e-31
NZ_CP044407.1\|WP_151010648.1\|4336918_4338577_+\|restriction-endonuclease	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	3.63556e-60
NZ_CP044407.1\|WP_151010663.1\|4356368_4356806_-\|transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	1.21301e-18
NZ_CP044407.1\|WP_151010665.1\|4356793_4357045_-\|transposase	gnl\|CDD\|379340	pfam13701, DDE_Tnp_1_4, Transposase DDE domain group 1. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	2.38281e-06

>NZ_CP044407.1|WP_151010650.1|4338633_4339200_+|hypothetical-protein
MYHTADELDWEFLSNPGKTAQYRRWFDDPEIGGELRKFASDQDVRVWIKDVPMKEYARAQEGIGNFVPYVRRRFRGAGEIVQFFCEPGWSVVPDSVEGKPNHCLATDGNARRYICWGKAGVLNVLIWAALNKAIDSPTRPGILVTTRDGETIPQHARERHIRLANHCGVDLSHLHRSMIDNPDFITRP
>NZ_CP044407.1|WP_151010648.1|4336918_4338577_+|restriction-endonuclease
MQSFLDPAPLLDAGPLQFPRRVERLLWHLGFTDVAVIDGSGDEGGDVLARRRGELWVFQCKWKRRGVVGADAVEEVDNARDHYCAHQAVVVTNSRFSPDARRRVDVLARIRPSIHLWEGGHLARSFKGIPPRFGTVTPRSYQAEALWSLDKDLESHGRALLVLATGLGKTVVGGEVIDAHLRRHPSDQVLVVAHAKDLVQQLERALWRHLPKDIPTRLLTGDTRPDDLSGVTCATVGSALPAARFGYRPALVMVDEAHHVGEDGQYDELLDVLSIARQFGVTATPWRGDSHDISHHFGAASFTLGIEEGMRRGYLAQVDYQLFVDNVDWDVVKAASEHEYGLADLNARLFLPQRDESIQDELAAAWASTANPRAIVFCRTVEHAERLAKLLRRTPLWSGALSLHAGLAKRERQSRLLAFRSGEVPILTSVDILNEGVDVPDVNILCFARVTHSRRIFVQQLGRGLRLREGKERVTVLDFVSDLRRIAAALNMKRSLEGGEVEVLDQVAPSQIEFNDQRVATLMEEWIKDAASLETAYDEHRLQFPSALAALE
>NZ_CP044407.1|WP_151010646.1|4333354_4334284_+|DNA-mismatch-endonuclease-Vsr
MTSGNATTRQGRWKEKQPPERAWKGRPGRTRAQAAAEQDRAAGGPDRRWVDLGGGRRARASVELKMQTKTRRIRAYLRWSDKGATRNPVYLGEVDYDTRRKNLAEAWRRAIERDLVLPQEETPASSWAASGSVRASMRGNRSRDTTPEKLLRKRLHERGVRYRVSHRPMPGMRRTADVAFLGAKVAVFVDGCFWHGCPDHCRWPRTNEEFWRDKIKGNRARDFETNRLLKQSGWLPVRVWEHEDPSEAADKIITVVRARQLLAAPKTRTSQINHSQELGDGDHSATPQDAPGGHAVGEQAAAAPETGRQ
>NZ_CP044407.1|WP_151010645.1|4330475_4331537_+|hypothetical-protein
MQTVADAGYMDRRSFLMLMGASITSPTHEWLIAHPVTKLAQETGTAVPALVVDDLDAITARLRHMDDQLGGGPLLQLVHGHLRYVTTLLHHGRYDDTIGWRLHATAAELLRLAGFVAFDDGQHGLAQRYWVAGLHAAHTAGDRALGANIIGFMSCQAKDLDGGREAVLLAQTARTGHPGASNRVTAILELRAAEAHAGDQTATTARRATDIRRSVDAAFDALSTDSLTGDPGWSYWMTATHAHGQAGYCHLRNRDYQRARHHLRQALHHDGSSREGALRQILLATTYVQQPQPDLEPALTNAHRALDTLSGQVDSARCRGHLSRFAEHLHPYRRNHAAREFLDRIESTSPQPR
>NZ_CP044407.1|WP_151010642.1|4329471_4330119_-|hypothetical-protein
MGLGMVVGLLADMEAQGDVEYADTVRAEFALIGELLVEAGAGSWDEPRLTAQDVQAYGMGYSGLHTVRRLAVHLARRGRLPEPLEDFSRAAKDRLLKKAYARMPDGGPFDHLVHHSDCEGYYVPVPFDALIVDERLTGGWLGSSVRLLDEVRRIAAALELPEDLDPDSEEVDEVLRGERRSAERWRRYGVESFTCLQLIGAAKHSLATGAAIAFT
>NZ_CP044407.1|WP_151010640.1|4328720_4329422_+|hypothetical-protein
MNVLTRICTCAKQPTTKQCSVSTATATRPHTRDRICSLFRQRITSRLRTASPPSADTEPLALAFGHPHGAGFIGAGADGLLRAALTEALTSKLGVSWVIATERDLRSLFDDAFNDALADQLVPRLHVAETLEDIVERLEFEADVIRALSVNDRPALTASTVLWFTAPGPDGDVVHEAMQSWPGTGLVPLIAGPWPYGPTYLVDSDGPRPLPRRPINLLTAQQATTKLQATMAA
>NZ_CP044407.1|WP_151010638.1|4327460_4328447_-|hypothetical-protein
MHTEAEQTAKQLLTDMVSDELLALYTRLLRIDGCLREEAANLLDGPEQVEALIGAGSALVRSSGPGTPAQLVPTRPDLALQGLLVELSRRMVADQDRLLTGQRRMSTMHLWPSSMDGSADGLVQVIVDRDQISRVARGLISSASFEWLTLDNQSVERPMDELTAVPPPPSFDGHVRCRAIYESACAEHPVGLKTIEIAVEAGEEARLLPRLGMKMKIADESIALLPLTPTGMTGALLIRSPVIIGALREYFEFLWERAVPFGAASPLSDMQKYVLNMMVEDVTVEQMAKRAGVSVPTIRRHSTAIRNMLGVDLPFAAGAAAVRRGWVK
>NZ_CP044407.1|WP_151010636.1|4325647_4327444_-|prolyl-oligopeptidase-family-serine-peptidase
MPGYKDFVPRQSFQPTLALSPDATLVAYSGNTSGQYDLWIVPATGGESRRLTDLAGQAVRNVAWSPDGKYLVFTADREGDEQYRLYRVGVDDEQPIDISTGPHCQRVLASSPFDASGRFLAYAANDRDRAVQDVLVRDLDDDSERRFIPPPGVVFEPAEISPDGRWLLTAGFRSNSDVALYLIDLQSKAEPFCVTSRHGEGLYEPGPWMADSSGFHLITDRWGEFKAVGRYLIDEGTLEPVVQHDWDVEHIDAAGDTLLWSVNQDGRSILHARHDGEPLPIPPLPSGVITAGALAPGASPVAVLLDSATRPTEIVVLAPEDGPRYLTDTRPPAIKTITAVEPESVVYPASAGRRVHALLYRPNQPGPHPVVLSIHGGPEAQERPRYARRGLYQYLLDRGVAVFAPNIAGSTGYGRSHQRLIYRDWGGIDLDDLDHATRYLQDAPDLDADRVAVMGGSYGGFAALSCLARLPFTWAAGVSICGPTNLLTLAQACPPTWRHFVDVVLGNPETDAQHLTDRSPVTYADNITAPLLILQGARDPRVPQAESDQLVHRLRSRGVDVLYNVYADEGHGFTNRANEVQAHEEIADFLIRHLLTSR
>NZ_CP044407.1|WP_151010634.1|4324349_4325969_-|MFS-transporter
MPTHVETLRRCRPRQPGNGRSAPDRPLPGDLCRQHHRAPAHPPGSPGSPRSAGRVRPTRPPSAQPRRGRPLQRLRRRGPRIHQSRERSPGARRDRRLPDPAPPDEPITAITASNQQATSVRQQDVPKALSPLALLTEPSVAPLFFARLLSSVGVGFGQLALAWGVMDLGYGPGGLSIVLACNSAPALLLLFGGLAGDRFRRHHVLMTAEIITCLAWLGLGACFLAGEAPLQLLCALALSSGVATAMFLPTIRGIIADLLSRTGRSAGNALISQTRSIGLLTGLAASGFVVSILGPGWAASTRGALCAVSAVLLSRLDTTRWQNDRTRVLRDLRTGWREFTAHRWVWILTLQYTAVIMAMVCFTDIAGPIYMDDGNGGARAWGIITATDAVGALIGAFIGARWKPARLVLAAALLPAAGAIPMFLLATGIPWPLLAAAALIPGACQAVFYVLWTTALQNTFAPDVLARVNSWNMIAGYALMPLTLLVAGPLVKSIGPQSAALGAGLLTVAAAAVTLVALRAAPDKQTVAKQPPKEVQIHL
>NZ_CP044407.1|WP_151010632.1|4323919_4324261_-|hypothetical-protein
MHRVTINSVEAIVYGVLVLAPSPVLALILWNVGPEHVTGTDLEPLYWAPALLASVSGAVALWCAHVRRTRWRCDYRSLYIIGSLGVVMLIPLGLFALVCLIMSSIGTQDGGWS
>NZ_CP044407.1|WP_151010653.1|4341405_4342551_+|DUF1837-domain-containing-protein
MSQLRRAALARAGSPGRSGDGTRLVRRRPRLDLHALRERGRQRALLQLVRRAAADIDAFDASVRPVPRTADELLVLSTDQKGVVMRLEALWPATAEASRWQGYAAEATSSVRFLQERSIWGWTVRENMADFSRWCTMGTLVSIGDHRSGMLESYDDATGVATVVAIIPDAYAEPESLALLASRLGKEGVAKFLRNKLPTKPNARSGDMGEILATAYLHDECGYVVGPSRLIQRDHQEWAMRGDDVLGASLDSDGKPRITKAEAKSRVSLGEETVKEARKGLARNDELPSPHSLTQFAERLLPTADSRVGEAVLTMQLSDGVRPDRVGHLLFLFTASDPSTHVAADLKAYSGSVSQLTITLRVKGHQKFIKDAYDGVTTGGA
>NZ_CP044407.1|WP_151010655.1|4342540_4346038_+|DEAD/DEAH-box-helicase
MAREARDLTESLLAATDADFRGRLLARGQAQSMIRRGGVLPQDAPQFSPFLDADLLNYGYAMLSTSLDLLETAGENTAGRIALAQQGFIQSSYALEAATRNATPAADLGFHGLVAGAASHLGGYAARAFSLIQASQRLGQLTPMEQTLADLAMRDLNSVERRTQSLRSSPQLSEQNLLAALTAEHERPPEHTSPEQVGPIVLLLSENYLSAVSAALYAIEIGSRELLAIAAGELRLGEQASSDVSAPGPWWVYRLTRRLLGDLFDTSLEIKIPSEPPPGAGDRVELWRDLRRTFVESLLARKRSEIDLWPSQLHVVDRIFRNSKDLVVALPTSAGKTRIAELSILACLAKQQRTVYVTPLRALSAQTEQLLARTFSPLGIRVSSLYGSMGTSDVDEDTLRSSEIVVATPEKLDFALRSDPSVLDDVGLLVLDEGHMIGASEREVRYEAQIQRLLQRSDASTRRILCLSAVFPSGNELDDFVAWITDDEPDSLHREAWRPTQQRFGLVEWRDDHARLTITLGPDQPFIPRYFEARDPTGRRRKTFPANQRELVIATGWRLVEEGQTVLVFCPQRNSVEPYARAIIKLYDQGLISSVLPPDVYLNDALTVGAEWFGADHPILRCLQLGVAIHHGALPGPFRREIERLLQQGSLRVTVASPTLAQGLNLSASAVLFHGLRRGRELLKSSEFANVIGRAGRAFVDTEGLVLHPIFQPNNARRREWLELTQGDGGKALRSGLIEVGIALLRRMTASLGFESIESFLDYLTGGPAWSLPIVSHEPEDERAAAAANWQSNLALLDIGILSTVGDGNQEIDADAATQIVANALIDSLWERQLRRSDEQTAAAVRELVSSRTRHLWSTFTSSQRRGWFLAGLGADAGSELSSVSENIIALANQAESAILDQNYETAADRLAAIADTMFAVEVFAPETALDNWNDVLRHWVHGRPLGDLSGNHAAIAQFIEADVIYRLVWGMEAARVYEAAQGNSDATVLSGTAVTAIETGTFNRAASILIRSGFDHRRAAILAVTSTGATFESAADMRQWIRDLDPELAVNPAWPTPESRSAWTTFAYRARTPRSRQWSHRTEDLQDVTWYDAIPAPDTWLRVTDGEQGKIKVWSTGFDPLGEAPINLNPERQGVLRARRLRTGTGVQLRYRGPGDLFPKAPKH
>NZ_CP044407.1|WP_151010657.1|4347087_4352166_-|hypothetical-protein
MILDSDLQRTDASGVAYEITLALHALAVLTATPGGPGRRRILELVRYLAGRVGALETGCAIPAEPIRCDGATGDPIGLGALLAEHLQPGGMGLETEIAALEDAGLTEILYDVHRRGEELCDSAWLTDAGRATLPIGSAGDSDVHVLLEPVGDWSVIATVAAEFGATPVPVNSTAAEPPDGVFGSRSWSPLTAGYLRETDGALEAARSLISSLGRPQPSRIRADITPPIAVQRPSAVCESTTSAAIALTYLASEAGLPSPAKMGVLPLAAITVDGEWIAPRNEKAALAAAKAAGLRVLRPAAGGWRLDAAEESDGTLSGAARVLWGGDWEAARRRWDEEALHAYGWSILYTSSSALTPVPGGDWGTAAPGLPLIRSDRAEMLQGQYIRQPKLAMILGGPPNSGKSVIARQVAEHLEGLRWRTLTLASNERVLPRADDLIAIVEAAFRLTGIASGEQTLVVIEDLRPLGGRNIGDVMTELTNHLEVSVLAIARYGAGSGGDWESETVTPLPAIVSREQVTDFVASLVDEYPDIYGGATSLLPDLVEASHKDLWMLVRLMREADSRPGPAVKVGDILASFIRRRTARVGDEHVEELRTVVAVSLVGDSVPGEYLPEQVLEALAELGAEQKDEEVRFRSREYARLLLRELTAGTQAPDEEEVPAAEAIPFIARHLVRLLSANQFVHARRLLRASRAFDQATLEALLRKPEVERTIVAWVASASPPNAAHLLAVCEQHMEPAGVASLLRMLLEHVPRAPEVDARQLGAVLRMVSRYHYQLDGTEELDRFVVWLQEPESGLRAVLTRPATLLDRYLLARRLHRLYSRRVAELIIELADVLVQGAISTSASDLVNVRRLDTLLARCHRDADLPLGRRPLETSPVLQDLLEAKPAGNAKVDVIVAWLSLRLHFDDRTDWTQVISEYEVRLRSAFVRATASEIARVLGDLATVHRGFCTMMLNQLRLGRRLREVLRKATAADAAQLISTIAGIHSATIRALLYEEDRDLGTLLPSEDLAHHLALRIRKTRDGKGAGLLLSRTHRADALYCSGRLTFAGRLAHHLGEDFALQQVNNEIRASVLYHLLRGLWDAGATYRKRVEDRAFDLIVGTIKSQYRANRPFAAQLALLLAADDYFGEEFLQKLATAIDPELLASRMAQRGLRDDAAVHLHRLGRAIHPDVPRRYRARLRHLDRLLLSFAPDGAPAAAKQLQVAAVTLRLAGEMSANTVLLREFKAAVSASGRSAWDWGTELGKCRNVSELSQTLNILYKLDPLTASDALKTLGENGGEQEFTSLSDFVARSALDPVELIELLKSAETISPGTGRDLLENLRASRFWYMFTKEFQYEQDPVTQGRIGRILVGLGVVPERDDYHWMNSLVTERWLKVTTLLASPRAVSELLKLSFLWNPGWGQRLAASIDGGRIVGRVRLGATRDLSEVPGLLQVLSLADRSDLVEQIIDALAEFDPDQLQESLGLVRGSQLLRKLRTLRPGRVDVHGEALVRMLDAALHRHLVIDPEAHWRSIGWAAQALRDSGREPPATVPHLPVNSAHGADLCWAATWLPESDWTRQVLDDAFPKFLRTGGRSWGQAEQVAMAFVAGVRSGLLSSPASDDDYWSVVAEARLGTVAMVFREGMSHDGMRPFLSALKPAVQKRLRAPQNRIDIWVDDLRTQLKGIADPAAPTPPGNLFSPRPGPAAGQNLD
>NZ_CP044407.1|WP_151010659.1|4352190_4355214_-|caspase-family-protein
MRSAEDRSAIAERRVCVVAGTQTYVDWKDLRHVPEEISLVRGALVEACGMDAYDGIGLDPTADELKDAVRAATAADPQADIPAADFLVLYYSGHGFLRFDTEFCLAVKNGSRSDESTFISAHALLAAVYDTDVRAAAVILDACVSAEAGGAYGGLLQQIEGRRAFAPTVYLFTSTSRIEDAEQLVFAEAFAAALREPGIPRGKRFIPPSVLRDEIDVRMSRSGQTPTLDFPQVSKVCEIFPNPLNMWRKYDRPSETVSGTGWRFCGRRQAVSEMVAHLSAERPPDRQYLVTGASGSGKSTLLRWVVAAAEGAPLPSGEGDLARLVPLACVDLFLDARDQYAHDVLKQIGDKFGVRSEVGTDDFFRELEGVAGSKRILVDSVHRATEPAELIEDALIPLARLSTTRLVMACDSVPRGLSAHEIDLEGPDYFDAVDVRELVWGVLADRTDSRHRNARHAVLEDICDRVAEQAGTSFLRAYLFALDMAARDSHDVEAEMRASVTEIFREQLARLAPDDPTWAADLLVPLAYAFGAGMPNRRVWLGVVRRLTGRDADHEDLLRLFDKADEFMTESPRGEEDAGWRIQSEELAQYLAELHESGRVHAAFTEALLDALPVGMDRTPSWGRADRYTRVNFAEHAFWAGVLDEYLDDPGFLLAMDSRRLRRAFTLWGTESARAVREVCDRMRGSGVDDGCTVSRLSFLAAAFGRDRLAGRAASMTDRWKGSWIERAPAESVAVVNHGGGHLVVALREGGALVCTLRTGRWWRLSLDDRDLVTALDAGVLDGRPFAVVGQLSGRVTLHELNEEDDPSELCRFDSQVVSCVLRQGELYVSALQEWTFFEVGVGAGPKVDVFGHFLADLSATTVAGRRLVAGITANEVILWDASGEEIDRFRTSQSRALTSVTVLGTEIVTASDDGSVQVTELRDGRTWPLFSLGDQPITSLRCCNTSDGHRLLATGQNGSLIICGVGERSAANPIKVDVGFPVQSADLEETGRLVVATEKGIVRLFL
>NZ_CP044407.1|WP_151010661.1|4355194_4356043_-|hypothetical-protein
MSQVLFCHGIGYRKRHRERMHANWYDALRTGMIDTNLPPLEATVIRAVYYGNCFRSLAAKGGGEEEGLEGFDDVPNYGSTDIRADVEIELLNAFAMAADPGSEGGKGAAQALLRRLERSRLLGDVPAKAVIWMIKQMHRYLTDENLHEQVQERFAGHVTDRTRVVLAHSLGSVVAYEALCAHPEWEIDTLITVGSPLGLRTISSRLRPPVGVDGAQWPHVRRWVNVAAKEDPVALVKELGPVYGEAIEDKPVSNGRFAAHSVLQYLTTAEVAREIADAVGRG
>NZ_CP044407.1|WP_151010663.1|4356368_4356806_-|transposase
MAELTGMGDLSGGRRECGSSSAANAPNPGARLRSFDSDRHRITCFVTGTHRGQFADQELRHRHRARCEDRIRCAKDTGVRNLPLHDFAANQLWLEVVVLVADLTTWAQMLAFKDHPARCWEPKRLRLRVFLTAAAMGRLQVLPAP
>NZ_CP044407.1|WP_151010665.1|4356793_4357045_-|transposase
MASSPREQRAGAGVPGAAGKIRTDSKGGTHDFVDWVARRRLKYSIGFTLADDICDAILALPENVWQCTYDADWQSRPGAWWPS
>NZ_CP044407.1|WP_151010667.1|4357108_4357648_-|hypothetical-protein
MSGKYGFERNPAVVSWRTLLQEQIEREGASRTYDYMDQPPAQDHVAAEMHRLRGLVMAQGTETESVLREIVKCLESNLNIEKSTARRLTKDIRRLLSGDDEAFWEYELCLIEEAIDRRNHAVHSEVVIGSSWEDYTTGGGEWVPVIGLLGKEQYDEVDLQKDFTLQWHATQAAVAILLT
>NZ_CP044407.1|WP_151010669.1|4358224_4359040_-|tyrosine-type-recombinase/integrase
MSSGGRGPGPVMVWTPAQTGSFLDFIAEERSYALSPRSLSAGCVVPRSRTWLGPTPTCRAQLTVRETSPGTEDPGDEYDDTKSEAGERTVALDEATMAVLLDWRARQERETRVGPEVRVDSGRVFTREDGARPRPQWISTRFEDLIKKYGLVRHRHSVEDCQPDRRCHRLSDRTVQAAIAGDPLPPIRFHDLRHGAATLALLGNVNMKVISETLGHARPSFTADTYTSVLPEVSKEAVAAVVHRRPQAGTPAAANVISFADRRNRRGEHAG
>NZ_CP044407.1|WP_151010671.1|4359064_4359352_-|hypothetical-protein
MIGLYEAILQINPPLPHAEKPSELLRRLLEVRAYSTRPPKPGERPRRKQTEPISPTRVKKVHAVLLSALNWVVKSKRLRENPIEQMQPPRIRDGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_6

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_6

4721536-4721636

Orphan

Consensus_repeat	Method
CGGGCCTTGCTGGTGCGATTGCTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_6

>merge|NZ_CP044407|6|4721536-4721636|CRISPRCasFinder
CGGGCCTTGCTGGTGCGATTGCTGCTGTGTTTGTTTGCAAGACCCTCGGCGTCAGGCCCCAGGGGGCCTTCCTTCAACGGGCCTTGCGGTGCGATTGCTGC

>NZ_CP044407|6|6|4721536-4721636|CRISPRCasFinder
CGGGCCTTGCTGGTGCGATTGCTGC	TGTGTTTGTTTGCAAGACCCTCGGCGTCAGGCCCCAGGGGGCCTTCCTTCA
ACGGGCCTTGCGGTGCGATTGCTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151011298.1\|4712869_4714195_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240541
NZ_CP044407.1\|WP_151011316.1\|4722524_4722746_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|226181
NZ_CP044407.1\|WP_151011291.1\|4711161_4711608_+\|50S-ribosomal-protein-L9	unknown	unknown	gnl\|CDD\|234659
NZ_CP044407.1\|WP_151011294.1\|4712576_4712765_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151018184.1\|4711877_4712564_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|133475
NZ_CP044407.1\|WP_151011326.1\|4724969_4725269_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151011334.1\|4727000_4728176_-\|methyltransferase	unknown	unknown	gnl\|CDD\|225443
NZ_CP044407.1\|WP_151011321.1\|4723676_4724180_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP044407.1\|WP_151011337.1\|4728262_4728649_+\|DUF2568-domain-containing-protein	unknown	unknown	gnl\|CDD\|378498
NZ_CP044407.1\|WP_151011307.1\|4718828_4720172_-\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|223650
NZ_CP044407.1\|WP_151011313.1\|4721916_4722525_+\|DUF2975-domain-containing-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151011331.1\|4726183_4727056_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|375319
NZ_CP044407.1\|WP_151018185.1\|4714621_4716802_+\|replicative-DNA-helicase	unknown	unknown	gnl\|CDD\|273206
NZ_CP044407.1\|WP_151011329.1\|4725279_4726053_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_CP044407.1\|WP_026403973.1\|4710906_4711143_+\|30S-ribosomal-protein-S18	unknown	unknown	gnl\|CDD\|178997
NZ_CP044407.1\|WP_151011324.1\|4724340_4724970_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|379883
NZ_CP044407.1\|WP_151011310.1\|4720174_4720969_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213222
NZ_CP044407.1\|WP_151011319.1\|4722742_4723642_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274680
NZ_CP044407.1\|WP_151011301.1\|4716839_4717370_-\|SMI1/KNR4-family-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151011304.1\|4717993_4718776_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180604

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151011298.1\|4712869_4714195_-\|MATE-family-efflux-transporter	gnl\|CDD\|240541	cd13136, MATE_DinF_like, DinF and similar proteins, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins. Escherichia coli DinF is a membrane protein that has been found to protect cells against oxidative stress and bile salts. The expression of DinF is regulated as part of the SOS system. It may act by detoxifying oxidizing molecules that have the potential to damage DNA. Some member of this family have been reported to enhance the virulence of plant pathogenic bacteria by enhancing their ability to grow in the presence of toxic compounds. Proteins from the MATE family are involved in exporting metabolites across the cell membrane and are often responsible for multidrug resistance (MDR).	2.17812e-109
NZ_CP044407.1\|WP_151011316.1\|4722524_4722746_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|226181	COG3655, COG3655, Predicted transcriptional regulator [Transcription].	1.67847e-21
NZ_CP044407.1\|WP_151011291.1\|4711161_4711608_+\|50S-ribosomal-protein-L9	gnl\|CDD\|234659	PRK00137, rplI, 50S ribosomal protein L9; Reviewed.	6.86344e-66
NZ_CP044407.1\|WP_151018184.1\|4711877_4712564_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|133475	cd06583, PGRP, Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.	1.35243e-24
NZ_CP044407.1\|WP_151011334.1\|4727000_4728176_-\|methyltransferase	gnl\|CDD\|225443	COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis].	3.12744e-21
NZ_CP044407.1\|WP_151011321.1\|4723676_4724180_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	4.17588e-11
NZ_CP044407.1\|WP_151011337.1\|4728262_4728649_+\|DUF2568-domain-containing-protein	gnl\|CDD\|378498	pfam10823, DUF2568, Protein of unknown function (DUF2568). One member in this family is annotated as yrdB which is part of a four gene operon however currently no function is known.	1.68923e-14
NZ_CP044407.1\|WP_151011331.1\|4726183_4727056_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|375319	pfam17765, MLTR_LBD, MmyB-like transcription regulator ligand binding domain. This domain is found in a family of actinobacterial transcription factors. The structure shows it has a PAS domain like fold and it is bound to Myristic acid.	1.63814e-42
NZ_CP044407.1\|WP_151018185.1\|4714621_4716802_+\|replicative-DNA-helicase	gnl\|CDD\|273206	TIGR00665, DnaB, replicative DNA helicase. This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of > 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites. [DNA metabolism, DNA replication, recombination, and repair].	1.70077e-141
NZ_CP044407.1\|WP_151011329.1\|4725279_4726053_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	6.08656e-24
NZ_CP044407.1\|WP_026403973.1\|4710906_4711143_+\|30S-ribosomal-protein-S18	gnl\|CDD\|178997	PRK00391, rpsR, 30S ribosomal protein S18; Reviewed.	3.67575e-39
NZ_CP044407.1\|WP_151011324.1\|4724340_4724970_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-ligand-binding-domain-containing-protein	gnl\|CDD\|379883	pfam16859, TetR_C_11, Bacterial transcriptional repressor C-terminal. This family of bacterial transcriptional repressors is characterized by the short approximately 50 amino acid stretch of residues constituting the helix-turn-helix DNA binding motif, around the YRFhY motif. The target proteins that are repressed are involved in the transcriptional control of multi-drug efflux pumps, pathways for the biosynthesis of antibiotics, response to osmotic stress and toxic chemicals, control of catabolic pathways, differentiation processes, and pathogenicity. Another target protein is BetI, an osmoprotectant which controls the choline-glycine betaine pathway in E.coli.	2.58474e-24
NZ_CP044407.1\|WP_151011310.1\|4720174_4720969_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213222	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein. This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of lipoproteins from the cytoplasmic membrane (LolCDE). They are clustered together phylogenetically. MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all. An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport. The LolCDE complex catalyzes the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.	6.25215e-111
NZ_CP044407.1\|WP_151011319.1\|4722742_4723642_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|274680	TIGR03619, F420_Rv2161c, probable F420-dependent oxidoreductase, Rv2161c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes a domain found in a distinctive subset of bacterial luciferase homologs, found only in F420-biosynthesizing members of the Actinobacteria. [Unknown function, Enzymes of unknown specificity].	1.59974e-40
NZ_CP044407.1\|WP_151011307.1\|4718828_4720172_-\|FtsX-like-permease-family-protein	gnl\|CDD\|223650	COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms].	1.79433e-06
NZ_CP044407.1\|WP_151011304.1\|4717993_4718776_+\|SDR-family-oxidoreductase	gnl\|CDD\|180604	PRK06523, PRK06523, short chain dehydrogenase; Provisional.	2.57074e-73

>NZ_CP044407.1|WP_151011310.1|4720174_4720969_-|ATP-binding-cassette-domain-containing-protein
MFGRKSAPPAGGSGEALRIEGVRKIYGTGEGQVAALDGVSLSLPAGSFTAVMGPSGSGKSTLLQCAAGLDRPTEGRILVDGAELAGETEAALTRFRRERIGFVFQHFNLLPTLTVLQNVTLPLKLARRPVDRGRAADVLRRVGLGDRLGHLPAELSGGQQQRVAIARALVARPRVLFADEPTGALDTRSARDVLALLQETVRVDGQTVVMVTHDPVAAAHADAVLYLADGRIVGHQSAPTAEAVAERMTHLADEVARQRTTAGV
>NZ_CP044407.1|WP_151011307.1|4718828_4720172_-|FtsX-like-permease-family-protein
MTALALRSLRKRTGAFTASFLALFLGATILMAFASMLDTASGTSGTTHETLVTMASVVGGWGLLLVVFAVTSTLTLSVRQRSAEMALLKSIGATPAQLTRMITGEAAVLAVVASLLAIGPAILAGHGLLALLHDTGQVTGDVSHTFGPIAISMGTGITFVSAVGAALLTARRLARGRIADTLAETDSGRLTKKRVAFAGLFFAAALSEVIVTVTVMKDEGSGAMATSGQADIFAAIGLALLAPAIVRRAASVLARPLRLFGVAGDLAVTGMRRRTSAMAAAVTPVILFTGIAVGTLYLQSTENAAVRAAGISKTISDKSIETLNMVVIGMVVLFAAIMLVNTLVAATAHRRREFGQTRLAGATPRQVMGTVALESAVLTVIGVACGSVASLFTIVPFSLVRVDSPMPEGDVWIYVGVVALAAVLTGATAATSTRRVLRTPAIEAVSA
>NZ_CP044407.1|WP_151011304.1|4717993_4718776_+|SDR-family-oxidoreductase
MNLGLDAKTAVVTGASRGIGLATVRTLADEGVRVVGAARTVTPELKETGAHAVAADLSTAEGVAALMDAAFAELGGVDLLVNNVGGGDDLLPGGFLDVDDAAWGSILDVNLMSAVRVTRAALPSLIERGGAIVNVSSMNARVPGAGPVAYSAAKAALTALGKSLAEEFGPRGVRVNTVSPGVVRTAVWEDPDGFGAKTAAAVGVEHADLLRGLPAAAGITTGRITEPGEVAALIAFLLSDVAGNIVGSEYLIDGGSVKTS
>NZ_CP044407.1|WP_151011301.1|4716839_4717370_-|SMI1/KNR4-family-protein
MAELTAPLLHKGLVAPSDLVGCTAEEIEALMAAQGVTTLPAVYREFLEYGGHTPYWLAREEWDYTWLLEEAKGVAREIVVDDDGQDWAPFADAFIFQTHHGYMFNYFRASDLTQPDPHFWIYCQGAQIESSGQPFSQYLQDLAGYLPEAIRTHQYLYHQGSAPNPPTHHWDITQRP
>NZ_CP044407.1|WP_151018185.1|4714621_4716802_+|replicative-DNA-helicase
MLLSQDAIAEVIEVLRTSDFYRPAHQIIYDVVLDLYGRGDPADAVTVSGELTKNGEINRIGGAPYLHTLISSVPTAANAGYYAKIVHERAVLRRLVETGTRIVQMGYAADGADADEVLDRAQAEVFAIAEKRAGEDYVPLSEIMPGALDEIEAIGSRGGQMVGTPTGFADLDALTNGLHPGQMIVVAARPAMGKALKSDTPLPTPTGWTTMGEVRVGDHLIGADGKPTRVVAATDVMDDRPCYEIEFSDGEIIVADAEHQWRTRTAPVSAIAGHCGTPLRKAVAAHAGTGSGPKRTHAHHSRLPQPPHHGHLSGRPHDLAAPGHRVRTTEEILRTLHRDGAPNHSVEVAAPFDLPPADLPTDPYLLGLRLGSGHASHLPDAYLRASAGQRRALLDGFLATAARTREDGFVRLALPSEPLARAVHELLVSLGRRATIEPAAPQDGRPDGAAPHRVALAAPDARVRHVVDVRRVPSVPVRCVQVDNDDHMYLAGRSCIPTHNSTLALDFARAASIKHGLTSAFFSLEMGRNEITMRLLSAEARVALHAMRSGTMQDEDWTRLARRMSEVAEAPLFIDDSPNMSMMEIRAKCRRLKQQHDLRLVIIDYLQLMTSGKRVESRQVEVSEFSRSLKLLAKELGVPVIALSQLNRGPEQRTDKKPMVSDLRESGSIEQDADMVILLHREDAYEKESPRAGEADLIVAKHRNGPTATVTVAFQGHYSRFVDMAQ
>NZ_CP044407.1|WP_151011298.1|4712869_4714195_-|MATE-family-efflux-transporter
MTNPRRLVTAQDREILRLAVPAFGALVAEPLFLLTDSAIIGHLGTAQLGGLGVAGQALGTLVYLCVFLAYGTTAGVARQVGAGDLRAAIRQGIDGMWLALAIGAVLVAAAWSLVPGIVGLFGASADVAPYAETYLRISLLGIPSMLVVLAGTGVLRGLQDTRTPLLVSIGGFGANLVLTVLLVIVLDWGVAGSAWGTVLAQTGSAAAYVAVVLRGARRHGAPVRPDAAGLRTAATAGFGLLVRTAALRVVLIVGTSVAARMGDAEIAAYQVGFQVWTLMAFALDAIAIAGQAITGRYLGASDVAGTRAVTRRMVGWGIACGVLFGVLILAVRPWLPGLFTGDGDVRDLLLASLLLVAVLQPVAGVVFVLDGILIGAGDGAYLAATTMVATAVFLPAALAAYWTGAGLVGLWIAIGLWMATRMLTLGLRARGDRWMVTGAVR
>NZ_CP044407.1|WP_151011294.1|4712576_4712765_-|hypothetical-protein
MCSTEGEPLARLAQAIDDLAAEGLAELPPETLVERVAGIWSLVEELDPEIARRRTGYTSRDT
>NZ_CP044407.1|WP_151018184.1|4711877_4712564_+|N-acetylmuramoyl-L-alanine-amidase
MADELPVGARPDGQGFFGEPMPGWAAEPRVYTRADWNARAPKRPAEVRNRPPDHIIVHHTATANSKSRSLAHAFALSRAIQRWHMDGNGWDDTGQQLTISRGGIVMEGRNRSLDSIRAGNLAVGAQVLHHNDHTIGIENEGTYTRSGVPKNLWTSLVEVCAWLCEQYRLDPAAAIVGHRDFNATSCPGDRLYRRLPELRREVAGRLDGGPRGGSHPATSIFPGFDPFD
>NZ_CP044407.1|WP_151011291.1|4711161_4711608_+|50S-ribosomal-protein-L9
MKLILTQQVSGLGEPGDVIDVRDGYGRNYLIPRGFAIRWTRGGEKEIDSIKKARSAREIATVEHAKEVADRLGGLRVTLRTRTGSNGRLFGAVTAADIAEAVKAANGPDLDRRRIEIGNPIKTVGTHRVSVRLHSDVNATIDVDVVEA
>NZ_CP044407.1|WP_026403973.1|4710906_4711143_+|30S-ribosomal-protein-S18
MAKPPPRKPKKKVCVFCQEKISYVDYKDTVLLRKFISDRGKIRARRVTGNCTQHQRDVATAIKNAREMALLPYTSTAR
>NZ_CP044407.1|WP_151011313.1|4721916_4722525_+|DUF2975-domain-containing-protein
MGAVAWWRRIDGRALEGVVGLALLLVGLFGVLLPILGVAGPFPPVDSRTVELDGAPTVPGAVAGDGVELHGARSAELAFADPGLGERVLLALPGVTGAILLVVILEQLMRMARTFQDGDVFVARNSRRLTVIAVAVLLFGVLVPLVDALTARALVGGTPVEPAVQIAYEPSALWALVSILLFAAAGAFRHGTRLRADTEGLV
>NZ_CP044407.1|WP_151011316.1|4722524_4722746_+|helix-turn-helix-domain-containing-protein
MPSEDAHQIKVHLDALLKERGMTLAELAERVGVTVVNLSVLKNDRAKAMRFTTLSAICRELDCQPGDLLSFDG
>NZ_CP044407.1|WP_151011319.1|4722742_4723642_-|LLM-class-flavin-dependent-oxidoreductase
MNDFEIGVILPGIAVQRRDGITLRDAARHAENAGLDGVWHGDHLAAGGPTLDASVALAVAAAATDRITIGTSVLVPAIRPLAWAAKQIATLQHVSGGRLVLGVGSGGGPAQWAAAGVPYRDRGRRTDTALDLLPRLLAGEPTPLPDEAGAPVAPSPAVPMPPVWVGNASPAAIRRAARYGDGWFPSLITPREVAGGAARLAELAAGHGRRVPAVAVGGTSALGGGDVPTRADIAAGIASAYGRPPEEAADVPLTGPPAAAAERLAAYRDAGARHAVIGVAGGDWRTQVDLLAEARSLLR
>NZ_CP044407.1|WP_151011321.1|4723676_4724180_-|GNAT-family-N-acetyltransferase
MPVRFVQLPEAALRALLDGDLARASAAAGVELTEYFLTDQARSVWRRRLDQLARTPADAPWIARAAVAEPGGAVVGHAGYHGAPDANGLVEVAYSVDPAHRRRGHARAMLEALLDRAAAEPSVRTVRASIGPDNAGSLATIAGHGFVHVGEQWDEEDGRELLFERPA
>NZ_CP044407.1|WP_151011324.1|4724340_4724970_+|TetR/AcrR-family-transcriptional-regulator-C-terminal-ligand-binding-domain-containing-protein
MTPRGDVRTEAILAAALEVLAEVGYDRLTMEAVAARAQASKATLYRRWPGKAELVVGAVRAHGGAGPDGAPVPPDTGGLRGDLVAVLEQMRANLEAQDAALILGLMTAMHRDPVLAETVRGRLVDDKRAAFGTVVERAVRRGDLAGDVDTALFTEISSAMLFSRLFVTGEPLDGAFVRHLVDAVLIPLLTGGRPAPGPPADRPTTQGDL
>NZ_CP044407.1|WP_151011326.1|4724969_4725269_+|hypothetical-protein
MWSAIVLGFLGGVMGGNALPHFVRGITRRSYPCALGNGPVPNLVAGWAGLVLSVLLLAWAGPGEHPGPAFGAAAAGVLAIGLFHAGPGAFGRREEPSGA
>NZ_CP044407.1|WP_151011329.1|4725279_4726053_-|alpha/beta-fold-hydrolase
MPTITVDGARIPYRVEGTGPALVLVHGVGPGAAMWDGVLDRFTGHRTVVRPDLAGSDAASDDGAPLTAGTLAAQVAAVIEDAGTGRADVLGFSLGAPVAAAVAALRPDLVRRLVPVAGVAGPGDEYVRQLVASWLAAAGDTDAFARHSTLLAYSRGFMNRAGHAAVEQAHAFMAPTPDRLRQVDLVGRIDVRDLLPRITAPTLVIGALHDATLPVENHREFSTGIAGAEYAELDSGHVVMGERTDEFLKLVEDFLSR
>NZ_CP044407.1|WP_151011331.1|4726183_4727056_+|helix-turn-helix-domain-containing-protein
MDMDRRELADFLRRSRARLRPREVGLPTGPRRRTPGLRREEVSQLAGMSADYYMRLEQARSPQPSAQLLGALARALRLTADERDHLYVLAGHRPPAGPLAGEHVRPGLLHLLDRLGDTPAQILGDLGDLLAHNAAAEALFGCVCTVDGPDRNIVWRWFADPSVRSAHPEDEHERIGRAHVADLRAAVARRGHDAASAALVRRLHGTGGEFTRMWELHEVAVRRTARMRVRHPELGTAEFDAEVLVTPAEDQRLVVYTPPPGSRSVEALELLRVIGPETAHRSHAAGATGS
>NZ_CP044407.1|WP_151011334.1|4727000_4728176_-|methyltransferase
MGAGQGRTDVSGGPAVGWREDGRDRRARWRSESAPPPRRVRVADDGTRADDAYRAACEGTALLWRGDFQNARQLLRAMARRIDAPPRKKKAEPSGAQAFHLFRQARAQRARTLGMLLVPVEAGHTVPLRRAPDVRDACAEAYGPGEEPYVVSLRELLGVIGAHEWRREGVPVPALGGDRIHPHYGVFSPIRGEYVDLVARAPLPSGVTSAFDIGTGTGVLAAVLARRGVGRVVATDMDPRALACARENVERLQVPVEVVQADLYPDGRAGLVVCNPPWLPAKPATPLERAVYDPGGRMLRGFLDGLGDRLEPDGEGWLVLSDLAEHLGLRARGELADAFAAAGLRVASRLDAAPVHPKAADADDPLHAARAAEITTLWRLRRDSGAPSPDR
>NZ_CP044407.1|WP_151011337.1|4728262_4728649_+|DUF2568-domain-containing-protein
MRLPGPVHAGNEGLAFLVELAAFAALAWWGFTAGDAVLVDLVLGLGAPAAAITLWGLFAAPKSRFDAGLPVVLLVKALVFASAALAVLAVGHPVLAAVFAAIALVNTALATLDRDARFRAARDEPSAG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_8

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_8

5916969-5917190

Orphan

Consensus_repeat	Method
CGCTCCGGCCGAGGCCGAACGCATCGCCCGCTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP044407_8

>merge|NZ_CP044407|8|5916969-5917190|CRISPRCasFinder
CTTGCTGACCGAGGCCGAGCGCATCACCCGCTCCGACACCAAGACGTTTCAGAAGTGGGCGTTGCCGGATGTAGCGGAGAACCTCGCTGCGCTCGACCCGGCCGAGGCCCAGCGCATCGTCCGCTCCATCGCCGACCCCTACGACCGGACAAAGGCGTTGGGAAAGGTCACCGAGACCATCGCCGGGTTCGACCCGGCCACGGCCGAACGTATTGCCCGCTC

>NZ_CP044407|8|8|5916969-5917190|CRISPRCasFinder
CTTGCTGACCGAGGCCGAGCGCATCACCCGCTC	CGACACCAAGACGTTTCAGAAGTGGGCGTTGCCGGATGTAGCGGAGAACCTCGCTGCGCT
CGACCCGGCCGAGGCCCAGCGCATCGTCCGCTC	CATCGCCGACCCCTACGACCGGACAAAGGCGTTGGGAAAGGTCACCGAGACCATCGCCGGGTT
CGACCCGGCCACGGCCGAACGTATTGCCCGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151013262.1\|5908786_5909944_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|99746
NZ_CP044407.1\|WP_151013286.1\|5932112_5933402_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379258
NZ_CP044407.1\|WP_151013268.1\|5914804_5915479_-\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP044407.1\|WP_151013275.1\|5918844_5919783_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151013282.1\|5924085_5925933_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_CP044407.1\|WP_151018305.1\|5903786_5905061_-\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP044407.1\|WP_151013254.1\|5902401_5903796_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223154
NZ_CP044407.1\|WP_151013277.1\|5919795_5920242_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP044407.1\|WP_151013279.1\|5920246_5921983_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013264.1\|5910070_5911954_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013260.1\|5908320_5908740_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341390
NZ_CP044407.1\|WP_151018307.1\|5933698_5934538_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_CP044407.1\|WP_151013256.1\|5906669_5907251_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP044407.1\|WP_151013273.1\|5917637_5918786_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP044407.1\|WP_151013284.1\|5929086_5931909_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|197715
NZ_CP044407.1\|WP_151013281.1\|5921979_5923773_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013270.1\|5915800_5916196_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151018306.1\|5925929_5928485_-\|protein-kinase/lanthionine-synthetase-C-family-protein	unknown	unknown	gnl\|CDD\|271199
NZ_CP044407.1\|WP_151013258.1\|5907253_5908240_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|367673
NZ_CP044407.1\|WP_151013266.1\|5912224_5913517_-\|aspartyl-protease-family-protein	unknown	unknown	gnl\|CDD\|276809

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151013262.1\|5908786_5909944_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|99746	cd06453, SufS_like, Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine; and selenocysteine lyase catalyzes the decomposition of L-selenocysteine.	2.26669e-107
NZ_CP044407.1\|WP_151013268.1\|5914804_5915479_-\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29692e-62
NZ_CP044407.1\|WP_151013286.1\|5932112_5933402_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379258	pfam13556, HTH_30, PucR C-terminal helix-turn-helix domain. This helix-turn-helix domain is often found at the C-terminus of PucR-like transcriptional regulators such as Bacillus subtilis pucR and is likely to be DNA-binding.	3.78177e-18
NZ_CP044407.1\|WP_151013282.1\|5924085_5925933_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	4.72689e-34
NZ_CP044407.1\|WP_151018305.1\|5903786_5905061_-\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	8.67298e-38
NZ_CP044407.1\|WP_151013254.1\|5902401_5903796_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223154	COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism].	1.22813e-85
NZ_CP044407.1\|WP_151013277.1\|5919795_5920242_+\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	1.62991e-09
NZ_CP044407.1\|WP_151013279.1\|5920246_5921983_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.03458e-78
NZ_CP044407.1\|WP_151013264.1\|5910070_5911954_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.1398e-163
NZ_CP044407.1\|WP_151013260.1\|5908320_5908740_+\|CBS-domain-containing-protein	gnl\|CDD\|341390	cd04622, CBS_pair_HRP1_like, CBS pair domain found in Hypoxic Response Protein 1 (HRP1) -like proteinds. Mycobacterium tuberculosis adapts to cellular stresses by upregulation of the dormancy survival regulon. Hypoxic response protein 1 (HRP1) is encoded by one of the most strongly upregulated genes in the dormancy survival regulon. HRP1 is a 'CBS-domain-only protein; however unlike other CBS containing proteins it does not appear to bind AMP. The biological function of the protein remains unclear, but is thought to contribute to the modulation of the host immune response. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	7.05173e-43
NZ_CP044407.1\|WP_151013256.1\|5906669_5907251_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	3.57521e-30
NZ_CP044407.1\|WP_151013273.1\|5917637_5918786_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	9.65461e-55
NZ_CP044407.1\|WP_151013284.1\|5929086_5931909_-\|AAA-family-ATPase	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	4.11681e-16
NZ_CP044407.1\|WP_151013281.1\|5921979_5923773_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.37291e-110
NZ_CP044407.1\|WP_151018307.1\|5933698_5934538_-\|alpha/beta-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	1.15139e-07
NZ_CP044407.1\|WP_151018306.1\|5925929_5928485_-\|protein-kinase/lanthionine-synthetase-C-family-protein	gnl\|CDD\|271199	cd04791, LanC_SerThrkinase, Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.	2.03735e-67
NZ_CP044407.1\|WP_151013258.1\|5907253_5908240_+\|LCP-family-protein	gnl\|CDD\|367673	pfam03816, LytR_cpsA_psr, Cell envelope-related transcriptional attenuator domain.	7.89323e-59
NZ_CP044407.1\|WP_151013266.1\|5912224_5913517_-\|aspartyl-protease-family-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.19181e-12

>NZ_CP044407.1|WP_151013270.1|5915800_5916196_+|hypothetical-protein
MSGRWVWGGATITVAAVAGLAVYYAVVGLEEADKLGSVVGSLVAVVGVAVAAYGLAGAPAPGRRVSQRARATGRGQVTQVGGDQVPRGAAAAGGAGRPAAEGGEQVRQNARADEDGAIRQIGGDQGRRSPS
>NZ_CP044407.1|WP_151013268.1|5914804_5915479_-|response-regulator
MRVLIVEDEPYLAEAVRDGLRLEAIAADIAGDGDTALELLGVHSYDLAVLDRDIPGPSGDEVARRIVASGSGVPILMLTAADRIDDKASGFELGADDYLTKPFELRELVLRLRALDRRRAHARPPVREIAGLRVDPFRREVYRDGRHVALTRKQFAVLDVLVAAEGGVVGAEELLERAWDANADPFTNAVRITVSALRKRLGEPWIIATVPGVGYRIDTGGAHG
>NZ_CP044407.1|WP_151013266.1|5912224_5913517_-|aspartyl-protease-family-protein
MADGEGWDRRSLLRGAAVVAGAAATAPLLGGTSAARTGTADADALFKAGKFEQAGRAYEEILRADPANLHAARRRGHVGLLSNSFRDAEKYLKTALDLAPDDRETNRLLADCYIRQDEFALSVPCWQAGGTEIFARWFGAIRGEPYQIHGDTARLPWRQTDPSPLVEGSVNGGPPKLFMPYTGAPWLGISVQMAEEAGLTPVAEQQIDYLDGTAWQYFGVLDSFRLGGIELRNVPVVWTDTDQDSPGGGDGIIGTWVFYHLLTTFDYAGRSLILRRPTPEASRRARADAARAGARPLPLWIAREHNLHSMGSVAGSAPAVVGLPIGGTSENAVVMSEETAKRLRVRTDYDRPLETFAHSHPTVTYPCYPEEVRLGGAVAKGVYSLVNPNGPLGRSGFDVLAAFFHSFYKPFNITLDFTEMNVYIARGKAP
>NZ_CP044407.1|WP_151013264.1|5910070_5911954_+|ATP-binding-cassette-domain-containing-protein
MDMEVTAWMSLHHAANAQDRRPFNRATLRRIGAFARSHRRTLTAFLLLSVVLAVLAVATPVLAGRVVDAINERAATSTVVWLAVLIAVLAVAEGGLGLANRWLSARIGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLNNDVIGAQRAFSDTLSGVVSNLVMVALTFAVMIGISWQITLLALVLLPLFLLPARRMGSRLARLEREAVGHDSAMSTQMTERFSAPGATLIKLFGRPARESAEFAARARRVRDIGVRTAMVQHVFITALTMVSALALALVYGLGGYLALRNSLDAGAVVALALLLTRLYAPLTALASARVEVMSALVSFERVFEVLDLKPLVAEKPDTRDVPDGPVSVEFDDVRFSYPSPEKVSLASLEEVATLDTRGGQEVLHGISFKAEPGQMVALVGSSGAGKSTIAQLLPRLYDVDSGAVRLGGVDVRDLSFAGIRATLGMVTQDGHLFHESIRENLLLARPEATEDELWSVLRRARLDALIEGLPDGLDTIVGERGYRLSGGERQRLTIARLLLARQRVVILDEATAHLDSTSEAAVQEALAEALDGRTAVVIAHRLSTVRAADQILVVEGGTIVERGTHDELLAARGRYADLYRTQFSDDAPPLEPVA
>NZ_CP044407.1|WP_151013262.1|5908786_5909944_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MDVGTLRADTPGCAEVAHLNNAGAALPPRPVLDAVTGHLALEAAIGGYEAAERAADEIEHFYDAVAGLIGARADEVAYVENATRAWDMAFYAIPFAEGDRILTTAGEYSSNAIAYQQVAAARGARVEVVPDGPDGAISLPALEAELAKGGVRLVSLNHVPTHNGLINPAAEVGRLCNEHGVLYLLDACQSVGQLAVDVREIGCDMLSATGRKFLRGPRGTGFLYVRREIVRTLEPPFLDLRAAEWRAPDGYEPRPDARRFETWERFVAGQLGLAAAADHAAALGMDEIEKRVTALAAALRSALAARPGTTVLDRGTHKSGIVTFTVDGHEPAAIQRTAREHKINVNVTTPAAHGYDPDAVPAAVRASVHYYNTEEELDRLLAILP
>NZ_CP044407.1|WP_151013260.1|5908320_5908740_+|CBS-domain-containing-protein
MARKIRDIMTGSPTSVSPELDIVTVARAMRDEDIGAVLVAEGDEMKGLVTDRDLVIRGLAAGGDPKDVKIGGLASRATATIGPDDSVDKAAQLMRERAVRRLPVVEDGRPVGIVSIGDLAVERDTDSALADISASRPNT
>NZ_CP044407.1|WP_151013258.1|5907253_5908240_+|LCP-family-protein
MDDMELIRGLGRDLEHEPPASLVRQRERLLRAGQRRRRLPGRWSLLGVVAVVTAAAVLVPVLFLRGGKAAAPVAGERAGAFNMLLIGSDARGDGAGARSDTLMLLHVPEGRESARVVSFPRDLVVQIPRCGGRSQGRNVINSAFLAGGAACAAETVGRLTGVRIDRSVTVGFDGFRTVVDALGGVEVTLPEAVRDPKAGLSVPAGKSRLDGRQALAYVRARYSLGDGSDLARIERQQAFLASMAGRVAELRKDPVAFARFVTAVAGAVETVPDLDAAGLLELSRSMAKVGADDVGFGTVPVVPAVDHPQRVEPDGQRAEELFAQLRGA
>NZ_CP044407.1|WP_151013256.1|5906669_5907251_+|sigma-70-family-RNA-polymerase-sigma-factor
MTAPPAVPLIDAELIRSSLTDPESFAELFDRYSPMIFRYVSRRLGPEAAEDVVGDTFLAAFGARHRYDLSRPDARPWLFGIATKLVARHHRSEAARYRALRRSPVDGPVEGPAERVADGLTAAAVRPALAAALAALPRRDRDVLLLVAWGDLAYEQVAHALGVPVGTGRSRLHRARRKVRAALGDSNPMHEEE
>NZ_CP044407.1|WP_151018305.1|5903786_5905061_-|D-alanyl-D-alanine-carboxypeptidase
MTRQDIPQVTGVPEDEPAGRAGQGERAGRRAWPWVLVAALAVVLAVVTVQLLRPVPEPELRLTIAAEHTFPGAAPVLPWPGSGQSAVFVEGIGMMGTSGGAVPAPTASVAKVMTAFVYLRDHPLRAGEPGPTMTVSPEGVAEMPARRARGESLLGITQGQRLTQRKALEALMIISANDVAHELAKWDAGSVRAFVAKMNAAARELGMTNTTYTDPSGYDAGTVSTAADQVKLLRAAMAMPAFAEIVNQRSYAPANGGPLREGGNFLLGQSGVVGGKTGFTDAAGGNFVFAARKDVAGVATLIVGAVMGQRTASAAGAVTAAGELVRAAESALTGVTVAKAGARVAVVDDGLGGTTPVRAASAVTVVGWSGLTVAVAAQGNPPAEAPAGTGTGTLTAGAARVPLELADAYEGPAIVDRLTRLGQE
>NZ_CP044407.1|WP_151013254.1|5902401_5903796_+|aminotransferase-class-V-fold-PLP-dependent-enzyme
MTLPEEGRPAAELLDLLAGLREADLPVRGGKVTAYVYDTGRDAVHDLAATAYREMLEVNCLDPTAFPSIQVLEREVVGAVADRLGGGTGIFTSGGTESIMLAVKAARDARPVPDPQLVVPATAHPAFHKAAHYLGLEPVIVPVDDGYRADPAAVAAAITPRTVLVVASAPSYPHGVMDPITEIAAIAESAGVLCHVDACVGGWVLPWLREAGRPVPPFDLSVPGVTSLSCDLHKYGYAPKGASVVLFADPALRRRAYFASAEWPGYTVINSGVQSSKSAGPLGAAWATLNAVGADGYRDLAVRAMDSAERLIAGLPDGLRVLGAPAVPLVAVASADPALDVFVLADEARDRGWFFQPQLSYRGIPANLHFTITGVSDTGALLGALADAAKAARAAGPPPVPDGLVDAIAALDLDSIDDAGFAELLASAGAGPSGGMAVVNAVLDELPPPTREALLVRFLSALYS
>NZ_CP044407.1|WP_151013273.1|5917637_5918786_+|serine-hydrolase
MPDERGPDRVRRVLDGHIGAGLAPGLVALVRRGAETRAVVLGSMAAGGGAPMRRDALFRVLSLTKPVTAVAALSLVEDGTLALDDPVDRWVPELAGPRVLRRPDGPLDDTVPAARAITVRDLLTFRLGTGAMTEPCPLGDAMAAAGVAPGPDPTELAPGEWLGRLGALPLAYQPGARWLYDTGSDVLGVLLARAADRPLADLFRERVFEPLGMRDTGFHVPSGEAHRLAASYRPPDGSGVLTPRDDPRDRPPAFPSGAGGLVSTADDYVTFFRTLLDGGGPVLSRESVAAMTTDRLRAAEKAGAGMFLQSGGWGFGVAVETRDDPPESRAGRFGWMGGLGTMAFADPSADLVAVLFTQVELGSPESARVFDEFREVAYAPAE
>NZ_CP044407.1|WP_151013275.1|5918844_5919783_+|hypothetical-protein
MGRQGWPRLRVADWQATRDTLHMWAQIVGKVRLAHAPLVNHWWNVTLYVSPRGLTTSTIPYGTGAFDVEFDFVGHRLRLRGSDGTDEGFALEPMTVAEFHDRTMRALGRLGVETRIQGHPNEVDPAIPFAEDDVHASYDADAAHLFWRQLLQGSRVLGEFRSRFVGKVSPVHVFWGALDLACTRFSGRTAPDHPGGAPNCGDWVMVEGYSRELSSCGFWPGGGEEGAFYAYAYPEPEGFAARSVRPSAAFYSAENGQFLLPYEAVADDPDPDAALLAFLQDTYEAAADLAGWDRDVLEADPARWAHKTNHRV
>NZ_CP044407.1|WP_151013277.1|5919795_5920242_+|VOC-family-protein
MVTREQLPAPTEGLVLTHFLTVRDVARSRAFYADVLGGEVVLAENPAIVRVANTWIIMNPGGGPTPDKPDVTLRAPEPGDPVTAFMNVRVADIAAFHARATSLGARFLTEPIDRKAEIRCYMVDPDGRLIEVGQATGMLHGVYADPPA
>NZ_CP044407.1|WP_151013279.1|5920246_5921983_-|ATP-binding-cassette-domain-containing-protein
MRVPPAARLLRRHLRGRGPALRGLAAWSVVEGLPVLAGGLLLARAVDHGFLAGRPGTGLAWLAVLAVLYLCGAEATRRIYPRLATTVEPLRDSLVTDVVTASLHRTGGTGGEADGTAGGAGTGVAQVAEQAEAVRVLLGTALRNVRQLLAAGIAALVGLALLSPPLALAIALSVAVAVGVFAAFLGVQIRRYRDVVRQAERIGESGAAIVAGVRDVVACAAEDRAARTVAASIDAQAAAMRAFARSRLVRLPVLALGVHLPLLVLLALAPSLIDGGRLTTGEVAGAAGYLITGLQPGIVLLVDAGGTLLLSLAVILGRLAETGAGGTAPALPARPGPVPASSDIELDRVTFAYSPRAAPVLTGLSLRIPAGTHLAVVGPSGTGKSTLANVLTDLVRPQRGTVTLGGVPLPDVDRDRLRSAVTLIPQESYIFAGTLRENLAYLRPGATTAQLDEAARAVGLEETLRRFGGYDAAVPPGGGSLSHGERQLVTLARAYLSAAPVLILDEATCHLPPAAEARAERALAGRGRTLVVIAHRISSAERAHRVLLLDSSGPIVGTHRTLLDLSPLYAELVGHWRT
>NZ_CP044407.1|WP_151013281.1|5921979_5923773_-|ATP-binding-cassette-domain-containing-protein
MTGRVRTEPAGGETAPRTEAPAAPPAPAVLRAGGRRLLRAAMRRTRALMGVLVLCTLLRVLATLATPVMLARAIDAVHTGRPPGGALTGLAVVLAVAALADAGEDLAGSYCGSHVTAWLRHRLIGRVLELGVPGRRRFPTGDVLSRLTESASGPAAFPVQLVSVAATLATTAGAVVALGLIDWTLALAFALGVPPAVVVLRVFVARAGEPFADYARHQAAVATRLLDAHQGIRTIRASGTADREVARILRPLPLLRDAGHRTWAVQGRVGWRLALLAPLLQVAVVGVAGLRLATGDITPGGLVAAASYTAMAVGAAALFDTVVALLNCEVSAGRVQEVLDTVPAVAPPPRPVALPDGPGRLSLRDVTVRIGDRTVLDRLDLTVPAGTGVAVVGASGTGKSVLVSLVGRLLDPQEGRVELDGVPVTAVAPPELRRAVAYAFERPALLGATVHDTIAYARPEATRAQVRRAARTAAADDFVRALPDGYDTPLDRAPLSGGELQRLGLARAALTGARVLVLDDATSSLDTATEMKVTRALQRLLARRTSLVVARRPATAARADLVAWLDGGRIRALAPHAELWADPDYRAVFGTAPGPGG
>NZ_CP044407.1|WP_151013282.1|5924085_5925933_-|alpha/beta-fold-hydrolase
MTAVPALPAIPSRFGFAFSGDGRWATCLSTVQDRVTLERWDLTGPVPSGRAVGTAGDPVDRTSRPIPLDDGRVLVARAATGAGGAPAGHGTVLAVRPGGPDGPDGAAARSWRIAPMLAGYPLAGPGSPQTLVVVTVEDERHSRIWVLPHGAGPPEPVVRIPGVLSGGVWLDDGRTLALDHAGDGHRTDGIVVDLRERSWRRIWTVSDTTSDRIVACDRAARRLAVTTGGPGRAVPAIGLWSPGGGRVRFPASLNRPGRARTPLAFGGGERLLVCEDVGATSRLLIHTPADDRVEPVPGPRGVLSPPASWTGGRIHLRFSAPHQPPTLATAHRAGWSLARRPAGTAARWAGADLVELPGPDGPVEAIVYGGARWHESDRVVLALHGGPLAAWRLEFDPLFQHLAAAGIAVVAPNQRGSTGYGERHLRAVVGDWGGPDLADVVHLGRGIAERRRGTGARVREPVLLGASYGAWLALLAACRHPDLWAACVALAPFTSPASLYRDAAAPVRDRVAALHRPGGTGRDARRDVLAACGALTAPLLVAHGTRDEVVPVGQSRALRRRLLELGRTEGPGFEYLEVDDDHTAVVQAWPADLRTSVVRFCLGAGRTLVPSKERR
>NZ_CP044407.1|WP_151018306.1|5925929_5928485_-|protein-kinase/lanthionine-synthetase-C-family-protein
MHVSATPASAPEVLARALPVLLAGEARSAFKFAATVDFVAALNARNTSRGHSGKFMTIYPESDTEAVRIARELHEATQGLAGPRVLSDRPYAPGSLVHYRYGAFVEERRLTNDGFYTWTILDPDGKPVEDQRTGKYTPPSWVTSPFPDNGMNGTRRSREAGAIMLGEHFAVREAIRHTNKGGVYRAVDRRTGDPVVIKEGRPHVAADMDGRDTRDRLRAEARALERLAGTGLAPRLVALFPQGGHLFLAQEMIEGGPLREWAADRIVETGWGGHLPAATDMARRLVELMSDVHAAGLLVRDFNPNNIMVRPDGAPVLIDLELAVVDGEDGPRQAGTPAFGAPEQLGGAAPHASADHYSLGATLCYLFTGAPPYLLDESPESRPPAERLEEWLAARTQDLDFPEHLRAMLRGLMADDPRHRWTADRAREALAARAPRRARGRDAETPWPRETVDRAIGGIVDELLASMDPDAPHALWPVSCVHGAPDPCTLQQGAAGCLGALVRYAELTGDPRLPDAIAAAARWIRARLADGTSRPPGLYFGTAGVSWSLLEAGLALGDERLVDDAADVAEGLPTAVASPDITHGTAGLGLTALHLWSRTGSARFARRADAAADALLGTVEDREGRLMWSTPADVDSKLAGRSYYGFAHGIAGVGYFLVACAEATGRDDCRALALRIGEELLDAAVVERGTAMWGAGAGDAPTAPYWCHGASGIGSFLLRLGTATGDARFLEAADRAARAVTEHAWRAVLGQCHGLSGNGDFLLDMADLTGDDRHRAAAWRLARTIVAARALRDGRLVLPDEQGEVSATWGDGLSGMLGFLLRLRYGSPRLWTVDAAAATAPTTATTARGAS
>NZ_CP044407.1|WP_151013284.1|5929086_5931909_-|AAA-family-ATPase
MTVTQGRDPLHGRVPELDAIGELLDRARGGRGGALAIVADAGLGRTALLEEAVRRAGPDVRTITASGVARESGVPYAGLHRLLRPLAAEIRLLPDEHRAALAAVRGGREHAEPFALYAALCELLALASRDGPLLCRADDVQWLDEVSLDALAFAARRVQDLPVAVLLAARDDRPGLAGIPHLRLGPLDEDASLRVLRDAIGDAVGGALADAIVDLADGRPRAIRDLAAALTPGQLSGAAAPPRALPPGSPLRALHRDRYLRLPAGAQRLVLLVVADEWVGAGTLDRAAGAAGIGAADVEAARESGLLRYETDAVTVRDRLVRSSLWADATRAERTAAHALLAEVLVHDWQYTGRIWHRAAMSGGTDDVAAAELAHAAVVSQGSGRYADSWRMWQRASTLTTDRTLAADRLLSAAADAWASGRPRRARAMLRRLAAFRCDGARTARADRLRGEIAAASGDPATALPLLRDAAERFAADDAALALETLLWAAEAAEAAGDVPAHAEIAERAAALPLPDEPWREARTRLMLDHLTGTAALHAGRYAEAARRLASATRHGSSVTDPAALAWAARAALNLGDAGLAPALATAAVAAARRAGIVPLESYALSVAARCEVLLGRPPAPVAAGHDGLRLAQATRLHGHAAEQLATLALAASFDGDSGAAERHLDRLATAAGRRGLVRAAAFGGWAPACLDLAADRPSDAVARLRLPAGPGVAHPGVRLAAAPHLVEALARGGDRARAAAAFDTFRRWSEATGTPVHRALAHRCRALLADTPADAAAHFTEALRLHETAGAVFEQGRTELLYGHRLRRARRPRAAREHLRTALRIFERYDAGPWTEQARAELRAAGETVAPLAVPAPAGPASVSGAAVVPSRTVPGQANGFGELTPQQAHIARLVAEGATNREIAARLLLSPRTIDHHLRNVFTRLGIRSRVELARMIR
>NZ_CP044407.1|WP_151013286.1|5932112_5933402_+|helix-turn-helix-domain-containing-protein
MTADADGAILRKAVLRLEDRLPELADRLAAEILSGEDGRDRPEAVLGDMWEVCHTGLGHGFEAILEPGGGRADLDWARRLGERRAQQGEPLEHVLRGYRLAGRVFWEAVVEAVGRHDPEHIPALVRQATRTWDTIDQQSDAAADAYHRTEFALARRSEERVHAIVDALLDGQGADGGLLATAGTVLGLPVTGRYAVAMLRADGGFAADVDLRPGEVGGMRFLWRMRANAQVALVALGAADLDDLVGALEPCTRGHAGVSPVAESLADLGTARWLAELALRTCHGPGPQVARLDRRLPDALVLSQPRLAGRLGDVALGGLGSVEPAYREVLLGTLDTWLDCGGSAARAAERLFCHRNTVLNRLRKIEQLTRRRLARPSDLVELVLALSAVRLHGSGADPQAAPPAAAPQGAAQPAASLLGAARPPRTRIP
>NZ_CP044407.1|WP_151018307.1|5933698_5934538_-|alpha/beta-hydrolase
MLASAALAAGLCAVPHTALAQENPYERGPDPTESSIEAPLGSYDVGEDSVSGLFVSGFGGGTVYYPEDTDETFGAVAIAPGFTAGQSSMSWYGPRLASRGFVVMTIDTNSRFDQPASRGDQLLAALDYMVEDSDAADLIDPNRLAVMGHSMGGGGTLEASVDRPSLKAAIPLTGWNLRKNWSQSQVPTLVVGAENDTVASVGSHSEPFYESLPPEKAYVELAGASHFAPNTSNTDIAKYSIAWLKRYVDNDTRYTQFICPGPDTGWFSDISEYRSTCPM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_7

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_7

5916546-5916768

Orphan

Consensus_repeat	Method
CGCTCCGGCCGAGGCCGAACGCATCGCCCGCTC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP044407_7

>merge|NZ_CP044407|7|5916546-5916768|CRISPRCasFinder
CTTGCTGGACGAGGCCGAACGCCTCACCGATTCCATCACCGACGCTGACCTCCGGGAACAGACGTTGATGTTCCTGGCGAGAGCCGCCGCCGGGTACGCTCCGGCCGAGGCCGAACGCATCGCCCGCTCCATCCCCGGCCCGACCTGCACATGGGCACTTAAGGGGGTGGCAGCAGTGGTGATGGAAACCGCTCCGGCCGAGGCCGAACGCATCGCCCGCTCG

>NZ_CP044407|7|7|5916546-5916768|CRISPRCasFinder
CTTGCTGGACGAGGCCGAACGCCTCACCGATTC	CATCACCGACGCTGACCTCCGGGAACAGACGTTGATGTTCCTGGCGAGAGCCGCCGCCGGGTA
CGCTCCGGCCGAGGCCGAACGCATCGCCCGCTC	CATCCCCGGCCCGACCTGCACATGGGCACTTAAGGGGGTGGCAGCAGTGGTGATGGAAAC
CGCTCCGGCCGAGGCCGAACGCATCGCCCGCTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151013262.1\|5908786_5909944_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|99746
NZ_CP044407.1\|WP_151013286.1\|5932112_5933402_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379258
NZ_CP044407.1\|WP_151013268.1\|5914804_5915479_-\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP044407.1\|WP_151013275.1\|5918844_5919783_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151013282.1\|5924085_5925933_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_CP044407.1\|WP_151018305.1\|5903786_5905061_-\|D-alanyl-D-alanine-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP044407.1\|WP_151013254.1\|5902401_5903796_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|223154
NZ_CP044407.1\|WP_151013277.1\|5919795_5920242_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP044407.1\|WP_151013279.1\|5920246_5921983_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013264.1\|5910070_5911954_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013260.1\|5908320_5908740_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341390
NZ_CP044407.1\|WP_151018307.1\|5933698_5934538_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|224423
NZ_CP044407.1\|WP_151013256.1\|5906669_5907251_+\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|224511
NZ_CP044407.1\|WP_151013273.1\|5917637_5918786_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|365903
NZ_CP044407.1\|WP_151013284.1\|5929086_5931909_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|197715
NZ_CP044407.1\|WP_151013281.1\|5921979_5923773_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224055
NZ_CP044407.1\|WP_151013270.1\|5915800_5916196_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151018306.1\|5925929_5928485_-\|protein-kinase/lanthionine-synthetase-C-family-protein	unknown	unknown	gnl\|CDD\|271199
NZ_CP044407.1\|WP_151013258.1\|5907253_5908240_+\|LCP-family-protein	unknown	unknown	gnl\|CDD\|367673
NZ_CP044407.1\|WP_151013266.1\|5912224_5913517_-\|aspartyl-protease-family-protein	unknown	unknown	gnl\|CDD\|276809

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151013262.1\|5908786_5909944_-\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|99746	cd06453, SufS_like, Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS catalyzes the removal of elemental sulfur and selenium atoms from L-cysteine, L-cystine, L-selenocysteine, and L-selenocystine to produce L-alanine; and selenocysteine lyase catalyzes the decomposition of L-selenocysteine.	2.26669e-107
NZ_CP044407.1\|WP_151013268.1\|5914804_5915479_-\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	1.29692e-62
NZ_CP044407.1\|WP_151013286.1\|5932112_5933402_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379258	pfam13556, HTH_30, PucR C-terminal helix-turn-helix domain. This helix-turn-helix domain is often found at the C-terminus of PucR-like transcriptional regulators such as Bacillus subtilis pucR and is likely to be DNA-binding.	3.78177e-18
NZ_CP044407.1\|WP_151013282.1\|5924085_5925933_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	4.72689e-34
NZ_CP044407.1\|WP_151018305.1\|5903786_5905061_-\|D-alanyl-D-alanine-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	8.67298e-38
NZ_CP044407.1\|WP_151013254.1\|5902401_5903796_+\|aminotransferase-class-V-fold-PLP-dependent-enzyme	gnl\|CDD\|223154	COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism].	1.22813e-85
NZ_CP044407.1\|WP_151013277.1\|5919795_5920242_+\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	1.62991e-09
NZ_CP044407.1\|WP_151013279.1\|5920246_5921983_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	2.03458e-78
NZ_CP044407.1\|WP_151013264.1\|5910070_5911954_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	5.1398e-163
NZ_CP044407.1\|WP_151013260.1\|5908320_5908740_+\|CBS-domain-containing-protein	gnl\|CDD\|341390	cd04622, CBS_pair_HRP1_like, CBS pair domain found in Hypoxic Response Protein 1 (HRP1) -like proteinds. Mycobacterium tuberculosis adapts to cellular stresses by upregulation of the dormancy survival regulon. Hypoxic response protein 1 (HRP1) is encoded by one of the most strongly upregulated genes in the dormancy survival regulon. HRP1 is a 'CBS-domain-only protein; however unlike other CBS containing proteins it does not appear to bind AMP. The biological function of the protein remains unclear, but is thought to contribute to the modulation of the host immune response. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	7.05173e-43
NZ_CP044407.1\|WP_151013256.1\|5906669_5907251_+\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|224511	COG1595, RpoE, DNA-directed RNA polymerase specialized sigma subunit, sigma24 homolog [Transcription].	3.57521e-30
NZ_CP044407.1\|WP_151013273.1\|5917637_5918786_+\|serine-hydrolase	gnl\|CDD\|365903	pfam00144, Beta-lactamase, Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.	9.65461e-55
NZ_CP044407.1\|WP_151013284.1\|5929086_5931909_-\|AAA-family-ATPase	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	4.11681e-16
NZ_CP044407.1\|WP_151013281.1\|5921979_5923773_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224055	COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms].	1.37291e-110
NZ_CP044407.1\|WP_151018307.1\|5933698_5934538_-\|alpha/beta-hydrolase	gnl\|CDD\|224423	COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism].	1.15139e-07
NZ_CP044407.1\|WP_151018306.1\|5925929_5928485_-\|protein-kinase/lanthionine-synthetase-C-family-protein	gnl\|CDD\|271199	cd04791, LanC_SerThrkinase, Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.	2.03735e-67
NZ_CP044407.1\|WP_151013258.1\|5907253_5908240_+\|LCP-family-protein	gnl\|CDD\|367673	pfam03816, LytR_cpsA_psr, Cell envelope-related transcriptional attenuator domain.	7.89323e-59
NZ_CP044407.1\|WP_151013266.1\|5912224_5913517_-\|aspartyl-protease-family-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	5.19181e-12

>NZ_CP044407.1|WP_151013270.1|5915800_5916196_+|hypothetical-protein
MSGRWVWGGATITVAAVAGLAVYYAVVGLEEADKLGSVVGSLVAVVGVAVAAYGLAGAPAPGRRVSQRARATGRGQVTQVGGDQVPRGAAAAGGAGRPAAEGGEQVRQNARADEDGAIRQIGGDQGRRSPS
>NZ_CP044407.1|WP_151013268.1|5914804_5915479_-|response-regulator
MRVLIVEDEPYLAEAVRDGLRLEAIAADIAGDGDTALELLGVHSYDLAVLDRDIPGPSGDEVARRIVASGSGVPILMLTAADRIDDKASGFELGADDYLTKPFELRELVLRLRALDRRRAHARPPVREIAGLRVDPFRREVYRDGRHVALTRKQFAVLDVLVAAEGGVVGAEELLERAWDANADPFTNAVRITVSALRKRLGEPWIIATVPGVGYRIDTGGAHG
>NZ_CP044407.1|WP_151013266.1|5912224_5913517_-|aspartyl-protease-family-protein
MADGEGWDRRSLLRGAAVVAGAAATAPLLGGTSAARTGTADADALFKAGKFEQAGRAYEEILRADPANLHAARRRGHVGLLSNSFRDAEKYLKTALDLAPDDRETNRLLADCYIRQDEFALSVPCWQAGGTEIFARWFGAIRGEPYQIHGDTARLPWRQTDPSPLVEGSVNGGPPKLFMPYTGAPWLGISVQMAEEAGLTPVAEQQIDYLDGTAWQYFGVLDSFRLGGIELRNVPVVWTDTDQDSPGGGDGIIGTWVFYHLLTTFDYAGRSLILRRPTPEASRRARADAARAGARPLPLWIAREHNLHSMGSVAGSAPAVVGLPIGGTSENAVVMSEETAKRLRVRTDYDRPLETFAHSHPTVTYPCYPEEVRLGGAVAKGVYSLVNPNGPLGRSGFDVLAAFFHSFYKPFNITLDFTEMNVYIARGKAP
>NZ_CP044407.1|WP_151013264.1|5910070_5911954_+|ATP-binding-cassette-domain-containing-protein
MDMEVTAWMSLHHAANAQDRRPFNRATLRRIGAFARSHRRTLTAFLLLSVVLAVLAVATPVLAGRVVDAINERAATSTVVWLAVLIAVLAVAEGGLGLANRWLSARIGEGLILDLRTAVFDHVQRMPVAFFTRTRTGALVSRLNNDVIGAQRAFSDTLSGVVSNLVMVALTFAVMIGISWQITLLALVLLPLFLLPARRMGSRLARLEREAVGHDSAMSTQMTERFSAPGATLIKLFGRPARESAEFAARARRVRDIGVRTAMVQHVFITALTMVSALALALVYGLGGYLALRNSLDAGAVVALALLLTRLYAPLTALASARVEVMSALVSFERVFEVLDLKPLVAEKPDTRDVPDGPVSVEFDDVRFSYPSPEKVSLASLEEVATLDTRGGQEVLHGISFKAEPGQMVALVGSSGAGKSTIAQLLPRLYDVDSGAVRLGGVDVRDLSFAGIRATLGMVTQDGHLFHESIRENLLLARPEATEDELWSVLRRARLDALIEGLPDGLDTIVGERGYRLSGGERQRLTIARLLLARQRVVILDEATAHLDSTSEAAVQEALAEALDGRTAVVIAHRLSTVRAADQILVVEGGTIVERGTHDELLAARGRYADLYRTQFSDDAPPLEPVA
>NZ_CP044407.1|WP_151013262.1|5908786_5909944_-|aminotransferase-class-V-fold-PLP-dependent-enzyme
MDVGTLRADTPGCAEVAHLNNAGAALPPRPVLDAVTGHLALEAAIGGYEAAERAADEIEHFYDAVAGLIGARADEVAYVENATRAWDMAFYAIPFAEGDRILTTAGEYSSNAIAYQQVAAARGARVEVVPDGPDGAISLPALEAELAKGGVRLVSLNHVPTHNGLINPAAEVGRLCNEHGVLYLLDACQSVGQLAVDVREIGCDMLSATGRKFLRGPRGTGFLYVRREIVRTLEPPFLDLRAAEWRAPDGYEPRPDARRFETWERFVAGQLGLAAAADHAAALGMDEIEKRVTALAAALRSALAARPGTTVLDRGTHKSGIVTFTVDGHEPAAIQRTAREHKINVNVTTPAAHGYDPDAVPAAVRASVHYYNTEEELDRLLAILP
>NZ_CP044407.1|WP_151013260.1|5908320_5908740_+|CBS-domain-containing-protein
MARKIRDIMTGSPTSVSPELDIVTVARAMRDEDIGAVLVAEGDEMKGLVTDRDLVIRGLAAGGDPKDVKIGGLASRATATIGPDDSVDKAAQLMRERAVRRLPVVEDGRPVGIVSIGDLAVERDTDSALADISASRPNT
>NZ_CP044407.1|WP_151013258.1|5907253_5908240_+|LCP-family-protein
MDDMELIRGLGRDLEHEPPASLVRQRERLLRAGQRRRRLPGRWSLLGVVAVVTAAAVLVPVLFLRGGKAAAPVAGERAGAFNMLLIGSDARGDGAGARSDTLMLLHVPEGRESARVVSFPRDLVVQIPRCGGRSQGRNVINSAFLAGGAACAAETVGRLTGVRIDRSVTVGFDGFRTVVDALGGVEVTLPEAVRDPKAGLSVPAGKSRLDGRQALAYVRARYSLGDGSDLARIERQQAFLASMAGRVAELRKDPVAFARFVTAVAGAVETVPDLDAAGLLELSRSMAKVGADDVGFGTVPVVPAVDHPQRVEPDGQRAEELFAQLRGA
>NZ_CP044407.1|WP_151013256.1|5906669_5907251_+|sigma-70-family-RNA-polymerase-sigma-factor
MTAPPAVPLIDAELIRSSLTDPESFAELFDRYSPMIFRYVSRRLGPEAAEDVVGDTFLAAFGARHRYDLSRPDARPWLFGIATKLVARHHRSEAARYRALRRSPVDGPVEGPAERVADGLTAAAVRPALAAALAALPRRDRDVLLLVAWGDLAYEQVAHALGVPVGTGRSRLHRARRKVRAALGDSNPMHEEE
>NZ_CP044407.1|WP_151018305.1|5903786_5905061_-|D-alanyl-D-alanine-carboxypeptidase
MTRQDIPQVTGVPEDEPAGRAGQGERAGRRAWPWVLVAALAVVLAVVTVQLLRPVPEPELRLTIAAEHTFPGAAPVLPWPGSGQSAVFVEGIGMMGTSGGAVPAPTASVAKVMTAFVYLRDHPLRAGEPGPTMTVSPEGVAEMPARRARGESLLGITQGQRLTQRKALEALMIISANDVAHELAKWDAGSVRAFVAKMNAAARELGMTNTTYTDPSGYDAGTVSTAADQVKLLRAAMAMPAFAEIVNQRSYAPANGGPLREGGNFLLGQSGVVGGKTGFTDAAGGNFVFAARKDVAGVATLIVGAVMGQRTASAAGAVTAAGELVRAAESALTGVTVAKAGARVAVVDDGLGGTTPVRAASAVTVVGWSGLTVAVAAQGNPPAEAPAGTGTGTLTAGAARVPLELADAYEGPAIVDRLTRLGQE
>NZ_CP044407.1|WP_151013254.1|5902401_5903796_+|aminotransferase-class-V-fold-PLP-dependent-enzyme
MTLPEEGRPAAELLDLLAGLREADLPVRGGKVTAYVYDTGRDAVHDLAATAYREMLEVNCLDPTAFPSIQVLEREVVGAVADRLGGGTGIFTSGGTESIMLAVKAARDARPVPDPQLVVPATAHPAFHKAAHYLGLEPVIVPVDDGYRADPAAVAAAITPRTVLVVASAPSYPHGVMDPITEIAAIAESAGVLCHVDACVGGWVLPWLREAGRPVPPFDLSVPGVTSLSCDLHKYGYAPKGASVVLFADPALRRRAYFASAEWPGYTVINSGVQSSKSAGPLGAAWATLNAVGADGYRDLAVRAMDSAERLIAGLPDGLRVLGAPAVPLVAVASADPALDVFVLADEARDRGWFFQPQLSYRGIPANLHFTITGVSDTGALLGALADAAKAARAAGPPPVPDGLVDAIAALDLDSIDDAGFAELLASAGAGPSGGMAVVNAVLDELPPPTREALLVRFLSALYS
>NZ_CP044407.1|WP_151013273.1|5917637_5918786_+|serine-hydrolase
MPDERGPDRVRRVLDGHIGAGLAPGLVALVRRGAETRAVVLGSMAAGGGAPMRRDALFRVLSLTKPVTAVAALSLVEDGTLALDDPVDRWVPELAGPRVLRRPDGPLDDTVPAARAITVRDLLTFRLGTGAMTEPCPLGDAMAAAGVAPGPDPTELAPGEWLGRLGALPLAYQPGARWLYDTGSDVLGVLLARAADRPLADLFRERVFEPLGMRDTGFHVPSGEAHRLAASYRPPDGSGVLTPRDDPRDRPPAFPSGAGGLVSTADDYVTFFRTLLDGGGPVLSRESVAAMTTDRLRAAEKAGAGMFLQSGGWGFGVAVETRDDPPESRAGRFGWMGGLGTMAFADPSADLVAVLFTQVELGSPESARVFDEFREVAYAPAE
>NZ_CP044407.1|WP_151013275.1|5918844_5919783_+|hypothetical-protein
MGRQGWPRLRVADWQATRDTLHMWAQIVGKVRLAHAPLVNHWWNVTLYVSPRGLTTSTIPYGTGAFDVEFDFVGHRLRLRGSDGTDEGFALEPMTVAEFHDRTMRALGRLGVETRIQGHPNEVDPAIPFAEDDVHASYDADAAHLFWRQLLQGSRVLGEFRSRFVGKVSPVHVFWGALDLACTRFSGRTAPDHPGGAPNCGDWVMVEGYSRELSSCGFWPGGGEEGAFYAYAYPEPEGFAARSVRPSAAFYSAENGQFLLPYEAVADDPDPDAALLAFLQDTYEAAADLAGWDRDVLEADPARWAHKTNHRV
>NZ_CP044407.1|WP_151013277.1|5919795_5920242_+|VOC-family-protein
MVTREQLPAPTEGLVLTHFLTVRDVARSRAFYADVLGGEVVLAENPAIVRVANTWIIMNPGGGPTPDKPDVTLRAPEPGDPVTAFMNVRVADIAAFHARATSLGARFLTEPIDRKAEIRCYMVDPDGRLIEVGQATGMLHGVYADPPA
>NZ_CP044407.1|WP_151013279.1|5920246_5921983_-|ATP-binding-cassette-domain-containing-protein
MRVPPAARLLRRHLRGRGPALRGLAAWSVVEGLPVLAGGLLLARAVDHGFLAGRPGTGLAWLAVLAVLYLCGAEATRRIYPRLATTVEPLRDSLVTDVVTASLHRTGGTGGEADGTAGGAGTGVAQVAEQAEAVRVLLGTALRNVRQLLAAGIAALVGLALLSPPLALAIALSVAVAVGVFAAFLGVQIRRYRDVVRQAERIGESGAAIVAGVRDVVACAAEDRAARTVAASIDAQAAAMRAFARSRLVRLPVLALGVHLPLLVLLALAPSLIDGGRLTTGEVAGAAGYLITGLQPGIVLLVDAGGTLLLSLAVILGRLAETGAGGTAPALPARPGPVPASSDIELDRVTFAYSPRAAPVLTGLSLRIPAGTHLAVVGPSGTGKSTLANVLTDLVRPQRGTVTLGGVPLPDVDRDRLRSAVTLIPQESYIFAGTLRENLAYLRPGATTAQLDEAARAVGLEETLRRFGGYDAAVPPGGGSLSHGERQLVTLARAYLSAAPVLILDEATCHLPPAAEARAERALAGRGRTLVVIAHRISSAERAHRVLLLDSSGPIVGTHRTLLDLSPLYAELVGHWRT
>NZ_CP044407.1|WP_151013281.1|5921979_5923773_-|ATP-binding-cassette-domain-containing-protein
MTGRVRTEPAGGETAPRTEAPAAPPAPAVLRAGGRRLLRAAMRRTRALMGVLVLCTLLRVLATLATPVMLARAIDAVHTGRPPGGALTGLAVVLAVAALADAGEDLAGSYCGSHVTAWLRHRLIGRVLELGVPGRRRFPTGDVLSRLTESASGPAAFPVQLVSVAATLATTAGAVVALGLIDWTLALAFALGVPPAVVVLRVFVARAGEPFADYARHQAAVATRLLDAHQGIRTIRASGTADREVARILRPLPLLRDAGHRTWAVQGRVGWRLALLAPLLQVAVVGVAGLRLATGDITPGGLVAAASYTAMAVGAAALFDTVVALLNCEVSAGRVQEVLDTVPAVAPPPRPVALPDGPGRLSLRDVTVRIGDRTVLDRLDLTVPAGTGVAVVGASGTGKSVLVSLVGRLLDPQEGRVELDGVPVTAVAPPELRRAVAYAFERPALLGATVHDTIAYARPEATRAQVRRAARTAAADDFVRALPDGYDTPLDRAPLSGGELQRLGLARAALTGARVLVLDDATSSLDTATEMKVTRALQRLLARRTSLVVARRPATAARADLVAWLDGGRIRALAPHAELWADPDYRAVFGTAPGPGG
>NZ_CP044407.1|WP_151013282.1|5924085_5925933_-|alpha/beta-fold-hydrolase
MTAVPALPAIPSRFGFAFSGDGRWATCLSTVQDRVTLERWDLTGPVPSGRAVGTAGDPVDRTSRPIPLDDGRVLVARAATGAGGAPAGHGTVLAVRPGGPDGPDGAAARSWRIAPMLAGYPLAGPGSPQTLVVVTVEDERHSRIWVLPHGAGPPEPVVRIPGVLSGGVWLDDGRTLALDHAGDGHRTDGIVVDLRERSWRRIWTVSDTTSDRIVACDRAARRLAVTTGGPGRAVPAIGLWSPGGGRVRFPASLNRPGRARTPLAFGGGERLLVCEDVGATSRLLIHTPADDRVEPVPGPRGVLSPPASWTGGRIHLRFSAPHQPPTLATAHRAGWSLARRPAGTAARWAGADLVELPGPDGPVEAIVYGGARWHESDRVVLALHGGPLAAWRLEFDPLFQHLAAAGIAVVAPNQRGSTGYGERHLRAVVGDWGGPDLADVVHLGRGIAERRRGTGARVREPVLLGASYGAWLALLAACRHPDLWAACVALAPFTSPASLYRDAAAPVRDRVAALHRPGGTGRDARRDVLAACGALTAPLLVAHGTRDEVVPVGQSRALRRRLLELGRTEGPGFEYLEVDDDHTAVVQAWPADLRTSVVRFCLGAGRTLVPSKERR
>NZ_CP044407.1|WP_151018306.1|5925929_5928485_-|protein-kinase/lanthionine-synthetase-C-family-protein
MHVSATPASAPEVLARALPVLLAGEARSAFKFAATVDFVAALNARNTSRGHSGKFMTIYPESDTEAVRIARELHEATQGLAGPRVLSDRPYAPGSLVHYRYGAFVEERRLTNDGFYTWTILDPDGKPVEDQRTGKYTPPSWVTSPFPDNGMNGTRRSREAGAIMLGEHFAVREAIRHTNKGGVYRAVDRRTGDPVVIKEGRPHVAADMDGRDTRDRLRAEARALERLAGTGLAPRLVALFPQGGHLFLAQEMIEGGPLREWAADRIVETGWGGHLPAATDMARRLVELMSDVHAAGLLVRDFNPNNIMVRPDGAPVLIDLELAVVDGEDGPRQAGTPAFGAPEQLGGAAPHASADHYSLGATLCYLFTGAPPYLLDESPESRPPAERLEEWLAARTQDLDFPEHLRAMLRGLMADDPRHRWTADRAREALAARAPRRARGRDAETPWPRETVDRAIGGIVDELLASMDPDAPHALWPVSCVHGAPDPCTLQQGAAGCLGALVRYAELTGDPRLPDAIAAAARWIRARLADGTSRPPGLYFGTAGVSWSLLEAGLALGDERLVDDAADVAEGLPTAVASPDITHGTAGLGLTALHLWSRTGSARFARRADAAADALLGTVEDREGRLMWSTPADVDSKLAGRSYYGFAHGIAGVGYFLVACAEATGRDDCRALALRIGEELLDAAVVERGTAMWGAGAGDAPTAPYWCHGASGIGSFLLRLGTATGDARFLEAADRAARAVTEHAWRAVLGQCHGLSGNGDFLLDMADLTGDDRHRAAAWRLARTIVAARALRDGRLVLPDEQGEVSATWGDGLSGMLGFLLRLRYGSPRLWTVDAAAATAPTTATTARGAS
>NZ_CP044407.1|WP_151013284.1|5929086_5931909_-|AAA-family-ATPase
MTVTQGRDPLHGRVPELDAIGELLDRARGGRGGALAIVADAGLGRTALLEEAVRRAGPDVRTITASGVARESGVPYAGLHRLLRPLAAEIRLLPDEHRAALAAVRGGREHAEPFALYAALCELLALASRDGPLLCRADDVQWLDEVSLDALAFAARRVQDLPVAVLLAARDDRPGLAGIPHLRLGPLDEDASLRVLRDAIGDAVGGALADAIVDLADGRPRAIRDLAAALTPGQLSGAAAPPRALPPGSPLRALHRDRYLRLPAGAQRLVLLVVADEWVGAGTLDRAAGAAGIGAADVEAARESGLLRYETDAVTVRDRLVRSSLWADATRAERTAAHALLAEVLVHDWQYTGRIWHRAAMSGGTDDVAAAELAHAAVVSQGSGRYADSWRMWQRASTLTTDRTLAADRLLSAAADAWASGRPRRARAMLRRLAAFRCDGARTARADRLRGEIAAASGDPATALPLLRDAAERFAADDAALALETLLWAAEAAEAAGDVPAHAEIAERAAALPLPDEPWREARTRLMLDHLTGTAALHAGRYAEAARRLASATRHGSSVTDPAALAWAARAALNLGDAGLAPALATAAVAAARRAGIVPLESYALSVAARCEVLLGRPPAPVAAGHDGLRLAQATRLHGHAAEQLATLALAASFDGDSGAAERHLDRLATAAGRRGLVRAAAFGGWAPACLDLAADRPSDAVARLRLPAGPGVAHPGVRLAAAPHLVEALARGGDRARAAAAFDTFRRWSEATGTPVHRALAHRCRALLADTPADAAAHFTEALRLHETAGAVFEQGRTELLYGHRLRRARRPRAAREHLRTALRIFERYDAGPWTEQARAELRAAGETVAPLAVPAPAGPASVSGAAVVPSRTVPGQANGFGELTPQQAHIARLVAEGATNREIAARLLLSPRTIDHHLRNVFTRLGIRSRVELARMIR
>NZ_CP044407.1|WP_151013286.1|5932112_5933402_+|helix-turn-helix-domain-containing-protein
MTADADGAILRKAVLRLEDRLPELADRLAAEILSGEDGRDRPEAVLGDMWEVCHTGLGHGFEAILEPGGGRADLDWARRLGERRAQQGEPLEHVLRGYRLAGRVFWEAVVEAVGRHDPEHIPALVRQATRTWDTIDQQSDAAADAYHRTEFALARRSEERVHAIVDALLDGQGADGGLLATAGTVLGLPVTGRYAVAMLRADGGFAADVDLRPGEVGGMRFLWRMRANAQVALVALGAADLDDLVGALEPCTRGHAGVSPVAESLADLGTARWLAELALRTCHGPGPQVARLDRRLPDALVLSQPRLAGRLGDVALGGLGSVEPAYREVLLGTLDTWLDCGGSAARAAERLFCHRNTVLNRLRKIEQLTRRRLARPSDLVELVLALSAVRLHGSGADPQAAPPAAAPQGAAQPAASLLGAARPPRTRIP
>NZ_CP044407.1|WP_151018307.1|5933698_5934538_-|alpha/beta-hydrolase
MLASAALAAGLCAVPHTALAQENPYERGPDPTESSIEAPLGSYDVGEDSVSGLFVSGFGGGTVYYPEDTDETFGAVAIAPGFTAGQSSMSWYGPRLASRGFVVMTIDTNSRFDQPASRGDQLLAALDYMVEDSDAADLIDPNRLAVMGHSMGGGGTLEASVDRPSLKAAIPLTGWNLRKNWSQSQVPTLVVGAENDTVASVGSHSEPFYESLPPEKAYVELAGASHFAPNTSNTDIAKYSIAWLKRYVDNDTRYTQFICPGPDTGWFSDISEYRSTCPM

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_9

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_9

6630666-6630798

Orphan

Consensus_repeat	Method
CGCCTCCCGCTCCGCCAGGGCTCCGCTCCAGGCGCCGGTCAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_9

>merge|NZ_CP044407|9|6630666-6630798|CRISPRCasFinder
CGCCTCCCGCTCCGCCAGGGCTCCGCTCCAGGCGCCGGTCAGTGTCATTGTGGGGGGACGACCCCCCACAGCCCCTGGAACGGCTGACCGGCGCCTTCCGCTCCGCCAGGGCTCCGCTCCAGGCGCCGGTCAG

>NZ_CP044407|9|9|6630666-6630798|CRISPRCasFinder
CGCCTCCCGCTCCGCCAGGGCTCCGCTCCAGGCGCCGGTCAG	TGTCATTGTGGGGGGACGACCCCCCACAGCCCCTGGAACGGCTGACCGG
CGCCTTCCGCTCCGCCAGGGCTCCGCTCCAGGCGCCGGTCAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151014425.1\|6634724_6636134_-\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224160
NZ_CP044407.1\|WP_151018381.1\|6631402_6631876_-\|DUF1772-domain-containing-protein	unknown	unknown	gnl\|CDD\|227787
NZ_CP044407.1\|WP_151014417.1\|6628200_6629349_+\|cystathionine-gamma-synthase	unknown	unknown	gnl\|CDD\|236104
NZ_CP044407.1\|WP_151014410.1\|6624216_6624417_-\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NZ_CP044407.1\|WP_151014421.1\|6632001_6632655_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|379522
NZ_CP044407.1\|WP_151018382.1\|6642990_6643950_+\|Gfo/Idh/MocA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|223745
NZ_CP044407.1\|WP_151014404.1\|6621310_6622342_-\|SGNH/GDSL-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|238874
NZ_CP044407.1\|WP_151014423.1\|6632662_6634699_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227204
NZ_CP044407.1\|WP_151014435.1\|6641268_6642705_-\|NDP-hexose-2,3-dehydratase-family-protein	unknown	unknown	gnl\|CDD\|367562
NZ_CP044407.1\|WP_151014433.1\|6640396_6641272_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	unknown	unknown	gnl\|CDD\|130274
NZ_CP044407.1\|WP_151014431.1\|6639565_6640375_+\|winged-helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|276938
NZ_CP044407.1\|WP_151014396.1\|6619882_6621103_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181146
NZ_CP044407.1\|WP_151014408.1\|6623999_6624185_-\|DUF397-domain-containing-protein	unknown	unknown	gnl\|CDD\|377231
NZ_CP044407.1\|WP_151014427.1\|6637288_6638452_+\|FIST-C-terminal-domain-containing-protein	unknown	unknown	gnl\|CDD\|226833
NZ_CP044407.1\|WP_151014416.1\|6625874_6628040_-\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP044407.1\|WP_151014406.1\|6622519_6623923_+\|cystathionine-beta-synthase	unknown	unknown	gnl\|CDD\|273464
NZ_CP044407.1\|WP_151014412.1\|6624413_6625226_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|197775
NZ_CP044407.1\|WP_151014414.1\|6625322_6625745_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|340413
NZ_CP044407.1\|WP_151018380.1\|6629676_6630594_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP044407.1\|WP_151014429.1\|6638448_6639411_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151014425.1\|6634724_6636134_-\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|224160	COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism].	1.26575e-91
NZ_CP044407.1\|WP_151018381.1\|6631402_6631876_-\|DUF1772-domain-containing-protein	gnl\|CDD\|227787	COG5500, COG5500, Predicted integral membrane protein [Function unknown].	1.10315e-17
NZ_CP044407.1\|WP_151014417.1\|6628200_6629349_+\|cystathionine-gamma-synthase	gnl\|CDD\|236104	PRK07811, PRK07811, cystathionine gamma-synthase; Provisional.	0
NZ_CP044407.1\|WP_151014410.1\|6624216_6624417_-\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	9.31069e-18
NZ_CP044407.1\|WP_151014421.1\|6632001_6632655_+\|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	3.1048e-13
NZ_CP044407.1\|WP_151018382.1\|6642990_6643950_+\|Gfo/Idh/MocA-family-oxidoreductase	gnl\|CDD\|223745	COG0673, MviM, Predicted dehydrogenases and related proteins [General function prediction only].	3.68584e-55
NZ_CP044407.1\|WP_151014404.1\|6621310_6622342_-\|SGNH/GDSL-hydrolase-family-protein	gnl\|CDD\|238874	cd01836, FeeA_FeeB_like, SGNH_hydrolase subfamily, FeeA, FeeB and similar esterases/lipases. FeeA and FeeB are part of a biosynthetic gene cluster and may participate in the biosynthesis of long-chain N-acyltyrosines by providing saturated and unsaturated fatty acids, which it turn are loaded onto the acyl carrier protein FeeL. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.	2.69893e-50
NZ_CP044407.1\|WP_151014423.1\|6632662_6634699_-\|hypothetical-protein	gnl\|CDD\|227204	COG4867, COG4867, Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only].	0
NZ_CP044407.1\|WP_151014435.1\|6641268_6642705_-\|NDP-hexose-2,3-dehydratase-family-protein	gnl\|CDD\|367562	pfam03559, Hexose_dehydrat, NDP-hexose 2,3-dehydratase. This family includes a range of proteins from antibiotic production pathways. The family includes gra-ORF27 product that probably functions at an early step, most likely as a dTDP-4-keto-6- deoxyglucose-2,3-dehydratase. Its homologs include dnmT from the daunorubicin biosynthetic gene cluster in S. peucetius, a similar gene from the daunomycin biosynthetic cluster in Streptomyces sp. strain C5, eryBVI from the erythromycin cluster in S. erythraea and snoH from the nogalamycin cluster in S. nogalater. The proteins in this family are composed of two copies of a 200 amino acid long unit that may be a structural domain.	8.25992e-105
NZ_CP044407.1\|WP_151014433.1\|6640396_6641272_-\|glucose-1-phosphate-thymidylyltransferase-RfbA	gnl\|CDD\|130274	TIGR01207, Glucose-1-phosphate_thymidylyltransferase_1, glucose-1-phosphate thymidylyltransferase, short form. Alternate name: dTDP-D-glucose synthase homotetramer This model describes a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases. It is well characterized in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	6.5969e-154
NZ_CP044407.1\|WP_151014431.1\|6639565_6640375_+\|winged-helix-turn-helix-domain-containing-protein	gnl\|CDD\|276938	cd15831, BTAD, Bacterial Transcriptional Activation (BTA) domain. The Bacterial Transcriptional Activation (BTA) domain is present in the putative transcriptional regulator Mycobacterium EmbR and the related Streptomyces antibiotic regulatory protein (SARP) family of transcription factors, which includes DnrI and AfsR, among others. Members of this family contain an N-terminal DNA-binding domain, followed by the BTA domain, and many have diverse domains at the C-terminus. EmbR contains an C-terminal forkhead-associated (FHA) domain, which mediates binding to threonine-phosphorylated sites in a sequence-specific manner. The BTA domain of EmbR contains three Tetratricopeptide repeats (TPRs) and two C-terminal helices. The TPR motif typically contains 34 amino acids, and 5 or 6 tandem repeats of the motif generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein.	9.43279e-52
NZ_CP044407.1\|WP_151014396.1\|6619882_6621103_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181146	PRK07851, PRK07851, acetyl-CoA C-acetyltransferase.	0
NZ_CP044407.1\|WP_151014408.1\|6623999_6624185_-\|DUF397-domain-containing-protein	gnl\|CDD\|377231	pfam04149, DUF397, Domain of unknown function (DUF397). The function of this family is unknown.	1.11539e-20
NZ_CP044407.1\|WP_151014427.1\|6637288_6638452_+\|FIST-C-terminal-domain-containing-protein	gnl\|CDD\|226833	COG4398, COG4398, Uncharacterized protein conserved in bacteria [Function unknown].	2.66948e-86
NZ_CP044407.1\|WP_151014416.1\|6625874_6628040_-\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	6.79403e-71
NZ_CP044407.1\|WP_151014406.1\|6622519_6623923_+\|cystathionine-beta-synthase	gnl\|CDD\|273464	TIGR01137, Cystathionine_beta-synthase, cystathionine beta-synthase. Members of this family closely resemble cysteine synthase but contain an additional C-terminal CBS domain. The function of any bacterial member included in this family is proposed but not proven. [Amino acid biosynthesis, Serine family].	0
NZ_CP044407.1\|WP_151014412.1\|6624413_6625226_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|197775	smart00530, HTH_XRE, Helix-turn-helix XRE-family like proteins.	1.81852e-08
NZ_CP044407.1\|WP_151014414.1\|6625322_6625745_+\|ATP-binding-protein	gnl\|CDD\|340413	cd16936, HATPase_RsbW-like, Histidine kinase-like ATPase domain of RsbW, an anti sigma-B factor and serine-protein kinase involved in regulating sigma-B during stress in Bacilli, and related domains. This family includes histidine kinase-like ATPase (HATPase) domain of RsbW, an anti sigma-B factor as well as a serine-protein kinase involved in regulating sigma-B during stress in Bacilli. The alternative sigma factor sigma-B is an important regulator of the general stress response of Bacillus cereus and B. subtilis. RsbW is an anti-sigma factor while RsbV is an anti-sigma factor antagonist (anti-anti-sigma factor). RsbW can also act as a kinase on RsbV. In a partner-switching mechanism, RsbW, RsbV, and sigma-B participate as follows: in non-stressed cells, sigma-B is present in an inactive form complexed with RsbW; in this form, sigma-B is unable to bind to RNA polymerase. Under stress, RsbV binds to RsbW, forming an RsbV-RsbW complex, and sigma-B is released to bind to RNA polymerase. RsbW may then act as a kinase on RsbV, phosphorylating a serine residue; RsbW is then released to bind to sigma-B, hence blocking its ability to bind RNA polymerase. A phosphatase then dephosphorylates RsbV so that it can again form a complex with RsbW, leading to the release of sigma-B.	3.59208e-13
NZ_CP044407.1\|WP_151018380.1\|6629676_6630594_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	6.78904e-28
NZ_CP044407.1\|WP_151014429.1\|6638448_6639411_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.10125e-68

>NZ_CP044407.1|WP_151018380.1|6629676_6630594_+|alpha/beta-fold-hydrolase
MVTPELPKTETYPYGPGERQQVDAYWTTSERGTAPRPAVLVVHGGYWLQGDKSAWEYFARRLVADGYVVLATNYRLAPAAQWPAQRTDVAAALNFLKTNAARWNADPERVVVIGSSSGGHLATQLGTYGDGGERVRGVVALSPPNDPELAYTDGAAPTADHRQQKLRRAVVELLGCDPAESAAGSRCWRLLADAKSETHVSAGDAPMLFMHGTSEFVPVAESRGLATALRAAGIEATIKTVEGAGHAAELLNDPDAYPTIAEWLERHLAPEPSGGAPVGEDDEGDDDEPPVELPSALPTQRATDD
>NZ_CP044407.1|WP_151014417.1|6628200_6629349_+|cystathionine-gamma-synthase
MDNDVHLGFETVAIHAGQEPDPVTGAVVPPIYQVSTYKQDGIGGLRGGYEYSRSANPTRTSLEVCLAEIEGGVRGLAFASGLAAEDALLRTVCRPGDHVIIPNDAYGGTYRLFAKVAEPWGVAFDPVPLGDVAAVRAAVRPDTRIIWVETPTNPLLGVADIAALASVARDAGALLVVDNTFASPYLQRPLELGADVVVHSTTKYIGGHSDVVGGALIVADPALGERLAFNQNSMGAVAGPFDAWLTLRGIKTLGVRMDRHCANAERVVDMLTRHPSVRRVLYPGLPEHPGHEIAAKQMKGFGGMVSFRMESEEAAVRVCERTKLFTLGESLGGVESLIEHPGRMTHASAAGSPLEVPADLVRLSVGIEDAGDLLRDLETALS
>NZ_CP044407.1|WP_151014416.1|6625874_6628040_-|MMPL-family-transporter
MFAGLARFVVRHPWWTIVAWLAAAVVIIAFSPKLTTESDQGEFLPSGYESVQAVELETDAFPQQAEASSLIVVQRSDGGQITPQDTAKITEAAKTLTAEKDEYPTVQGFITSPELVAPNKSIQLITVPMEMATGAEAQEQSQAIKDLREKLPEVLGGNLEAKVGGDIAMFVDNEDSFTQSFLLITVATFALIIGLILLIFRAPLAAILPIIVIIVTEQLSMGLIGSASKLLDFSGDDSLQIILTIVLFGVGADYYLFVLFRYRELLRAGVERKEALIRAVERVGEVITSAAAAIAATFIVLMLASFGIFAAWGPSLAIGVVVMGITSLTVFPALLSILGTAVFWPSKAWKKEPKGTVSTKLGGLVGKRPAIVALAAAAVMIALSTGVLGFKSNYDFQSSFPQDTESAMAMKDMEKGFPAGQTRPVKVMFESTDGQPLTKAELDAFGAEAKSLPGVGGVAPAELGQDPKVGRVNLLLDGNPVSNESINLVKDELNPAVHDLAPEGTKAYVGGEAAIYADINKVVNRDLSVILPVAGVLIAVILLLLLRSVVAPLYLVPAVLLGYAATLGSAVFVFQGLLGEPGEIFHLPIMLYLFVLAIGTDYNILMTARLREEAKQGHAPRKAAALAVQHGGPTVAAAGLILAGTFSVMLLASVSMLQQMGFSIALGIALSAFVMSIFLVPGVTALLGERAWWPGRAGPKEPPAGSADPAEEQYAPSGTRS
>NZ_CP044407.1|WP_151014414.1|6625322_6625745_+|ATP-binding-protein
MGMTIACAGAGRHVYSGRWHAWEETVYLSRTLVDEAVTAWRCEHLRDDARVIVSELVTNSVRADRGGLIEVRLTNHNGAVMGIRVWDNSPRRPEDRHPGELGERGRGLFIVRALTNDACGWEYLPAAQGGGKVVWATLAV
>NZ_CP044407.1|WP_151014412.1|6624413_6625226_-|helix-turn-helix-domain-containing-protein
MARADHLDPDSSHWHWLAVDLRVWRLERNLSQAELGALLGVDISTVSNWESGSAKLPKGRAEALDRIWKTRGHFARLRNLAESSHNPDWFDQYTRYERKAEAIRAYSALALHGLLQTEEYTRALVLSGELVDDVDQAVEERMARQQVLAAPRPPELWILIKESVLQDPIGGPDVMRVQLDHLINLSHRPNIVIRVVPRSLGAHPGIDGSFTLLECDGVDHSWSEAVGGGRLVSDPTKVRACRVKYDRIGADALSRDCSRNLIAEVMEAMQ
>NZ_CP044407.1|WP_151014410.1|6624216_6624417_-|DUF397-domain-containing-protein
MSKPVWRKSSRSGTGGAGGQECVELAPLGTSIGVRDSKTPEGGHLTISRGAFAALLNRIKADDPNA
>NZ_CP044407.1|WP_151014408.1|6623999_6624185_-|DUF397-domain-containing-protein
MIHWRKSSHSDTSGNECVEVADLAVGLGVRDSKNPEGGHLTVSRRTFATLLSRIKADTPNA
>NZ_CP044407.1|WP_151014406.1|6622519_6623923_+|cystathionine-beta-synthase
MHVHDSLVELMGNTPLVRLRKVTEGYTRGRVPQVFAKVEYFNPGGSVKDRIAVRMIDAAEASGELRPGGTIVEPTSGNTGVGLAIVAQERGYRCVFVCPDKVAKDKIDVLRAYGAEVVVCPTAVNPDHPDSYYSVSDRLTAEIPDAWKPNQYANPQNPASHYATTGPELWEQTEGRITHFVAGIGTGGTISGAGKYLKEVSGGRVQVIGADPEGSVYSGGTGRPYLTEGVGEDIWPDTYDREICDRVIAVSDKDSFVMTRRLAREDALLVGGSCGMAVVAALRVAAEADDDAVIVVLLPDGGRGYLSKIFNDEWMSQYGFSEERSATETTVGDVLAHKTGELIPNFVHMHPTESVGEAVKVLREFGVSQMPVVAPGAGHPDVMAGEVVGAVEERVLLHALYADQAGSDDPLEKHMSPPLPVVGSGEPVARMVSVLENRDAVVVLVDGKPSGIVTRQDVLSYLADTRP
>NZ_CP044407.1|WP_151014404.1|6621310_6622342_-|SGNH/GDSL-hydrolase-family-protein
MLRAFTARRIAAAAAYGGGGITALGGATFALVVMEMRLARKIILATPNGDPPRADGLYGEMYGRAPLSLVVLGDSTAAGLGVHDPAETPAAVLASGLAAMAGRPVRLTNVALPGARSSALGGQVERALEVRPDVAVVMVGANDVTSRVPAADSVRHLAGAVGRLRDAGAQVVAGTCPDLGSVKPLMQPLRWIARRASRQLAAAQTIAVVERGGRSVSIGDLLGREFAADPHTMFSADRYHPSARGYAAAAAALLPSLAAALELEPDLEAWPLRTRIGDGVLPVYRAAAAAAELAGTEVSGASVAGRERGPRGRWARLLRRRSATEPDTGSGAGSRTEPDPATS
>NZ_CP044407.1|WP_151014396.1|6619882_6621103_-|acetyl-CoA-C-acetyltransferase
MPEAVIVATARSPIGRAFKGSLKDIRPDDLTVQMINAAMAKVPQLQPSQIDDLLLGCGLPGGEQGYNMARVVSVLLGWDSVPGATITRYCSSSLQTTRMGLHAIKAGEADVIVSAGVETVSRFAKGNSDGLPDTKNPVFADAQARADKAAEGGAGVWHDPREDGLIPDVYIAMGQTAENLASMRGVTRQAQDEFGVRSQNLAEKAIANGFWEKDITPVTLPDGTVVAKDDGPRPGTTYEKVSQLKPTFRPDGTVTAGNCCPLNDGAAAVVIMSDTKAAELGITPLARVVSTGVTGLSPEIMGLGPVEASRQALARAGMTIDDIDLVEINEAFAAQVLPSAEDLGIDIDKLNVNGGAIAVGHPFGMTGARITSTLLNGLKFHDKQFGLETMCVGGGQGMAMVLERLS
>NZ_CP044407.1|WP_151018381.1|6631402_6631876_-|DUF1772-domain-containing-protein
MFGGAVFGFFYAWVCSTMWGLDDADPRVAIAAMQSMNASVRNAVFFPAFFLTPAVMALAAVLALRARRRAPAVLLAVAAAVYLGGGLLLTMLVNVPMNEDLAAVAVPASAEEARRVWADYSGRWQLFNQIRTVASGASLLLAAVALARLRRDGRPAT
>NZ_CP044407.1|WP_151014421.1|6632001_6632655_+|TetR/AcrR-family-transcriptional-regulator-C-terminal-domain-containing-protein
MAEQTGRRRGRLPAAERERRRAEVLDAALSVVTEQGYDRATMSDVAARAGASKETLYAWFGDREGLIAALIEANADASAARLVALVGDRDVTPGTARRALVAYATGLLTLLTGPSSVTLNRAAMASPSLARTLLSSGRHRIGPLVEDYLERLHAAGIVHAPDPGEAYRTLYGLVVRDTQIRVLLGEEAPTAAEIAEHAETAVTGFLALHAPGRPPSA
>NZ_CP044407.1|WP_151014423.1|6632662_6634699_-|hypothetical-protein
MSGYRYGAYEDGPDPLAPPYDVRGALDAVGDAVLDGTRPGDALRDLLRRGLPGRDGRGLDDLLRDVRERRRALRDRGRLDGTLEQARALLDTAIGQERAELFPDPSDDARLRETELDALPDDTSQAVRRLSNYEWKSGAARETFERLKDMLRSEVLDAQFQGMKQALQSQDPAQMQRVKDMMSALNAMLEKDARGEHTPEDFDRFMDDYGDFFPDRPENLEELVDALARRAAAMDRLLASLSPEQRAELAGLMDEAMKDAGLAMEMTRLGDSLRARRPDLGWGGAEPMTGEDPLGMGDATSALAELADLAELEAALGQEYPGARLDDIDEDAVRRALGRRAVDDLQALRRIEAELERQGYLRRNRGKLELTPKAVRRLGETALRRVFSQLASGRPGDHDQRDAGQAGELTGSSRPWRFGDEQPLDVVRTVSNAVRRSAMNGLSAPVAPAVPAEVADPAGGVRSDIVPGPRPVRLGVDDFEVHETERRTGAAVCLLVDLSYSMVLRGTWAAAKQTTLALHTLVTSKFPQDAIQIVGFSNYARTLQPTEMAGLDWDMVQGTNLHHALMIAGRHLDRHPDFEPIVLVVTDGEPTAHLRPDGRSLFDYPPSTETLVLTLAEVDKMTRRGAGMNFFMLADDRRLVSFVEEVARRNGGRVFAPDAQRLGEYVVSDYLRVRRGRR
>NZ_CP044407.1|WP_151014425.1|6634724_6636134_-|sigma-54-interacting-transcriptional-regulator
MRASTPRETTVGELRNSGHVQRPVKAEIRRNLLDRLRSGEPRFPGILGFDETVLPHLERALLAGHDLVLLGERGQGKTRLIRTLVGLLDEWTPVVAGCEINDHPYEPVCVRCRRLADELGDGLPVAWRHRDERYGEKLATPDTSVGDLIGDVDPIKVAEGRTLGDPETVHFGLVPRTNRGIFSINELPDLAERIQVALLNVLEERDVQIRGYALRLPLDVLLVASANPEDYTNRGRIITPLKDRFGAEIRTHYPLELDAELALIRQESDFADLGGVPAEVPDHLVEVIGRFTRLVRESTAVDGRSGVSARFALAGAETVAAGAVRRAALTGEDHAVARVCDLPAVVPALLGKVEFEVSEEGREQEVLEHLLRRAVAETYRRTLGAADLSGLLDKFDAGDSVESGELVAASELLRRVGQVPGLARMMERLGMSGESPGQAAAALEFALEGLFLTRRLSKDAADGTSTYRT
>NZ_CP044407.1|WP_151014427.1|6637288_6638452_+|FIST-C-terminal-domain-containing-protein
MARFGDGLAVGPDLSSAAVTAVEEALAPLSAAPDLVCVFISGEDPDEIEAAAHGAALAAGPAVMIGCSGAGVIGAGRGVEETGAVSAWAAVLPDARIDPFRLETLRSDDRLIVVGMPEGQDDDVVGVLLTDPYSFPVDAFVERSDDALPGLPLVGGLAEGSGPGTVRLFIDGEVHSDGAVGVVIGGSVAAATLVSQGARPIGPDMVVTRAEENVLYELAGTPALEKLEEIVVGLPDDEQEMAGRGLLIGVAMDEYADEHEHGDFLVRGVVGADTENGAIAIGDVVDVGRTVRFQVRDAGAAEEDLAALLERFDMAPVEGALLFSCNGRGKSMFPDSDHDAKVLDRAFGPAGVGGFFAAGEIGPVSGRNHVHGFTASILAFGRSGERA
>NZ_CP044407.1|WP_151014429.1|6638448_6639411_+|ROK-family-protein
MTDPAPPGGIVLAIDIGGTKLAAALVDGAGRVVAYDRVPTPNEPGRGAEDLWRALDALLDKVVAEGGGPAITGVGVGCGGPMTWPEGAVSPLNIPAWRGFPLRDRLRERHPGLPVRVHNDAICVAVGEHWRGAGRGRANVLGMVVSTGVGGGLVLGGRLVDGASGNAGHIGHVIVDPDGPPCGCGGRGCLEAVARGPGLVAWARERGWRPGEPGTGVELAADARDGAPVAVAAMRRAGRALGVAIASATHLCDLEVVAIGGGVSQAGPLVFEPLREAFDAHARMDFARPLEIVPAELGQPAGLVGAAALIFAPGRYWNAR
>NZ_CP044407.1|WP_151014431.1|6639565_6640375_+|winged-helix-turn-helix-domain-containing-protein
MVRFKVLGSLEITDHGRVCTLTAPKVRQVLALLLLRTGRLVQNESVVRELWGDAPPKSASTTVQTYIYQLRKALGRERSGSEPLSTQPCGYQMRIDPAELDACLFERYVAEGRRMLDGGRAEDASQRLRQALDLWTGPPLADVTQGPLLSAHAVHLQEQRIRALELRISADVQLDRGRDLIGELRSLVTRYPLHEWFHGQLIEALTRAGRRAEALQAYHNLRIRLDTELGLEPSPELQRLHYEVLVPAERARRSQHQRPVAMANGSSRG
>NZ_CP044407.1|WP_151014433.1|6640396_6641272_-|glucose-1-phosphate-thymidylyltransferase-RfbA
MKGVILAGGSGSRLQPATLVVSKQLLPVSDKPMIYYPLSVLMLAGIRDILIISTPDHLPLFRRLLGDGSRLGLRIDYAAQAEPRGLADAFLVGADHIGDDSVALVLGDNIFHGYSFSELLETAVADVQGCVLFGYPVTDPERYGVGEVDAAGRLLSIEEKPSRPRSNRAITGLYFYDNDVVDIARSLAPSPRGELEITDVNLAYLARGQATLVDLGRGFVWLDAGTPEALLAAGQYVRTIEERQGVRIACIEEIALRKGFIDADTCHRLGAEIANSSYGQYVMAIAKELVQ
>NZ_CP044407.1|WP_151014435.1|6641268_6642705_-|NDP-hexose-2,3-dehydratase-family-protein
MNAPRAVAPEPSLAERLAVSARHPGDAAPAEVRAWLAGTAARARMRVDRVPLEEVDGWSRDPVTGDLGHRSGRFFTITGLRVRDPDGPVPEWTQPIIDQPEVGVLGILVKEFDGVLHFLMQAKVEPGNHGGPQLSPTVQATHSNYTRVHQGSAVPYLDHFTDASRPRLVDVRQSEQGTRFLRKRNRNMVVEAAGDVEVLDGFRWLTLGQVHRLLEMDDVVNMDARTVLGCLPFTDGPAPHGGAAGRTAFGAALLRSCDPEAGALHPMPDLLSWITEARTASGMRAEPVPLAEADGWEAAGGAIAHRTGRFFSVIGVHVTAGAREVGRWGQPLVAPAGTGVIAFLAAPIDGVLHVLVRAAAEPGFVDVAELGPTVQCTPENHAHLPAAARPPFLDEVLAADPDRIRFGALLSEEGGRFHHARNRYLVVETRAGREPPGFRWAAVHQLGALVRHSHYLNVEARTLLACLHSLTSAPGGAR
>NZ_CP044407.1|WP_151018382.1|6642990_6643950_+|Gfo/Idh/MocA-family-oxidoreductase
MGVVGCADIAVRRMLPVMAGTDAVDLVAVAARDADRAAAVAARFGCAAEAGYEALLERDDIDAVYVPLPPALHHAWTRRALEAGKHVLAEKPLCVDAVQTAELVELARRRDLALVENFMFLHHSQHRAVRDLVEQGEIGTLRTLSSSFGIPPLDPGSYRYDPELGGGALLDVGVYPLRAAQLYLPGELAVLGACLRLDPATGVDVAGSVLLCSPDGVTAQLDFGFEHAYRSDCALWGDRGLLRVPRAFTPPEHHRPLVRIEQQDRVTELSLPPDHQVRNAIEAFAAAARSGGRRAGTAAPILRQAVLVERVRDAARIVE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_10

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_10

6972422-6972509

Orphan

Consensus_repeat	Method
GTTGCCGCGCTCGTCGTACCGCGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_10

>merge|NZ_CP044407|10|6972422-6972509|CRISPRCasFinder
GTTGCCGCGCTCGTCGTACCGCGCCCGGGTCGTGGCCCCGGACGGGTCGGTCAGGCTCGTGACGTTGCCGCGCTCGTCGTACTCGCGC

>NZ_CP044407|10|10|6972422-6972509|CRISPRCasFinder
GTTGCCGCGCTCGTCGTACCGCGCC	CGGGTCGTGGCCCCGGACGGGTCGGTCAGGCTCGTGAC
GTTGCCGCGCTCGTCGTACTCGCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151014895.1\|6969578_6970058_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151014907.1\|6974990_6975536_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151014916.1\|6978183_6978573_-\|NUDIX-domain-containing-protein	unknown	unknown	gnl\|CDD\|240030
NZ_CP044407.1\|WP_151014877.1\|6962745_6963903_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|319985
NZ_CP044407.1\|WP_151018411.1\|6959592_6960174_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151014892.1\|6968215_6969523_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225148
NZ_CP044407.1\|WP_151014904.1\|6974034_6974952_+\|RNA-polymerase-sigma-70-factor	unknown	unknown	gnl\|CDD\|132002
NZ_CP044407.1\|WP_151014922.1\|6979335_6980181_+\|PHP-domain-containing-protein	unknown	unknown	gnl\|CDD\|223686
NZ_CP044407.1\|WP_151014913.1\|6976605_6978153_+\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|224185
NZ_CP044407.1\|WP_151014871.1\|6958046_6959513_+\|leucyl-aminopeptidase-family-protein	unknown	unknown	gnl\|CDD\|238247
NZ_CP044407.1\|WP_151014925.1\|6980211_6980919_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293792
NZ_CP044407.1\|WP_151014883.1\|6966016_6966373_+\|twin-arginine-translocase-TatA/TatE-family-subunit	unknown	unknown	gnl\|CDD\|179287
NZ_CP044407.1\|WP_151014910.1\|6975576_6976518_+\|CoA-ester-lyase	unknown	unknown	gnl\|CDD\|225184
NZ_CP044407.1\|WP_151014880.1\|6964039_6965914_+\|trypsin-like-peptidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|273938
NZ_CP044407.1\|WP_151014874.1\|6960269_6960872_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|226607
NZ_CP044407.1\|WP_151014928.1\|6980968_6981904_+\|PD-(D/E)XK-nuclease-family-protein	unknown	unknown	gnl\|CDD\|378929
NZ_CP044407.1\|WP_151014919.1\|6978646_6979294_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151014901.1\|6973625_6973961_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223021
NZ_CP044407.1\|WP_151014889.1\|6967718_6968219_-\|DUF1003-domain-containing-protein	unknown	unknown	gnl\|CDD\|377629
NZ_CP044407.1\|WP_151014886.1\|6966517_6967657_-\|P-loop-NTPase	unknown	unknown	gnl\|CDD\|378455

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151014889.1\|6967718_6968219_-\|DUF1003-domain-containing-protein	gnl\|CDD\|377629	pfam06210, DUF1003, Protein of unknown function (DUF1003). This family consists of several hypothetical bacterial proteins of unknown function.	3.12834e-46
NZ_CP044407.1\|WP_151014928.1\|6980968_6981904_+\|PD-(D/E)XK-nuclease-family-protein	gnl\|CDD\|378929	pfam12705, PDDEXK_1, PD-(D/E)XK nuclease superfamily. Members of this family belong to the PD-(D/E)XK nuclease superfamily.	2.04716e-23
NZ_CP044407.1\|WP_151014916.1\|6978183_6978573_-\|NUDIX-domain-containing-protein	gnl\|CDD\|240030	cd04673, Nudix_Hydrolase_15, Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X. Enzymes belonging to this superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and contain a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V), which functions as a metal binding and catalytic site. Substrates of nudix hydrolases include intact and oxidatively damaged nucleoside triphosphates, dinucleoside polyphosphates, nucleotide-sugars and dinucleotide enzymes. These substrates are metabolites or cell signaling molecules that require regulation during different stages of the cell cycle or during periods of stress. In general, the role of the nudix hydrolase is to sanitize the nucleotide pools and to maintain cell viability, thereby serving as surveillance & "house-cleaning" enzymes. Substrate specificity is used to define families within the superfamily. Differences in substrate specificity are determined by the N-terminal extension or by residues in variable loop regions. Mechanistically, substrate hydrolysis occurs by a nucleophilic substitution reaction, with variation in the numbers and roles of divalent cations required.	3.48971e-36
NZ_CP044407.1\|WP_151014877.1\|6962745_6963903_+\|hypothetical-protein	gnl\|CDD\|319985	cd16327, RseB, RseB, a sensor in periplasmic stress. This family contains the periplasmic protein RseB (also known as MucB or Mucb/RseB) which exerts a crucial role in modulating the stability of RseA, the transmembrane anti-sigma-factor that is degraded during sigma-E-dependent transcription caused by bacterial envelope stress. RseB binds to RseA and inhibits its sequential cleavage, thereby functioning as a negative modulator of this response. The protein is composed of two domains, the larger N-terminal domain resembling an unclosed beta-barrel that is remarkably similar structurally to LolA and LolB, proteins capable of binding the lipid anchor of lipoproteins, suggesting that RseA acts as a sensor of periplasmic stress with a dual functionality, detecting mislocalized lipoproteins as well as propagating the signal to induce the sigma-E-response.	9.78164e-08
NZ_CP044407.1\|WP_151014892.1\|6968215_6969523_-\|CBS-domain-containing-protein	gnl\|CDD\|225148	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism].	4.49206e-48
NZ_CP044407.1\|WP_151014922.1\|6979335_6980181_+\|PHP-domain-containing-protein	gnl\|CDD\|223686	COG0613, COG0613, Predicted metal-dependent phosphoesterases (PHP family) [General function prediction only].	5.93491e-47
NZ_CP044407.1\|WP_151014913.1\|6976605_6978153_+\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|224185	COG1266, COG1266, Predicted metal-dependent membrane protease [General function prediction only].	1.7787e-17
NZ_CP044407.1\|WP_151014871.1\|6958046_6959513_+\|leucyl-aminopeptidase-family-protein	gnl\|CDD\|238247	cd00433, Peptidase_M17, Cytosol aminopeptidase family, N-terminal and catalytic domains. Family M17 contains zinc- and manganese-dependent exopeptidases ( EC 3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and play a key role in protein degradation and in the metabolism of biologically active peptides. They do not contain HEXXH motif (which is used as one of the signature patterns to group the peptidase families) in the metal-binding site. The two associated zinc ions and the active site are entirely enclosed within the C-terminal catalytic domain in leucine aminopeptidase. The enzyme is a hexamer, with the catalytic domains clustered around the three-fold axis, and the two trimers related to one another by a two-fold rotation. The N-terminal domain is structurally similar to the ADP-ribose binding Macro domain. This family includes proteins from bacteria, archaea, animals and plants.	6.30935e-168
NZ_CP044407.1\|WP_151014925.1\|6980211_6980919_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293792	cd06262, metallo-hydrolase-like_MBL-fold, mainly hydrolytic enzymes and related proteins which carry out various biological functions; MBL-fold metallohydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) for which this fold was named perform only a small fraction of the activities included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases which can catalyze the hydrolysis of a wide range of beta-lactam antibiotics, hydroxyacylglutathione hydrolases (also called glyoxalase II) which hydrolyze S-d-lactoylglutathione to d-lactate in the second step of the glycoxlase system, AHL lactonases which catalyze the hydrolysis and opening of the homoserine lactone rings of acyl homoserine lactones (AHLs), persulfide dioxygenase which catalyze the oxidation of glutathione persulfide to glutathione and persulfite in the mitochondria, flavodiiron proteins which catalyze the reduction of oxygen and/or nitric oxide to water or nitrous oxide respectively, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J which has both 5'-3' exoribonucleolytic and endonucleolytic activity and ribonuclease Z which catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors, cyclic nucleotide phosphodiesterases which decompose cyclic adenosine and guanosine 3', 5'-monophosphate (cAMP and cGMP) respectively, insecticide hydrolases, and proteins required for natural transformation competence. The diversity of biological roles is reflected in variations in the active site metallo-chemistry, for example classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, human persulfide dioxygenase ETHE1 is a mono-iron binding member of the superfamily; Arabidopsis thaliana hydroxyacylglutathione hydrolases incorporates iron, manganese, and zinc in its dinuclear metal binding site, and flavodiiron proteins contains a diiron site.	2.83536e-39
NZ_CP044407.1\|WP_151014904.1\|6974034_6974952_+\|RNA-polymerase-sigma-70-factor	gnl\|CDD\|132002	TIGR02957, putative_sigma_factor, RNA polymerase sigma-70 factor, TIGR02957 family. This group of sigma factors are members of the sigma-70 family (TIGR02937). They and appear by homology, tree building and bidirectional best hits, to represent a conserved family. This family is found in a limited number of bacterial lineages. This family includes apparent paralogous expansion in Streptomyces coelicolor A3(2), and multiple copies in Mycobacterium smegmatis MC2, Streptomyces avermitilis MA-4680 and Nocardia farcinica IFM10152.	6.08641e-113
NZ_CP044407.1\|WP_151014910.1\|6975576_6976518_+\|CoA-ester-lyase	gnl\|CDD\|225184	COG2301, CitE, Citrate lyase beta subunit [Carbohydrate transport and metabolism].	2.80565e-77
NZ_CP044407.1\|WP_151014880.1\|6964039_6965914_+\|trypsin-like-peptidase-domain-containing-protein	gnl\|CDD\|273938	TIGR02037, Probable_periplasmic_serine_protease_do/HhoA-like, periplasmic serine protease, Do/DeqQ family. This family consists of a set proteins various designated DegP, heat shock protein HtrA, and protease DO. The ortholog in Pseudomonas aeruginosa is designated MucD and is found in an operon that controls mucoid phenotype. This family also includes the DegQ (HhoA) paralog in E. coli which can rescue a DegP mutant, but not the smaller DegS paralog, which cannot. Members of this family are located in the periplasm and have separable functions as both protease and chaperone. Members have a trypsin domain and two copies of a PDZ domain. This protein protects bacteria from thermal and other stresses and may be important for the survival of bacterial pathogens.// The chaperone function is dominant at low temperatures, whereas the proteolytic activity is turned on at elevated temperatures. [Protein fate, Protein folding and stabilization, Protein fate, Degradation of proteins, peptides, and glycopeptides].	5.57483e-90
NZ_CP044407.1\|WP_151014874.1\|6960269_6960872_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|226607	COG4122, COG4122, Predicted O-methyltransferase [General function prediction only].	1.09684e-53
NZ_CP044407.1\|WP_151014901.1\|6973625_6973961_+\|hypothetical-protein	gnl\|CDD\|223021	PHA03247, PHA03247, large tegument protein UL36; Provisional.	0.00887553
NZ_CP044407.1\|WP_151014883.1\|6966016_6966373_+\|twin-arginine-translocase-TatA/TatE-family-subunit	gnl\|CDD\|179287	PRK01371, PRK01371, Sec-independent protein translocase protein TatB.	9.47284e-45
NZ_CP044407.1\|WP_151014886.1\|6966517_6967657_-\|P-loop-NTPase	gnl\|CDD\|378455	pfam10609, ParA, NUBPL iron-transfer P-loop NTPase. This family contains ATPases involved in plasmid partitioning. It also contains the cytosolic Fe-S cluster assembling factor NBP35 which is required for biogenesis and export of both ribosomal subunits.	8.11152e-130

>NZ_CP044407.1|WP_151014895.1|6969578_6970058_-|hypothetical-protein
MISGHDSVLVCAGPVAERVGGFVDALADASPSLLVAVDEGGFVPWDGRTRPPSGAAELLVARDAEMVDRWDRDGYHLDRDGHGTLMIAYEPCRAPRLDVTVLDDPYGRGGFLFDPYDVTLIGAGLSLVTVVTPDADGPFARSVLDGLAEHLAGAAPRGG
>NZ_CP044407.1|WP_151014892.1|6968215_6969523_-|CBS-domain-containing-protein
MSASPTRVFIARLAGIAVFDPVGDQVGRVRDVVVALRLAPRPPRVLGLVVEVQPRRPVFLPITRVTVIESDAIIFDGRLNIRRFQQRESETLAIAEMLDRTVRFRDTGEPVSVVDVAMEPTRTRDWLLSKVAVRRSTKRGLRRRGESLVVDWDAVEGFSAVEHGQGAAGLIAAFERSKPADLAGVVHELPEKRRAEVAEALDDERLADILEELPQDDQVEIIGTLPLERAADVLEAMDPDDAADLLGELPDEQRERLLTLMEPKEAAPVRRLLSYEDHSAGGLMTTDPVIVAPDATVAEALAQIRNPDLNPALAAQVYVCRPPTATPTGRYLGTVHFQRLLREPPRTLVSAVVDAELDPLRPGMTLEEVAMLLAAYNLVAQAVVDENGHLLGSVTIDDVLDHLLPEDWREAVMDADADGREPTSDPEEEALRGRT
>NZ_CP044407.1|WP_151014889.1|6967718_6968219_-|DUF1003-domain-containing-protein
MTTTTRLETTRLDQPRRYRRSLVPRPHYDPESFGRLSERIARFLGTARFLVYMTVFIIVWITWNWFAPPALRWDPYPFIFLTLILSLQASYAAPLILLAQNRQDDRDRVQYEQDRARTERTTADTEYLTREIAGLRVALSEVVTRDFLRSELQQVLRELDAKDPVR
>NZ_CP044407.1|WP_151014886.1|6966517_6967657_-|P-loop-NTPase
MASELTTEQVTAALATVNDPEIRKPITELDMVKSVDIAPDGSVRVGIFLTVAGCPMKETLTSNVTEAVSRLDGVTSVQVELDVMSDEQRKALQTKLRGGEPAKEIPFAQPNSLTKVYAVASGKGGVGKSSVTVNLAAALAAQGRKVGVVDADIYGHSIPRMLGVQHPPTKVEEMIMPPSAHDVKVISVGMFTAGNQPVVWRGPMLHRALQQFLADVYWGDLDVLLMDLPPGTGDIAISVAQLLPSAEILVVTTPQQAAAEVAERAGAIAAQTHQQVVGVIENMSYLACPHCGERQDIFGSGGGQTVADALTKTLGTRVPLLGQVQIDPRLREGGDEGRPLVLSDPDAGAAKELRTIADTLGGRSRGLAGMSLGISPKGR
>NZ_CP044407.1|WP_151014883.1|6966016_6966373_+|twin-arginine-translocase-TatA/TatE-family-subunit
MFDVGLGEMAVLVVLALVIFGDRLPQVAGQAGRMLRQVRQMANSARSDLQEGLGPEFKDFDIADLNPKTFVRKHLLEDDDDYTPVRANGKVFDDEPSYAGTAGELDYDERPPFDNEAT
>NZ_CP044407.1|WP_151014880.1|6964039_6965914_+|trypsin-like-peptidase-domain-containing-protein
MTEDNRGPFRASTEDDDAVPESERQEAATPPETVTDQEISLEQDDPTDDDPTDDDPAAGGPAASGADPSERAGAAGGPGGDRLVAGNAQNGFAPPDGPFGETAEDIPAQDAGSPRDPAAHGMPAAMGPQEVPLQDGSARDVPAPPSLDKRAPGEQPPPAPMDPPPAPDGPDARPRPGFVPYDQPPPAPGGMYGPGGWAQQQAHPGPPPGGPPPAGGPPPGGPPPAPMGPPPGGGPQAAFGAPAPNWAPVPAPPSTSRGGPGLGLLAVIALIVALVAGAVGAGVGVIATDGDEGSVSLGGGSSTAGGEAPNRPPDSVAGVAQRVLPSVVMIRVQSAQGEVGGTGFIVEGGYIITNNHVVSGGGTGGRIEVVFNDKKSLPATIKGSDPSTDIAVIKPEGNHELPALQLGDSARIAVGDPVIAIGSPLGLQGSVTTGIVSSLNRAVPVGEEGGGDSSYLNAIQTDAAINPGNSGGPLVDMKGRVIGINTAIATVGGQTMGGEQQGGNIGLGFAIPINQGKRIAEEIIANGQVRQALLGVLPDPRYQQGGARILPEPVQGQEPVTPNGPADKAGLKPGDVITRIDDRPIQDATDLIAQIRSRAPGDQVRVTYERGGQESTVTVTLGGS
>NZ_CP044407.1|WP_151014877.1|6962745_6963903_+|hypothetical-protein
MTAASSAAARRRRAVITGGIAGALALIVALTGDPVSARRVRSDPGAVGLLRAAADAARRLPYEGLRVLTTRSRDRSATSQVTVLHRPGEGIRYTSASGGSGYRPESAAGETTGFTSETLELLTRNYTVVRVADGARCGRAAHVVEARRSDGTLAGRFWLDAETGLMLHRELVDPSGRAVVSTGFTEISFAVPVPSGGTPPGGTSGGADGGADGVPARPLSRRGSSLTGTPEQPAATGGGTATATAGEPVDDASLAGLRAEGWPIPALLPGGLTLHDVRRGDGDLHLSYSDGLAAVSVFVQRGALDEGRMAGWDRSTRQGRTVFHRAELRRWAVSAGDGFVYTVLTDGPSATAESVARELPGGSGSAWARLGRGAHRLAAAANPFD
>NZ_CP044407.1|WP_151014874.1|6960269_6960872_-|class-I-SAM-dependent-methyltransferase
MEDFHPEDEPIRDARRRGEEVGASPIGPAGGAALRFLATLIGARTVVEVGSGCGVSGVYLMRGMPADAVLTSVDIEPENQRLAKQAYREAGLGSFRTRMISGPALEVLPRLTDGAYDMVFCDAVKQEYPEYLTAALRLLRPGGVVAFDNALWHHRVADPQVRDPVTEAIRDVHRMIADDEGLVPLLLPVGDGLLCAVKRD
>NZ_CP044407.1|WP_151018411.1|6959592_6960174_-|hypothetical-protein
MFAVRDRIGWRGLWRALALLVLFLASVGFVAGGVMRGGGAGSVVVIVLGAGGIVLFGWGLLASVGELTVRRPVLEFDAREVRRPARWPLPKRFGRTLPWDDVAALAAIRRGVTGARGGVRDHLVFLPTPELAELARTAERPALVALTLRDVPETAAAEPWAFPVEPGWDASLPEVVKQARRRRRIPVIDRRTK
>NZ_CP044407.1|WP_151014871.1|6958046_6959513_+|leucyl-aminopeptidase-family-protein
MPIETRVRAADGTVSGTAAELGAEVAAVPVRSGPDGPVAPAAEIAGLLPFGLDELLSLHRAKGEAGEITSAHVPVDGRVRELLLYGVGEARPADLRKAGAALARRGRGRTALVAGVPDGDLAAFAEGALLASYRFTLGTPSGPGPLGELVVLTEAGPAAGADALERGTARARAAARARDLANTPSGEKDPSWLADQAAAVAADAGLGIRVRDEKELAEGGFGGLLAVGAGSARPPRLIELTYVPDGTPDRHVVLVGKGITFDTGGLQLKPSAGMTTMKTDMAGGGTVIAVMGALRALGVRARVTGLVAAAENMPSGSAMRPGDVITHFGGRTSEVLNTDAEGRLVLADALAYAAAGLDADAVVDVATLTGAAKVALGLRHGALFASDDALAAALTTAGDAAGEPLWRLPLVDDYRAALDSDVADLANLGRGGYGAGAITAALFLREFAGDRPWAHLDIAGPGRATSDDAEITRGATGYGTRLLLEWLA
>NZ_CP044407.1|WP_151014901.1|6973625_6973961_+|hypothetical-protein
MTSIGSLVVVRPSGRRALPRPGFPRRPRPPAWSRPPPRPPLPGPPPPPPPPRFAARGGRKEGPAMVPNGGPAAPIPAPRPFRLPLENLGPMGCAPVVGPTGELERDVSRLK
>NZ_CP044407.1|WP_151014904.1|6974034_6974952_+|RNA-polymerase-sigma-70-factor
MAGTVRAADETFEEHRGLLFAVAYRMLGTAADSEDAVQDAWLRWSAADRSDVRDPRGYLVRITTNIALDRLRGARARRETYVGPWLPEPMLTAPDVADDAERAESVSMALLVVLETLSPLERAVFVLKEAFGYPYAEIAAALDRSEASVRQLGTRARRHVAARRPRFAAAGAERRAATDRFLDAVMGGDVNRLMEILAPDVTLWTDGGGKVRAALRPIVGAERVARFIGAVAGAPYAGVAAADMRMRRADVNGRPGLVIEGPERTISAVTVELDEAGRVEAIHMVSNPDKLGALDAGRELAVPRL
>NZ_CP044407.1|WP_151014907.1|6974990_6975536_-|hypothetical-protein
MGDPNATPPPPPEAVHALSAALVEEAAKKSGLLWLDLPGLPQPRAAWHVWHEGSAYVLTGGEGEQPLPGLPEADRVTVILRSKDKGGRLVAFVAACEHVEPGGELWDEVAPKLAKDRLNARAHAEQPARWAAESWVIRLTPTGEEIEPSGDYAHVRPVPSPATTAGPPPRLAGGKRRRADR
>NZ_CP044407.1|WP_151014910.1|6975576_6976518_+|CoA-ester-lyase
MRSRRTTLAVPGSNPRFIEKAQGLPADEIFLDLEDAVAPSAKQDARKSVVAALNEGDWTGKIRVVRVNDLDTPFAYRDVIEVVEGAGANIDAIMLPKVQDPSHVQWLDRLLTQIEGATGLEPGRIGIEAQIEDARGMTRIDDIAASSPRLETLVFGPGDFMASINMKTLVVGEQPPGYTEGDAYHYILMRILLAARAHDLQAVDGPYFNVRDADGFDRAARRSAALGFDGKWVLHPSQIDAGNAIFSPNQDDYDHAELILDAYDHAINVEGRGAAMLGDEMIDEASRKMALVIAAKGRAAGLARTRTFDPSGN
>NZ_CP044407.1|WP_151014913.1|6976605_6978153_+|CPBP-family-intramembrane-metalloprotease
MSDQEDANGWAPLDPDMGDGRARPPAPDAPPPGGPGGPDRPGERPEQGPAAPRQQQSTSPYGLPPQDGRPGARPQGGQEFPQQQQQWTSPYGLPQHGGGPYGGQAPDQAYPAGHHTGAQPAWDQNAWGGQYPQGYPQQYQYPPGYAHGYGPGYGGYPQPVKRPWIVPTPRGVPFHRMARSETHSWWRPLVGTLAIIVVGLGAGGVLAVIGLLVQMMVSDEDPALLDDPGTTSIFGNDTADIAYALGSLALFLPLIALAAWGIQRRRPGTLSSVAGRLRWRWMLACAGMSVVFCAVSFVLSMAAGATVENDPAGSTTEGSWVGWDDFLLPALVIVALVPFQSAAEEYFFRGWLMQAIGACTLEKARNGLARALSVVFRTPWPGIVVGAALFTSGHGYTGWGMLDIFVFGAIAGWLTVRTGGLECTIALHVFNNLMAFLLPAALGQLSLEQGGIPWQYVLADVTSMAVYAVGIVLLARRFKVRTVTPGDGPGDGPADDPGPDAPQRPGGVPGAQPAY
>NZ_CP044407.1|WP_151014916.1|6978183_6978573_-|NUDIX-domain-containing-protein
MRERCVGAIVHDRGGRLLLVRRGRPPGAGLWSVPGGRVEPGEDDAAAVARELLEETGLRVRAGALVGTVERDGPGGVVYEIHDYAATVLGGTPRAGDDAADVRWVAPAELRDLPLVPGLLDALTEWGVL
>NZ_CP044407.1|WP_151014919.1|6978646_6979294_+|hypothetical-protein
MRAEPTCPRCGAQVQAPGLWSSDWSCGVHGAVLPRQPPVRPGPDALGIVLRDVRVPVWTPWPLPLNWLVTGFLTVGDERGGARACAVAVSGPGLLGGLADMLLIAEEPGVGLGAHYAGLAGPDPGREFDGDPPHAKIGISGPAATSGHTVPLWTVGREPDRAVFVGEALGNWLWVVLWPADAGVLMLEELNLLDLREPGMDVDLPYGAHSGKLDL
>NZ_CP044407.1|WP_151014922.1|6979335_6980181_+|PHP-domain-containing-protein
MVIDLHVHSDASDGTRPPAEVMRRARENGVDVVALTDHDTTAGWDAAAAALPDGLTLVRGIELSCVQDGRSLHMLGYLFDPAEPVLAAELARIRDDRVIRARTMVGLLRDLGVDVTWERVRELARGEAVGRPHIAQAMIEAGAVATHDEAFTPDWIAEGGRAHADRYALDPERAIALVRAAGGVCVLAHPRPSRRTYVFPDEVIERLAAAGLAGVEVDHPDHAPDDRAHLRDLAAALGLAGTGSSDDHGAPTGDRIGAESTDPAAYEALVGAARGTVSPLP
>NZ_CP044407.1|WP_151014925.1|6980211_6980919_+|MBL-fold-metallo-hydrolase
MDARIEQVVTSGKLTLDDTEYDVENNTYVIGDDEEVIVIDPAFDAEAILEKVGEREVMAVLLTDGHEHRLAVVLEVAAAGEEDEENWAPIALHRADRQLWRDYFGRLAKEEEDEDDAKALRSLEPDIWLEDGGVFEIADAQLEIVHTPGHTLGAVCVISEQLGVLFSGDTLHRGRPGSVGGAFEDLRKQLNSIGALLDPLPRDLQVMPAQGDETTAGEENARWESWGDMAREDND
>NZ_CP044407.1|WP_151014928.1|6980968_6981904_+|PD-(D/E)XK-nuclease-family-protein
MEQLGFEGMPERLYSCTPSRLNTWLDCPRRYRMTYLDRPMPPKGPPWAHNSVGASVHNALAAWWRLPEPERTPAAAGTLLVRGWITEGFRDAAQSAAHRDRARDMTERYVAGLDPSDEPVGVERTVATRTARIAVSGRIDRLDRRGGELVVVDYKTGRRPLTPDDARGSLALAIYAVAASRVLRRPCRRVELHHLPSGEVAAWDHTGASLDRHLGRAEDIAAEASAADDSYRERVPKPRRGDSGPPRRGDAGPPRRGDAARSGPVDHAPFDERFPARPGPLCAWCDFARHCPEGRAAAPRKEPWSALPVEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_11

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_11

7129694-7129825

Orphan

Consensus_repeat	Method
GGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_11

>merge|NZ_CP044407|11|7129694-7129825|CRISPRCasFinder
GGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGACGTGTTTGCCTGCATCGCCCTCGGCGTCAGGCCCTGGGGGGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC

>NZ_CP044407|11|11|7129694-7129825|CRISPRCasFinder
GGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC	GTGTTTGCCTGCATCGCCCTCGGCGTCAGGCCCTGGGG
GGCCTTCCTTCAACGGGCGCTGCGTGCGATTGCTGCATCGCTCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151015193.1\|7137033_7138305_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|224567
NZ_CP044407.1\|WP_151018424.1\|7127869_7128307_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151015175.1\|7126243_7126513_-\|WhiB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|376791
NZ_CP044407.1\|WP_151015167.1\|7120202_7121198_+\|biotin-synthase-BioB	unknown	unknown	gnl\|CDD\|235755
NZ_CP044407.1\|WP_151015197.1\|7139277_7140111_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472
NZ_CP044407.1\|WP_151015187.1\|7133119_7133908_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235794
NZ_CP044407.1\|WP_151018425.1\|7135228_7136158_+\|alpha/beta-hydrolase-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|369561
NZ_CP044407.1\|WP_151015177.1\|7126810_7127749_-\|diacylglycerol-kinase-family-lipid-kinase	unknown	unknown	gnl\|CDD\|224513
NZ_CP044407.1\|WP_151015173.1\|7123122_7124358_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|235655
NZ_CP044407.1\|WP_151015195.1\|7138312_7139281_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224096
NZ_CP044407.1\|WP_151015185.1\|7132097_7133123_+\|DUF4432-family-protein	unknown	unknown	gnl\|CDD\|379620
NZ_CP044407.1\|WP_151015183.1\|7131336_7132098_+\|phytanoyl-CoA-dioxygenase-family-protein	unknown	unknown	gnl\|CDD\|368580
NZ_CP044407.1\|WP_151015179.1\|7129153_7129582_-\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|235217
NZ_CP044407.1\|WP_151015181.1\|7130322_7131237_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP044407.1\|WP_151015191.1\|7136192_7136897_+\|FCD-domain-containing-protein	unknown	unknown	gnl\|CDD\|225097
NZ_CP044407.1\|WP_151018423.1\|7122278_7123010_-\|UTRA-domain-containing-protein	unknown	unknown	gnl\|CDD\|225099
NZ_CP044407.1\|WP_151015169.1\|7121209_7121479_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151015171.1\|7121480_7122191_-\|Uma2-family-endonuclease	unknown	unknown	gnl\|CDD\|99749
NZ_CP044407.1\|WP_151015189.1\|7133965_7135144_+\|DUF5005-domain-containing-protein	unknown	unknown	gnl\|CDD\|293005
NZ_CP044407.1\|WP_148351607.1\|7128344_7129103_-\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|274373

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151015193.1\|7137033_7138305_+\|extracellular-solute-binding-protein	gnl\|CDD\|224567	COG1653, UgpB, ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism].	6.2794e-35
NZ_CP044407.1\|WP_151015175.1\|7126243_7126513_-\|WhiB-family-transcriptional-regulator	gnl\|CDD\|376791	pfam02467, Whib, Transcription factor WhiB. WhiB is a putative transcription factor in Actinobacteria, required for differentiation and sporulation.	1.11141e-26
NZ_CP044407.1\|WP_151015167.1\|7120202_7121198_+\|biotin-synthase-BioB	gnl\|CDD\|235755	PRK06256, PRK06256, biotin synthase; Validated.	0
NZ_CP044407.1\|WP_151015197.1\|7139277_7140111_+\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	2.23761e-57
NZ_CP044407.1\|WP_151015187.1\|7133119_7133908_+\|SDR-family-oxidoreductase	gnl\|CDD\|235794	PRK06398, PRK06398, aldose dehydrogenase; Validated.	6.70531e-80
NZ_CP044407.1\|WP_151018425.1\|7135228_7136158_+\|alpha/beta-hydrolase-fold-domain-containing-protein	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.89933e-79
NZ_CP044407.1\|WP_151015177.1\|7126810_7127749_-\|diacylglycerol-kinase-family-lipid-kinase	gnl\|CDD\|224513	COG1597, LCB5, Sphingosine kinase and enzymes related to eukaryotic diacylglycerol kinase [Lipid metabolism / General function prediction only].	2.26639e-46
NZ_CP044407.1\|WP_151015173.1\|7123122_7124358_-\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|235655	PRK05958, PRK05958, 8-amino-7-oxononanoate synthase; Reviewed.	1.73205e-148
NZ_CP044407.1\|WP_151015195.1\|7138312_7139281_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	4.44939e-82
NZ_CP044407.1\|WP_151015185.1\|7132097_7133123_+\|DUF4432-family-protein	gnl\|CDD\|379620	pfam14486, DUF4432, Domain of unknown function (DUF4432).	1.38756e-24
NZ_CP044407.1\|WP_151018423.1\|7122278_7123010_-\|UTRA-domain-containing-protein	gnl\|CDD\|225099	COG2188, PhnF, Transcriptional regulators [Transcription].	1.27637e-78
NZ_CP044407.1\|WP_151015179.1\|7129153_7129582_-\|anti-sigma-factor	gnl\|CDD\|235217	PRK04069, PRK04069, serine-protein kinase RsbW; Provisional.	1.40274e-13
NZ_CP044407.1\|WP_151015181.1\|7130322_7131237_-\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	9.84547e-82
NZ_CP044407.1\|WP_151015191.1\|7136192_7136897_+\|FCD-domain-containing-protein	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	4.85256e-41
NZ_CP044407.1\|WP_151015183.1\|7131336_7132098_+\|phytanoyl-CoA-dioxygenase-family-protein	gnl\|CDD\|368580	pfam05721, PhyH, Phytanoyl-CoA dioxygenase (PhyH). This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins, ectoine hydroxylases and a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalyzing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterized by the accumulation of phytanic acid in plasma and tissues.	3.16052e-34
NZ_CP044407.1\|WP_151015171.1\|7121480_7122191_-\|Uma2-family-endonuclease	gnl\|CDD\|99749	cd06260, DUF820, Domain of unknown function (DUF820). This family consists of hypothetical proteins that are greatly expanded in cyanobacteria. The proteins are found sporadically in other bacteria. They have been predicted to belong to the PD-(D/E)xK superfamily of nucleases.	8.01143e-09
NZ_CP044407.1\|WP_151015189.1\|7133965_7135144_+\|DUF5005-domain-containing-protein	gnl\|CDD\|293005	pfam16396, DUF5005, Domain of unknown function (DUF5005). This small family of proteins is functionally uncharacterized. This family is found in bacteroides. Proteins in this family are typically around 440 amino acids in length.	1.68827e-11
NZ_CP044407.1\|WP_148351607.1\|7128344_7129103_-\|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor	gnl\|CDD\|274373	TIGR02980, SigBFG, RNA polymerase sigma-70 factor, sigma-B/F/G subfamily. This group of similar sigma-70 factors includes clades found in Bacilli (including the sporulation factors SigF:TIGR02885 and SigG:TIGR02850 as well as SigB:TIGR02941), and the high GC gram positive bacteria (Actinobacteria) where a variable number of them are found depending on the lineage.	1.94829e-117

>NZ_CP044407.1|WP_151015179.1|7129153_7129582_-|anti-sigma-factor
MTEETAAMPASTKLSVRDVVTVKLPAASAYLSVLRTATAGLAARLDFTLDEIEDLRIAVDEACAMLLAQAVPGTDLSCEFELTGEAMRISVSVLTVDGVEPSRDTFAWTVLSSLAGEVDARAGTDDRVTVTLQKRRGAGGTQ
>NZ_CP044407.1|WP_148351607.1|7128344_7129103_-|SigB/SigF/SigG-family-RNA-polymerase-sigma-factor
MPDRARARALFERLAELPDGDPERQRIRDQLVELHLPLVEYLARRFRNRGEWLDDLIQVATIGLIKSIDRFDLERGVEFSTYATPTIVGEIKRHFRDKGWAVRVPRRLQELKLSLTKAISDLAQREGRAPTVSELAAHLQMSEEEVLEGLESANAYSTVSLDAPDSGDEDAPAVADSLGMVDESLEGVEYRESLKPLLEKLPAREKKILLLRFFGNMTQSQIAAELGISQMHVSRLLARTLAQLREGLTADE
>NZ_CP044407.1|WP_151018424.1|7127869_7128307_+|hypothetical-protein
MSAARPATVSAAAGLEAVEGLAAVGYGAYVGVETAIGDPVDPMSAIGVTVLALAGGIGMLACARGLLRADQWSRAPTVLTQLFALPVAWSLWQSEQFALGLPLGIVAVLTLIAVLSPPSTAWLITDHDEDEQDERDELADGPAGK
>NZ_CP044407.1|WP_151015177.1|7126810_7127749_-|diacylglycerol-kinase-family-lipid-kinase
MRAMLIANPKATSTSRRARELLVRACAGDLDLVIAETRHRGHAVELARDAATDGYDLVIALGGDGTVNEAVNGLLSSGAAEPPALAVLPCGSANVFARALGLPDDPISATRVVLEALRAGRYRTVGLGAARPGDGPERYFTFCAGVGLDAEVVREVERHRGSGRRADPSLYVRTAVRHFFTGTERRRAALTLEQPGRPPKSGLFLAFISNTSPWTFVGRIPVNPSPLAHFARGLDVFAIRSLRVGPTLAAVAGMLLARTRPVQGRDVVNVHDAAEVTVRAERPVAFQLDGDYLGEHRSVTFRSVPKAIRIVI
>NZ_CP044407.1|WP_151015175.1|7126243_7126513_-|WhiB-family-transcriptional-regulator
MDWRHRAACRDVDPELFFPIGNTGPAILQIEEAKQVCRRCDVTDACLRWALESGQDSGVWGGMGEDERRALKRRAARARTRAGVGLQHR
>NZ_CP044407.1|WP_151015173.1|7123122_7124358_-|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MTERTEGTRPNSPGSAGDPLPPDAGAAAPDPLARLRDAAARRHAAGLRRTLRPRTRDLIDLASNDYLGLSGDPRLAAGAAAAARAFGTCSTGSRLVTGTTELHTELDRRLAAFTGAAAGLVFSSGFLANLGAVTALSGPDVLVVSDQTNHASIVDACRLSRSRVAIVPHRDTAAVAEALAERDEDHAIVVTDAVFSVDGDIAPLAELHALVQSHGALLVIDEAHALGVVGTGGRGAAHAAGLAGEPDVVRTLTLSKSLASQGGAVLGAPEVIDALVDTARSFIFDTGLNPPAVGAALAALDVLESDPGLPARARAVAARMTALAAGSGLETAEPAAAVVPVYLGEPHAALRGAEICADHGVRVGCFRPPSVPKGRACLRLTARATVNESDLTNLGSALAEIARATGRSLHA
>NZ_CP044407.1|WP_151018423.1|7122278_7123010_-|UTRA-domain-containing-protein
MGRHHSSHAPRIPKYYKLKELLVELIQSLPPGSPLPPERALAEKYETSRTTVRQALAELVVEGRLQRIQGKGTFVAKPKVAQELQLVSYTEDMRHHGLRPETRILEAGYVSADEHLAALLGIRPGGRVLRVHRLRLADGEAMSIDTSHLPARRFPGLRRELSRHHSLYETLATAYDVHLTEAEETIETVLATPHDAQLLGVDVGLPMLLLSRHAFDTTGQPVEWAQSLYRGDRYKFITRLRRH
>NZ_CP044407.1|WP_151015171.1|7121480_7122191_-|Uma2-family-endonuclease
MDGSRIVRERPRDVSVTPEVHMSDLPDTPYNLWVRGELDDYVDAPEGSRIEVIEGEVVVSPAPTVAHGTPLRHITRALERAAFDDPDFPWVAQQVAELDLVGLGQIFIPDLVITTEEILHAVSDADLPRLMSDEIEMAVEVTSRNGKGDDLPPPRTDHRKQEKKPNKWTGYARTEIPYYLVVDRSPKMARTTLYSIPDQATAAYLHEESWEFGETIHLPDPFGIDIDTTHWKPWRD
>NZ_CP044407.1|WP_151015169.1|7121209_7121479_-|hypothetical-protein
MPYHVVHHDYEIELPEDPFDLWCKDELWKYIGVEKGAKIEVIGGEIRVQGAPMSSGIGSDVHPLQQIRDMEARMEKMIVELSTRRAVDE
>NZ_CP044407.1|WP_151015167.1|7120202_7121198_+|biotin-synthase-BioB
MSDILETARRQVLEEGEGLSADQVLECLTLPDDRLEELLALAHEVRMRWCGPEVEVEGIVSLKTGGCPEDCHFCSQSGKFESPVRSVWLNIPELVEAAKETAKTGATEFCIVAAVRGPDERLMSQVRDGVKAINDAVEINIACSLGMLTQEQVDELTAMGVHRYNHNLETARSHFASVVTTHSWEERWDTLRMVKEAGMEVCCGGIIGMGETVEQRAEFAAQLAELEPDEVPLNFLAPRPGTPFSDLPLVEGPDALRTIAAFRLALPRTILRYAGGRELTLGDLGTREGMLGGINAIIVGNYLTTLGRPAEKDLDLLTDLQMPIKALTQTL
>NZ_CP044407.1|WP_151015181.1|7130322_7131237_-|sugar-kinase
MQNIRVALIGECMIELSHLAPDRLALGYAGDAFNVAAYLARSAPVDVEFVTAVGDDPYSAQMQAAWAARNVGSAHTRVIPGARPGLYLIRTDDRGERTFHYYRSQSAARALFGPDQPDTVDDALAGHDLVYLSGITLSILTPHARTRLLAVLDETRRRGGRIAFDGNYRPAGWPSPDIAAAAMSAVLSRTDIALPTFDDERAVFGDRTPADTVRRLRAAGCTEIAVKLGPRGSLIADADTTVPIPARTVPNVVDTTAAGDSYNGAYLAARLTGATRAEAAESATTLAARVITHQGALLPEPTRT
>NZ_CP044407.1|WP_151015183.1|7131336_7132098_+|phytanoyl-CoA-dioxygenase-family-protein
MDPMQRYETDGYAIFRNVLDAELVAEADAHVRWLQERHPGRSGEDLSTELVAEDPFWVRLVSDERLLDVAQRFVGPDIALFASAYISKPPHTGKAVLWHQDGSFWPLEPMRVVTLWLAVDRSTPENGCLRVIPGSHRSGLHEVRERDDAGAVFGVESARDVDESAAVDLVLEPGDVEVHHPNIMHGSNANESPHRRCGLTIRYIPTSTRITAEPSPFPSALHLRGEPGVNEYRARPAYVAGEHFPFRGAESWA
>NZ_CP044407.1|WP_151015185.1|7132097_7133123_+|DUF4432-family-protein
MRRNWGARVHEVTLAGLRAFVLEDRLLRVTVLAGKGGDVVEFLHKPRDMDFVWWSPGGLRNPRDAGGAAGDDVAAFLDAYEGGWQEVLPNGGAPSVYRGARFAQHGEVAGLPWDAEIVTDDVREVAVRLSVRARRSPLRVVKTFRLVDGELIVEEELTNESDVDVDAMWGHHIVFGAPFLKPGHRIRVPDGARVVPHGAPIGPGGRRVRAGGPYRWPHVPADGGGTVDLSVVPAKGEPSEIVYLTDLDEGRYEVVDPADGLGLRVRWDASVLPHLWLWQELGATVDHPWWGRAYAVGLEPFAGYPTDGLAAAVDNGTALHLGPRAVRRSWLRAGVIEGSTG
>NZ_CP044407.1|WP_151015187.1|7133119_7133908_+|SDR-family-oxidoreductase
MSEFEGKVALVTGGSLGIGRAVVERLAGDGAAVVFSGIEGVREAEEELRAAGRAVTGAVADVRDAERADALVRTAVHEYGGLDIVVTSAGVQRYGTVEDTSEETWDEVLDVNVKGVFLACRAAVPELRRRGGGTIVTVSSVQAFVSQAGVAAYSASKAAINALTRAMALDHAADGIRANAVCPGSVDTPMLRWAADLFGGGSQDAQVAEWGRAHPLGRVARPEEVAEVVAFLAGPRSSFVTGAEHRVDGGLLARNPAALPEN
>NZ_CP044407.1|WP_151015189.1|7133965_7135144_+|DUF5005-domain-containing-protein
MSRSALALALTAGLVVVPAAPAAAQAAPVCAGRPAPTFGTATQNTAQNAKFTTYGNSNARLDDWTGADTTYSLRLSDGRIVYAYSDTFLGKVNADGSRPPVIEEGGTTPFLNNSFVVQGTNGSLRTVHGGTAANPTAPMPPSQAAHWYWAGDLTQHASEVQQLYREYYDPDPGNGDPWDLKWKRNVLARFSTGNLSGPMTVNAMPSATGVQWGSALLEDGGHTYIYGTEDYTDPDTKQNTKYLHIARVDGDDLRGDWSYRTAGGWSSEEADSARLMSGVSNEFSVTKRGAHYIMVNQDTEFAFGAEIDVLLSCSAGGPFTAEQAVYTTPETGSWPDVYTYNAHQHASLSSSGNLVISYNVNTLDNAEDDGVNDNYRYVSIYRARYIDLPVTG
>NZ_CP044407.1|WP_151018425.1|7135228_7136158_+|alpha/beta-hydrolase-fold-domain-containing-protein
MPPGLDADLAAVLAGAPHVGLADPAKARAAMRDLVAALGEPERDHRVEVTGRTVAGGVPVRIYRPVRVTGPAPVLVYFHGGGFVTGDPENEHGRCLAFAGDGGIAVVSVDYRLAPEHPFPAGLDDCYAACAWAHAHASGFGGDPARVAVGGGSAGGALAAAVALRARDEGGPPLAFQMLLYPVLDDRMDTPSMRACTEPPLFNRTDAAHMWRHYLGGRPATPYAAPARARDLAGLPPAYVLAAEFDPLRDEALEYGRRLIGAGVPTELRHMAGVCHGFDGVASADSARRARAEQRDVLVRNLWTRQQIK
>NZ_CP044407.1|WP_151015191.1|7136192_7136897_+|FCD-domain-containing-protein
MAQDVARPSLADALTERMLELIRADGLRPGDRLPSARELSQRFAVTTPTLREALRRLEATGAVQLRHGSGIYVGADLERVVIPNPNAGALDGERVLHLLDARLLIEPPLAAQAARRSAPDDLGRLRTVLDEAGRNLDGDVPDAEARLHEANMAFHRATAGVAGNSVLCEVIDSLLKVHASEQREIQRIFDDRTRDYEEHRAILGAIERGAAGEAEDLMRAHLADVKNVIERRLG
>NZ_CP044407.1|WP_151015193.1|7137033_7138305_+|extracellular-solute-binding-protein
MVSSPRLRVTALAAGALLLAAGCGSGGGSGDPNHLKLYNDKGAWKPYFEQMAKLGEQSTGMSMEPVGYTDEPAYTAFIKSSFRTNVKPDLFTWTTGERLREIVEQDQVAETTGIWTQGIKAGDLTEQLRQYYTIDGKQYCVPLNTAYWGMFYSKKVFKEHDLEPPETWDELMDAAAKLKAAGQVPFHQTTPTSLFSFVWFEQLLAGTDPELYDRLSKGEASYTDPGVVAVMEQWKGLIDKGYLTEPGDKSDPADHFKSGDAAMVMSGTWFNTSMTQRDLELGDDYGFFLVPNVNPDLPKRSLIFESGPLCSLKKAPSPESSEKYLTWWTTAEAQEKWANARGDVSANPKVKIADPDLDAVAKKATGDGNRLVLRYFEATPSPVLTEALSAFDKFLNEPGSYMEVLQTIQKANDRYWKQQKAGS
>NZ_CP044407.1|WP_151015195.1|7138312_7139281_+|ABC-transporter-permease-subunit
MTTHHATAERPVKASARGAGPSGGRRRPGGPGTGFALYGRFRHLYVSPAVLFVAVLLYLPFLWTVYLSFTSYDGLASPEFTGIDNYRRLLQDDALLVSIRNTLLWVAGTVVLPVGLGLLVAVLSYNIKGGAWFRLPFLLPYAMSGAGLGVIWGFILQPDGMANQLLTFLGMPGGDTAFLQDGPLNTVAMIVVWTWQQLGVNMLLFVVGLQSIPKAPIEAARIDGASGWSMFRHVIWPLMRPITTVVFGLALVASLKTFDIVWVMTQGGPGRSSETLAVTMYRDVFVANEYGYGSAVAVLLTTVTGLASYIYLRHQVGKEDRG
>NZ_CP044407.1|WP_151015197.1|7139277_7140111_+|ABC-transporter-permease-subunit
MNTRLLTGTVRRAILVVLGLAWLFPTYLVVAGAIRPAGDYDPSDAVAPPTSVGLFDNIAQAWERTDVGSTLLSTLLYSLVAPAVAVLLGALAGYAIVVLRLRHGFLWFVVIFAGTVVPFQMLLIPLFVGYSRVSMYDSQAGLIIVYTAISVPLAALVMRNFFGGVARSIFEAARLDGASTFRIFWRIYLPLSSAALAAVFILEFTYVWNDLLFGLTLSQSENVRPVWAELSALTTDVYAGTPVPIALAAGLVVSLPTVVLFLATQRLFTRGLTLAQF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_12

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_12

7596724-7596995

Orphan

Consensus_repeat	Method
CGGCGCGGACGGCGCGGACGGCGTGG	CRISPRCasFinder

4 spacers

WYL

The CRISPR arrays of NZ_CP044407_12

>merge|NZ_CP044407|12|7596724-7596995|CRISPRCasFinder
GATCTCGGGCGGCGTGGGCTGCGTGGAACTGCGCCGCCCGATGCGGACCTGCTCGGCCGACAGCGGGATCCGGCGCCGCGGCGCGTACGGCGGGAACACCAGGGAGCCCGAGTCGGGCCCCTCCTCGGCGAGGACGGCGTTGAAGTACTCGCGGTCGGCCTCGACGACGGCCGTCCACTCGGCCTGCGAAGGCACCCCGGACGACGGCAGCGGCGCGGACGGCGCGGACGGCGTGGACGGCGCGGACGGCGTGGACGGCGTGGACGGCGCGG

>NZ_CP044407|12|12|7596724-7596995|CRISPRCasFinder
GATCTCGGGCGGCGTGGGCTGCGTGG	AACTGCGCCGCCCGATGCGGACCTGCTCGGCCGACAGCGGGATCCGGCGCCG
CGGCGCGTACGGCGGGAACACCAGGG	AGCCCGAGTCGGGCCCCTCCT
CGGCGAGGACGGCGTTGAAGTACTCG	CGGTCGGCCTCGACGACGGCCGTCCACTCGGCCTGCGAAGGCACCCCGGA
CGACGGCAGCGGCGCGGACGGCGCGG	ACGGCGTGGACGGCGCGGA
CGGCGTGGACGGCGTGGACGGCGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151018458.1\|7588262_7589066_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224098
NZ_CP044407.1\|WP_151015976.1\|7609063_7610329_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270306
NZ_CP044407.1\|WP_151018459.1\|7589079_7590489_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|274522
NZ_CP044407.1\|WP_151018460.1\|7591017_7591521_-\|PH-domain-containing-protein	unknown	unknown	gnl\|CDD\|367615
NZ_CP044407.1\|WP_151015972.1\|7606349_7607957_-\|PucR-family-transcriptional-regulator-ligand-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|377939
NZ_CP044407.1\|WP_151018461.1\|7591852_7592470_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151018457.1\|7586023_7587142_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270308
NZ_CP044407.1\|WP_151015962.1\|7599968_7602404_-\|protein-kinase	unknown	unknown	gnl\|CDD\|319004
NZ_CP044407.1\|WP_151015964.1\|7602466_7603699_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151015956.1\|7593959_7594928_-\|transporter-substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|270408
NZ_CP044407.1\|WP_151015960.1\|7597325_7598672_-\|VWA-domain-containing-protein	unknown	unknown	gnl\|CDD\|238738
NZ_CP044407.1\|WP_151015970.1\|7605493_7606339_+\|TrmB-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224296
NZ_CP044407.1\|WP_151018463.1\|7598668_7599829_-\|protein-phosphatase-2C-domain-containing-protein	unknown	unknown	gnl\|CDD\|223704
NZ_CP044407.1\|WP_151015968.1\|7604797_7605457_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|372616
NZ_CP044407.1\|WP_151015952.1\|7587351_7588176_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224097
NZ_CP044407.1\|WP_151015974.1\|7608252_7608606_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151015954.1\|7592444_7593764_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP044407.1\|WP_151015950.1\|7584809_7585988_+\|polyamine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|226361
NZ_CP044407.1\|WP_151018462.1\|7594939_7596361_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151015966.1\|7603864_7604395_+\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151018458.1\|7588262_7589066_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224098	COG1177, PotC, ABC-type spermidine/putrescine transport system, permease component II [Amino acid transport and metabolism].	1.25924e-71
NZ_CP044407.1\|WP_151015976.1\|7609063_7610329_+\|extracellular-solute-binding-protein	gnl\|CDD\|270306	cd13588, PBP2_polyamine_1, The periplasmic-binding component of an uncharacterized ABC transporter involved in uptake of polyamines; contains the type 2 periplasmic binding fold. This group represents the periplasmic binding domain that functions as the primary high-affinity receptor of an uncharactertized ABC-type polyamine transport system. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.2997e-92
NZ_CP044407.1\|WP_151018459.1\|7589079_7590489_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|274522	TIGR03329, Phn_aa_oxid, putative aminophosphonate oxidoreductase. This clade of sequences are members of the pfam01266 family of FAD-dependent oxidoreductases. Characterized proteins within this family include glycerol-3-phosphate dehydrogenase (1.1.99.5), sarcosine oxidase beta subunit (1.5.3.1) and a number of deaminating amino acid oxidases (1.4.-.-). These genes have been consistently observed in a genomic context including genes for the import and catabolism of 2-aminoethylphosphonate (AEP). If the substrate of this oxidoreductase is AEP itself, then it is probably acting in the manner of a deaminating oxidase, resulting in the same product (phosphonoacetaldehyde) as the transaminase PhnW (TIGR02326), but releasing ammonia instead of coupling to pyruvate:alanine. Alternatively, it is reasonable to suppose that the various ABC cassette transporters which are also associated with these loci allow the import of phosphonates closely related to AEP which may not be substrates for PhnW.	2.83336e-64
NZ_CP044407.1\|WP_151018460.1\|7591017_7591521_-\|PH-domain-containing-protein	gnl\|CDD\|367615	pfam03703, bPH_2, Bacterial PH domain. Domain found in uncharacterized family of membrane proteins. 1-3 copies found in each protein, with each copy flanked by transmembrane helices. Members of this family have a PH domain like structure.	6.00596e-09
NZ_CP044407.1\|WP_151015972.1\|7606349_7607957_-\|PucR-family-transcriptional-regulator-ligand-binding-domain-containing-protein	gnl\|CDD\|377939	pfam07905, PucR, Purine catabolism regulatory protein-like family. The bacterial proteins found in this family are similar to the purine catabolism regulatory protein expressed by Bacillus subtilis (PucR). PucR is thought to be a transcriptional activator involved in the induction of the purine degradation pathway, and may contain a LysR-like DNA-binding domain. It is similar to LysR-type regulators in that it represses its own expression. The other members of this family are also annotated as being putative regulatory proteins.	4.13119e-40
NZ_CP044407.1\|WP_151018457.1\|7586023_7587142_+\|extracellular-solute-binding-protein	gnl\|CDD\|270308	cd13590, PBP2_PotD_PotF_like, The periplasmic-binding component of ABC transporters involved in uptake of polyamines; possess the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain that functions as the primary high-affinity receptors of ABC-type polyamine transport systems. Polyamine transport plays an essential role in the regulation of intracellular polyamine levels which are known to be elevated in rapidly proliferating cells and tumors. Natural polyamines are putrescine, spermindine, and spermine. They are polycations that play multiple roles in cell growth, survival and proliferation, and plant stress and disease resistance. They can interact with negatively charged molecules, such as nucleic acids, to modulate their functions. Members of this family belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.84189e-94
NZ_CP044407.1\|WP_151015962.1\|7599968_7602404_-\|protein-kinase	gnl\|CDD\|319004	pfam16918, PknG_TPR, Protein kinase G tetratricopeptide repeat. This domain is found at the C-terminus of protein kinase G and contains a tetratricopeptide repeat (TPR).	1.61999e-85
NZ_CP044407.1\|WP_151015960.1\|7597325_7598672_-\|VWA-domain-containing-protein	gnl\|CDD\|238738	cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin). Bikunin confers the protease-inhibitor function while the heavy chains are involved in rendering stability to the extracellular matrix by binding to hyaluronic acid. The heavy chains carry the VWA domain with a conserved MIDAS motif. Although the exact role of the VWA domains remains unknown, it has been speculated to be involved in mediating protein-protein interactions with the components of the extracellular matrix.	7.9378e-17
NZ_CP044407.1\|WP_151015970.1\|7605493_7606339_+\|TrmB-family-transcriptional-regulator	gnl\|CDD\|224296	COG1378, COG1378, Predicted transcriptional regulators [Transcription].	2.04646e-28
NZ_CP044407.1\|WP_151018463.1\|7598668_7599829_-\|protein-phosphatase-2C-domain-containing-protein	gnl\|CDD\|223704	COG0631, PTC1, Serine/threonine protein phosphatase [Signal transduction mechanisms].	1.44111e-28
NZ_CP044407.1\|WP_151015968.1\|7604797_7605457_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	9.78505e-10
NZ_CP044407.1\|WP_151015952.1\|7587351_7588176_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224097	COG1176, PotB, ABC-type spermidine/putrescine transport system, permease component I [Amino acid transport and metabolism].	4.21066e-71
NZ_CP044407.1\|WP_151015954.1\|7592444_7593764_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	0.00130963
NZ_CP044407.1\|WP_151015950.1\|7584809_7585988_+\|polyamine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|226361	COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism].	9.53837e-164
NZ_CP044407.1\|WP_151015956.1\|7593959_7594928_-\|transporter-substrate-binding-domain-containing-protein	gnl\|CDD\|270408	cd13690, PBP2_GluB, Substrate binding domain of ABC glutamate transporter; the type 2 periplasmic binding protein fold. This group includes periplasmic glutamate-binding domain GluB from Corynebacterium efficiens and its related proteins. The GluB domain belongs to the type 2 periplasmic binding protein fold superfamily (PBP2), whose many members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.90822e-71
NZ_CP044407.1\|WP_151015966.1\|7603864_7604395_+\|WYL-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	8.73165e-21

>NZ_CP044407.1|WP_151018462.1|7594939_7596361_-|hypothetical-protein
MLSAAVPAPTGPRRLLPRTAASRVRWLSALAVLILLALLGVTAGTIAQAREGMRVIGHDAGPQVVATGDLYSQLTDMDAQLANALLAGDSEPAVRAEALELYDMNRLRAGEALFEAARLADDPTEEDTARALLDALARYERLAGQALQLERRTQHQAGPPPQEVLDLYRDATDLMKLNLLPKAYNLTLDNGALVRGTYEDQRSAVRTGLVWVIAVGVLLVAALVALQVFLAVRFRRLLNVGVALATVGTLALITASGLMLWGQAESLRKAKEDGFDSMLALSRTRAISNNAAADQTRYLLDPGRTDTYEQVYLSKSQTVLYVEAGNLAEYNAAVQKAGYVPGRTDFLGFLGTEGNRLVEDPATQSRIGGIFDTALQEYQRFQQRDHEMRRLVESGDRAQAVARRGELTAQFRQYDQALQELEEIRQTVFDEAVQDGDDGTSGWYGVLPIAGAAIVVLLLIGVWPRLSEYRWSK
>NZ_CP044407.1|WP_151015956.1|7593959_7594928_-|transporter-substrate-binding-domain-containing-protein
MRPFAGETDRTRGARPARGAERARETGRTRGPRRTRGAGRARRAGAALAGAAALLTAAACGVGSSDAESVADMEKLVIGVNGDRPGVGLRIAESGDYDAFEGFDVRVAKEIARNLGVNAADVSFREVTSGNRETLLANGDVDLVVAGYSITPERKLKAAFAGPYYVAHQDLMVREADADAIRSIHDLVGKRVCRVEGSTSFPRIHDEQGVAAVPVDAGGYGECLRLLTEGRLDAVSTDDLILAGLARQAAADGHTMTIVNAPISDERYSVGLRADDVEGCEAVNEAITKMYLDDTIPIHLERWFGETELELSKDVPQFEGCQ
>NZ_CP044407.1|WP_151015954.1|7592444_7593764_-|hypothetical-protein
MTTVVLIVMCVVVGALELYAGKQSRDQARAFTRRVDELNEQVTKQNNVLVTVGEQLTAELARVKRDVLPALDDRVHRTTGRVEELADVVHRADEFVRTQAGRLRDLEQQRITLAALRRKLAEVETSVREVVVGAGGAGASGDVREQVDTALERLADLERGGAEILELQRTLTRTLEDVEDIVAELLQFTEGALDDAVTAALTGTPRSLPAGSTGPGGGAGGAGRAGALPGGLPGGVGTVGGPRDAAVTATGRLWTRDDQLEDILGDVYERCVRANRLSVRFRTAEGADGLEPGSPERRRYFLGGQLPDDLAGAFSALLISTGADLPPSGLAGNGGTRRGLARVEPGVPSGVEPARPPEDEAALKSLLRTLAECSGAVAQIGPLMAVRTRDELVCAVLSAGQSLELESDEVFWDPAAAAVRLRRLPSHQLWDLTAWAAAP
>NZ_CP044407.1|WP_151018461.1|7591852_7592470_+|hypothetical-protein
MADTRVDFPPDVDFTPDVTVRPIWRLLLRGLGVYLPGWERPAGAARVPGRAGDGFGPPAYLDGDAGFGLQVPDRRRGLEPDREIYVRGRENPSFGIVVAGPTAAIGSRVVDAAALLRFARRLTFEELFDTGDADSVPYAVRGARAVENVVFLDRAAGVGLCAEVDPVTRDVRCPLYVRIGDPAERTVRAYGVAAHALPRGPRPTR
>NZ_CP044407.1|WP_151018460.1|7591017_7591521_-|PH-domain-containing-protein
MMVHRDNSTRTVDRYLMGHEGRVIAVRRHPAVLLPPVIAFVAGLIVCGAAATVTGVFWIWWLWLIPVGYLLWKVIAWSLEFFLVTEHRVMVINGVLNRTVAMMPLAKVTDINLERSITGQMLGYGEFVMESAGQKQALRNVGFMPYPEQLYLEVSSVIFGTIDESPD
>NZ_CP044407.1|WP_151018459.1|7589079_7590489_+|FAD-dependent-oxidoreductase
MHVARSLADAEPTPYWTAGSVRPDPGPALTGRRACDLAVVGGGYGGLWTALRAKERDPSLDVVVLEAGRIGSAASGRNGGFCSASLTHGLLNGVGRWPDDMDVLERLGWENLRAIAATLTRYGIDADWDPTGELTVATQEWQVPLLEEEAEHAFELGWEPILLGREGVRAEVNSPTYLAGLWDRHAVALLHPAKLAWGLADACRSLGVRIFEDTRVTGLRPDGGRLRLDGAHGAIGAHRVALATGAFPPLLRRMRGFVVPVYEYALVTEPLSRAQRDAVGWRRRQGVGDSGNRYHYYRLTPDGRVVWGGYDAVYHFGGRIGAALERRPAAFASLARNFFTTFPQLDGVRFAHAWGGVVDTCTRFCAFFGTAHDSRLAYAAGYTGLGVGATRFGADVMLDLLHLGVGPGEETERTRLAMVRDKPVPFPPEPLRFGAIELTRRAMARADREGGRRGPWLRALDRIGAGFGS
>NZ_CP044407.1|WP_151018458.1|7588262_7589066_+|ABC-transporter-permease-subunit
MILFGFNDVQGKQNFRWEGFTLEWYARLFDRSDLTRALVNSLAIAFASTAVTTVLGTFAGLALARYRFRGRRAADLLLFMAIACPELVMGASLLSMFVTFGVPRGAPTILVAHVMFSIAFVTVTVRARAVGLDPAVGEAARDLGAGPWMRFRLVTLPMIRPGVVAGALLAFVLSVDDFVVTSFTGGATVTFPLWVYGSTRTGTPPQVNVMGTLIFAVGVLIAVGSARRTFRGRDAAGTGTGSGRAEPQADGTGKGTHEETDGHRRGR
>NZ_CP044407.1|WP_151015952.1|7587351_7588176_+|ABC-transporter-permease-subunit
MVLPAGLWLLAFLVIPLSFMVSLSLQTGNLVDGFRQTLHWQNYADGLSTYGETFARSLWYGLLATVLCILLAYPAAYWIAFRAGRRKTMYLFLILLPYFVSFVLRTVAWRQVLSDNGPLLGPLRDHGPLPAGFHVLDTGFAVVAGLTYNFLPFMILPIYVALQRIDPRTVEAARDLYAGRAQAFGRVVLPLSLPGVFAGVIMTFVPASADFVNAEVLGGPGDTMIGNVIRAEYFESGAYPVASALSFTLTAILLVAIFVYARTLGTRGVLEAAR
>NZ_CP044407.1|WP_151018457.1|7586023_7587142_+|extracellular-solute-binding-protein
MLLAACGVEGRGKSVDEGEFWTGKSRNGRLRWANWPGYMQDDRATIKAFEADSGIGVTYREVIQEMGPWFGKIQAPLAAGQSIGFDLMVMTNGIHLERCRRLGYLAPLDHGRLKNFAAHAGPGYKDPSYDPGNEFTVPYQAGITGIAYNTKYVDEEITSISQLFDPRYKGRVGMMSDSQELGNFGMFLLGIDPEKSTRADWERAAGKLREQRDSGIVRKYYEQNYVDAVSKGDVWLTMAWSGDVYSLTSPDVRFVVPEEGGTIWTDNLCVPVTAENPVDALALMDWLYVPEHNAPLTEFVNYITPVPAVRDIIARHAAQATGEEKEDLARLSESPLVFPSEGDMARLRHYRRFSQEEATEYQKIFQAIVRGA
>NZ_CP044407.1|WP_151015950.1|7584809_7585988_+|polyamine-ABC-transporter-ATP-binding-protein
MISAIELAGVEKAYGRTEAVRGVDLAVAQGEFFSLLGPSGCGKTTVLRMVAGFEEPSAGEVRLDGRTVNGIPAERRDVNMVFQSYALFPHMSVFDNVAFGLRRRGAGRAEVRTRVGEMLEMVDLAGGGRRRPTELSGGQQQRVALARALVNRPRALLLDEPLGALDLRLRQAMQAELKRLQRDVGVTFVYVTHDQGEALTMSDRIAVMNEGRIEQVGTPRDVYERPATRFAAGFIGTSNVLDGEVVETSGDGAVIGHGKDGRIEVRGTVAGTRIEVTVRPEKVRLTTDEPSPRSCRLRGTVTDVVYQGASTSYEVRTSAGANVSVFAQNAASADVVADRGDEVWLSWDPRHSYVIGDRRSAGDHVTGDRRSAGDQATTDRERAGDTAIGGAR
>NZ_CP044407.1|WP_151015960.1|7597325_7598672_-|VWA-domain-containing-protein
MSEQPQFTVKVDQNQYLPEGGREVHAIVSVEASGADAAGGAAPAAGPATRASEVIIIDTSGSMSYPETKLRAAVEAAQVAVDTLRDGVEFAVVSGSNVASMVFPARQELVPANDENRRLAKEALGRLRASGGTAIGSWLRQADVLFGDREGIRHAILLTDGKNQHETPEQLDAVLFRCEGRFICDCRGVGTDWEVAELRKVASALLGGVDIVRDPAGLVADFQAMTEAAMGKSVADVALRLQTPQTAKLKFVKQVLPTVEDLTGRRVEVPPQAGDYPLGAWGEESRDYHVCVELPPGEVGKVLRAVWVKLVVPGAPGEEARVLATGNVLAEWTDDEARSTRINDRVAHYTGQAELAAEIQQGLEARDRGDEDTATARLGRAVVLADEAGNEEITSLLRKVVDVIDPATGTVRLKKDVDKGDEMELNTRSTKTVRTRKDETVNNRGQKG
>NZ_CP044407.1|WP_151018463.1|7598668_7599829_-|protein-phosphatase-2C-domain-containing-protein
MVYAGETFCEGCGHRLGDAPEPSAPAPGAGAAVREGRTFRTTTASLARRRAATAPPCTGCGGSAIDAEGYCESCGLRQPADRDHVEATLPEGAGPLLVAGVSDRGLRYSRNEDALALAVHAAGVAAVVSDGVGSSQRPEEASRAAADTGAAALASRLDAGEDPAEATRAAARAAALAVAALASSEDDAPSCTYVSAVTRDGTITVGWVGDSRAYWLAADDTGDADAGGDGGGGVESGSGAGGSGEAGPVGLAASRRLTEDDSWAAFMVAEGALTEAEAEAHPNAHVITAWLGADAGDVAPHVATFRPSGPGTLLVCSDGLWNYFPAARDLRALLPADPAPDPAADPLGTARTLVRHALDSGGRDNITVAVVPLPSPVRPPSTEQHR
>NZ_CP044407.1|WP_151015962.1|7599968_7602404_-|protein-kinase
MAAPSSPSGPSAPDACAQAGCGGTIDGGFCATCGSPPGPSGAGTPGTPNAAGGASAPGGAGGAGAPGGACDKPGCGGTIDDGFCDVCGEAPSPPSATAATGPSGARSLSLGGSRSGSVGTGRTGSARTGASRPSTGVGGLGAGLINVPRIEPLNPSAAVLRDPKVAETKRYCGHCDEPVGRSRGGQPGRTEGFCPKCGTGFAFTPKLAPGDLVGGQYAVLGCLAHGGLGWIYLARDKNVSDRWVVLKGLLNSGDADAQAAAAAERAFLAEVEHPNIVKIYNFVQHDGDGYIVMEYVGGRSLKEILLQRRDEGADALPVAQAIAYGLEVLRAFGYLHARGLVYCDFKPDNVIQFEEQLRLIDLGGVRRLDDPDGAIYGTPGYQAPEIADVGPSVSSDLYTVGRTLAVLSFPFKGYTSRFRESLPPRSDVPVLARHESFDRFLRRATHQDPDERFQDAAEMADQLTGVLREVLATEDGRPRPAPSALFGPERFAARAAGDDANASALPPVPPATAAAALPVPLVDAGDPAAGFLAGLTSLEPRQLEATVAGAPQRTPEVRLTLARVKIELGEYEEAGRLLDESDADQPGDWRVEWFRTVALLARGRATEAEPRFDRLYDLLPGEAAPKLALARCREESAPGEAARLYELVWRTDDAYINAAFGLARVRFASGDRAGAISALDSVPESSIRRTSAQVAAVTTAVRSRPAAELTAADLLAAGQRLGRLGPDALDVRRRDRLTAEILEAALDWLLIGPGRADEARGAALLGATLSEAPLRRHLEGAYRRLAKVAPDRDESRRLVDAANAVRPRTFL
>NZ_CP044407.1|WP_151015964.1|7602466_7603699_-|hypothetical-protein
MGEPTRLPMSRDEVDRTLAHLRDERERIGSSLLELEANQGYQLLEGATPHGETRRVQSDVRSRVESLWTLFDLYRRAVAEAEEVRARPGRLGHWRLAELTRLLSGPSIELPAAEVPLERRALLHVPSGERLTLRAAVARMTALYEETVRAVGGLERVWSALLSRLAEIEAARRAATEALAALGGTDPELDRLGAGLDAVAAEVRGDPLALAPGGRPDTSRLDELRGGFADARRRLEAAALLRDGYAERVRGVARTLDRVREAEAEARRVRDSVTARIAGPVPPARPEASPALADRLAALDRDARSGGDWTERARRIDDLEHAADEALRAARDAVEVVRGLLERRDELRGRLDAYRVKAARLGLSEDEATTGLYEKARALLWTSPCDLREATVALSEYQRAVAAREKGADG
>NZ_CP044407.1|WP_151015966.1|7603864_7604395_+|WYL-domain-containing-protein
MANVATHRRTAPTLTALSAAEIAALALSLAHLGAGPQAATARRALRTLLDTVPHDDVAGATLTTLTASLDASTADRARVVAAAISEHRVVRLCYGDSGANVTIREVEPVTTLVHRDHWYLVGWCRMRRGVRAFRFDRILAVESTGMPARPRRADRYLPFQRRKAVHAGGPAHTATT
>NZ_CP044407.1|WP_151015968.1|7604797_7605457_-|methyltransferase-domain-containing-protein
MTRRLDDAELEASPVVANIAMNRERTLASYRRELGVDPLAEAGTGHWLDLCCGTGRALVDAAGESADVRITGVDLVGHFLPGVPPPNVRLVVASVTVWEPAAPADLITCVHGLHYVGDKLGLLARAASWLTGDGLLVADFDPRSVRLAGGSPAGRPAAAALRRAGFALDTRRHRITLRGRREITLPYRYLGADDRAGPNYTGQPAVDSYYAPEPVEGER
>NZ_CP044407.1|WP_151015970.1|7605493_7606339_+|TrmB-family-transcriptional-regulator
MTAVSTRDVLEHLRRLGMSGYEAKAYVALVAAGRPVNGYEVAKRSGVPRSTVYETLGKLVARGAAYEVRGSSDGTEYLPLPPESLLDRMRREFDGSVAALRTALPAVAAAPEAPPIHGLKDAEAMLDRAGDVVAAARRDLFVSIWPEEMRRLRGPVEEAAGRGADVSVVAFGEDTAFGGDTAPDTGARIHRHRYSAPEAVLEDLGYRLIVVVGDRREAVVGGFAEGAAWGIYTADPAVALMAAEYVRQDIALQILADRVGAAELDRLFATDPDLLRLLGRR
>NZ_CP044407.1|WP_151015972.1|7606349_7607957_-|PucR-family-transcriptional-regulator-ligand-binding-domain-containing-protein
MLPTLDDVLRLDAVRRCRPHVVAGADRTGGRVRWVHVAEVTDIAHLLRGGELVLTTGIALPDDPARLRAYVADLAEVGVSGLMIELGRRYATALPGPLLAAAERHGLPVIVLAHEPVFVDITEAVHARIVQEQFAELRESERLHEIFTRLSVEGASTDEVVRRVAALAGHPVVLENLSHRVLAADAGGADPAQVLAAWEARSRAVRPGVRTGYDDTSGWLATMVGARGEDWGRLIIVLGSPPTPRETVLIERAATTLALGRLLDRHAESLERQAHGTVIARVIAHAHSDPQEAAARARALGVPLTGRRLFGAVLRQRGAAGSAPPVGELSQLAETAAAACRQARLAALVGVLDEGGPHARVGVLASLPARADAETVLTEVAALLRKQSVHDGVLAAGSVVETVRDVRRSFLEAEQVADVAARGPGDRPFYRLPDLRLRGLLHLLRDDARVQTFAERELGPLLRHDARRGTDLTRILELYLESGRNKAEAAQRAHLSRPALYERLRRIERVLDTDLDDVESCVSLHVALLALGSVR
>NZ_CP044407.1|WP_151015974.1|7608252_7608606_+|hypothetical-protein
MTADDHAAEVDALGRRFPGWTFWFGPFTRRWWALPPRELDVGDFLEADTPQALIARIEMIRRAPWRPPQGDGRRPSFPTTDTRRDARRPSNLLRLEGITPSPFRRAPAIAWPGSTAG
>NZ_CP044407.1|WP_151015976.1|7609063_7610329_+|extracellular-solute-binding-protein
MRLTGTRLTNTRLLDGVRAKVLAALGTTAVLGAAGLVACSGGEDEPGRVGVAKVASTLGPGEGVLNLVTLPGYIENGGNDPRVDWVTPFEERTGCKIGWKVVTTPHEMADLMRDGGRHYDGVAAPPEVAGRLIAENQVVPVNTDLVDGYKKLEPTLRGLLERDDRYFGVPYVWGSNLLVHDARSVLQPSSWAALFDPDQARRYSGELVMRDSPLSIAEAALYLKGAEPDLDVADPYSLTPEQLAAAGRVLKEQRPHVAEYWELPADAVSAFAAGGAVLGQAWPYHVDVLNRASQPVRGAVPAEGVTGWMDAWMISSRAQHPNCMYQWLQWTASADVQQQVAEWTGVAPANPQACSGDRLRPGFCSAYRVGDRDYLESVIFAHTPRADCGRKPGEDAEEKPGEAKCTSYADWTRTWIESTKL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044407_13

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044407_13

7794515-7794669

Orphan

Consensus_repeat	Method
CTGACCGACGACCGGAGCGGAGCGCTAGCGGAGTGGAGGTCGGCGGGCGGGCGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044407_13

>merge|NZ_CP044407|13|7794515-7794669|CRISPRCasFinder
CTGACCGACGACCGGAGCGGAGCGCTAGCGGAGTGGAGGTCGGCGGGCGGGCGGCTGCTTTTGCCGGGGGGTGTGGGGGGTCGCCTCTCACTGTGGTGGGTCTGACCGACGACCGGAGCGGAGCGCTAGCGGAGTGGGGGTCGGCGGGCGGGCGG

>NZ_CP044407|13|13|7794515-7794669|CRISPRCasFinder
CTGACCGACGACCGGAGCGGAGCGCTAGCGGAGTGGAGGTCGGCGGGCGGGCGG	CTGCTTTTGCCGGGGGGTGTGGGGGGTCGCCTCTCACTGTGGTGGGT
CTGACCGACGACCGGAGCGGAGCGCTAGCGGAGTGGGGGTCGGCGGGCGGGCGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044407.1\|WP_151018485.1\|7787147_7788464_+\|DUF21-domain-containing-protein	unknown	unknown	gnl\|CDD\|224173
NZ_CP044407.1\|WP_151016436.1\|7784169_7784757_-\|SigE-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|132028
NZ_CP044407.1\|WP_151016444.1\|7795626_7796439_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379849
NZ_CP044407.1\|WP_151016440.1\|7788494_7788827_-\|cytidine-deaminase	unknown	unknown	gnl\|CDD\|235875
NZ_CP044407.1\|WP_151016445.1\|7796848_7798561_+\|2-isopropylmalate-synthase	unknown	unknown	gnl\|CDD\|235154
NZ_CP044407.1\|WP_151016443.1\|7794700_7795636_+\|GTPase-Era	unknown	unknown	gnl\|CDD\|234624
NZ_CP044407.1\|WP_151016448.1\|7801294_7802230_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224096
NZ_CP044407.1\|WP_151016434.1\|7782659_7783391_+\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	unknown	unknown	gnl\|CDD\|236959
NZ_CP044407.1\|WP_151016437.1\|7785057_7785402_+\|HIT-domain-containing-protein	unknown	unknown	gnl\|CDD\|238607
NZ_CP044407.1\|WP_151016433.1\|7781405_7782542_+\|molecular-chaperone-DnaJ	unknown	unknown	gnl\|CDD\|237654
NZ_CP044407.1\|WP_151016438.1\|7785598_7786654_+\|PhoH-family-protein	unknown	unknown	gnl\|CDD\|376820
NZ_CP044407.1\|WP_151016446.1\|7798595_7799636_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224525
NZ_CP044407.1\|WP_151016452.1\|7805090_7806140_-\|M4-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341060
NZ_CP044407.1\|WP_151016451.1\|7804832_7805087_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044407.1\|WP_151016439.1\|7786650_7787130_+\|rRNA-maturation-RNase-YbeY	unknown	unknown	gnl\|CDD\|234575
NZ_CP044407.1\|WP_151016449.1\|7802236_7803115_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472
NZ_CP044407.1\|WP_151016441.1\|7788979_7791118_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|225272
NZ_CP044407.1\|WP_151016450.1\|7803170_7804766_+\|DUF3459-domain-containing-protein	unknown	unknown	gnl\|CDD\|200471
NZ_CP044407.1\|WP_151016447.1\|7799820_7801176_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270303
NZ_CP044407.1\|WP_151016435.1\|7783456_7784173_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235906

Protein	Function_ID	Function_description	E-value
NZ_CP044407.1\|WP_151018485.1\|7787147_7788464_+\|DUF21-domain-containing-protein	gnl\|CDD\|224173	COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only].	2.33046e-96
NZ_CP044407.1\|WP_151016436.1\|7784169_7784757_-\|SigE-family-RNA-polymerase-sigma-factor	gnl\|CDD\|132028	TIGR02983, putative_RNA_polymerase_ECF-subfamily_sigma_factor, RNA polymerase sigma-70 factor, sigma-E family. This group of similar sigma-70 factors includes the sigE factor from Streptomyces coelicolor. The family appears to include a paralagous expansion in the Streptomycetes lineage, while related Actinomycetales have at most two representatives.	1.18448e-47
NZ_CP044407.1\|WP_151016444.1\|7795626_7796439_-\|hypothetical-protein	gnl\|CDD\|379849	pfam16481, DUF5058, Domain of unknown function (DUF5058). This family consists of uncharacterized proteins around 250 residues in length and is mainly found in various Firmicutes species. The function of this family is unknown.	0.00114408
NZ_CP044407.1\|WP_151016440.1\|7788494_7788827_-\|cytidine-deaminase	gnl\|CDD\|235875	PRK06848, PRK06848, cytidine deaminase.	0.000338674
NZ_CP044407.1\|WP_151016445.1\|7796848_7798561_+\|2-isopropylmalate-synthase	gnl\|CDD\|235154	PRK03739, PRK03739, 2-isopropylmalate synthase; Validated.	0
NZ_CP044407.1\|WP_151016443.1\|7794700_7795636_+\|GTPase-Era	gnl\|CDD\|234624	PRK00089, era, GTPase Era; Reviewed.	1.91275e-159
NZ_CP044407.1\|WP_151016448.1\|7801294_7802230_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	6.1972e-79
NZ_CP044407.1\|WP_151016434.1\|7782659_7783391_+\|16S-rRNA-(uracil(1498)-N(3))-methyltransferase	gnl\|CDD\|236959	PRK11713, PRK11713, 16S ribosomal RNA methyltransferase RsmE; Provisional.	1.37273e-73
NZ_CP044407.1\|WP_151016437.1\|7785057_7785402_+\|HIT-domain-containing-protein	gnl\|CDD\|238607	cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members.	2.91323e-53
NZ_CP044407.1\|WP_151016433.1\|7781405_7782542_+\|molecular-chaperone-DnaJ	gnl\|CDD\|237654	PRK14278, PRK14278, chaperone protein DnaJ; Provisional.	0
NZ_CP044407.1\|WP_151016438.1\|7785598_7786654_+\|PhoH-family-protein	gnl\|CDD\|376820	pfam02562, PhoH, PhoH-like protein. PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation.	1.41859e-136
NZ_CP044407.1\|WP_151016446.1\|7798595_7799636_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	1.4262e-89
NZ_CP044407.1\|WP_151016452.1\|7805090_7806140_-\|M4-family-metallopeptidase	gnl\|CDD\|341060	cd09597, M4_TLP, Peptidase M4 family including thermolysin, protealysin, aureolysin, and neutral protease. This peptidase M4 family includes several endopeptidases such as thermolysin (EC 3.4.24.27), aureolysin (the extracellular metalloproteinase from Staphylococcus aureus), neutral protease from Bacillus cereus, protealysin, and bacillolysin (EC 3.4.24.28). Typically, the M4 peptidases consist of a presequence (signal sequence), a propeptide sequence, and a peptidase unit. The presequence is cleaved off during export while the propeptide has inhibitory and chaperone functions and facilitates folding. The propeptide remains attached until the peptidase is secreted and can be safely activated. All peptidases in this family bind a single catalytic zinc ion which is tetrahedrally co-ordinated by three amino acid ligands and a water molecule that forms the nucleophile on activation during catalysis. The active site is found between two sub-domains; the N-terminal domain contains the HEXXH zinc-binding motif while the helical C-terminal domain, which is unique for the family, carries the third zinc ligand. These peptidases are secreted eubacterial endopeptidases from Gram-positive or Gram-negative sources that degrade extracellular proteins and peptides for bacterial nutrition. They are selectively inhibited by Steptomyces metalloproteinase inhibitor (SMPI) as well as by phosphoramidon from Streptomyces tanashiensis. A large number of these enzymes are implicated as key factors in the pathogenesis of various diseases, including gastritis, peptic ulcer, gastric carcinoma, cholera and several types of bacterial infections, and are therefore important drug targets. Some enzymes of the family can function at extremes of temperatures, while some function in organic solvents, thus rendering them novel targets for biotechnological applications. Thermolysin is widely used as a nonspecific protease to obtain fragments for peptide sequencing. It has also been used in production of the artificial sweetener aspartame.	1.54977e-123
NZ_CP044407.1\|WP_151016439.1\|7786650_7787130_+\|rRNA-maturation-RNase-YbeY	gnl\|CDD\|234575	PRK00016, PRK00016, metal-binding heat shock protein; Provisional.	8.95588e-67
NZ_CP044407.1\|WP_151016449.1\|7802236_7803115_+\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	6.77036e-69
NZ_CP044407.1\|WP_151016441.1\|7788979_7791118_+\|MMPL-family-transporter	gnl\|CDD\|225272	COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only].	6.20773e-93
NZ_CP044407.1\|WP_151016450.1\|7803170_7804766_+\|DUF3459-domain-containing-protein	gnl\|CDD\|200471	cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins. Oligo-1,6-glucosidase (EC 3.2.1.10) hydrolyzes the alpha-1,6-glucosidic linkage of isomaltooligosaccharides, pannose, and dextran. Unlike alpha-1,4-glucosidases (EC 3.2.1.20), it fails to hydrolyze the alpha-1,4-glucosidic bonds of maltosaccharides. Trehalose synthase (EC 5.4.99.16) catalyzes the isomerization of maltose to produce trehalulose. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.	0
NZ_CP044407.1\|WP_151016447.1\|7799820_7801176_+\|extracellular-solute-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.20576e-50
NZ_CP044407.1\|WP_151016435.1\|7783456_7784173_-\|hypothetical-protein	gnl\|CDD\|235906	PRK07003, PRK07003, DNA polymerase III subunit gamma/tau.	2.74491e-06

>NZ_CP044407.1|WP_151016441.1|7788979_7791118_+|MMPL-family-transporter
MSRLLYRLGRAAALRPWRFVVVWLVLVAAVGGAAAAGGGSLQDDYTLEGTGSQRATELLRDRFPALSGADARVVVHSGDGRVDPAALAAASGELRELPDAAAVDPPRFGAGGRTALLTVRYSVPVTDLETGPTLDALRGATANLEDAGYQVEFGGQVPENVTAPGGVAEAVGVVAALVILLVAFGSVVAAGLPLAVALAGLGAGVSGIMLLAAVSNVATTAPTLAVMVGLGVGIDYALFILTRHREGLAAGLDVPESAGRAIATAGQSVLFAGFTVLLALCGLVLSRIPVFMTMGFATGIVVAATVASAVTLLPAVLGLAGRRVLRRRDRASGAAPATDSPRVRRWALHVGRRPWPWLLAGLMLMLTLAAPALGMRTWPSDAGSEPTSNTARQAYDLVADAYGPGDNGPLLVAVDLRETDPGVLPGLRDRLAATEGIAAVAPPRLSDARDAAVIVATPEYGPQDERVTPLVDRIRADVLPPGAEITGNTAAYVDLTRTLAERLWPVIGAVVATSFVMLVLVFRSVLAPLKAALMNLLSIAAAYGVLTAVFQWGWGAELLGLPHSVPVSSFILLLMFAVLFGVSMDYEVFLLSRVREEWLRTGDARGAVSGGLAVTGRVITSAALIMVAVFLGFAADPSLVIKQMGVGLAVAVALDATVVRLVLVPAAMALLGRGNWWLPGWLAKVLPSVDLHGAAVPPAAGAEPRTPEPSRT
>NZ_CP044407.1|WP_151016440.1|7788494_7788827_-|cytidine-deaminase
MSELNDEDAKIITLARSSRARGGAAEGAAVRDETGRTYAATSVDLPSLRLSALKVAVAMAVSSGAEDLEAAAVVTAADAPDPSDVAAVRDLGPKAPVLVASPDGTLRATL
>NZ_CP044407.1|WP_151018485.1|7787147_7788464_+|DUF21-domain-containing-protein
MAGLAALLVVLAGLLASTETALARVSRVTVEEFARERRRGSKRLAEVVADPARYVNMVLLLRIGCELVATVIVADLCISWLDETWPAYVVAAAFMIVVSYVAVGVAPRTLGIQHADRIALAGAAVLHPVTRVFGPLPRLLILLGNALTPGKGFREGPFASEAELRDLVDLAEQRSLIEPDEREMIHSVFELGDTLVREVMVPRTDIVFVERDKTLRRAMSLALRSGFSRIPVVGENEDDVVGIAYLKDVVRRSHEHHEAESVETVDSVMRPATFVPDSKPIDELLREMQARRIHVAIVIDEYGGTAGLVTIEDILEEIVGEITDEYDREIPPVSWLDGEAARVTARLPVDDLAELFDVEIDAEDVDTVGGLLARALGRVPIEGSTAEVGSAPRTPDDDDDGGAARGAVLSLKAETIAGRRNRIGTVLVRRIDTGGGEV
>NZ_CP044407.1|WP_151016439.1|7786650_7787130_+|rRNA-maturation-RNase-YbeY
MSIEVLNESGADVDGNTLAELSRHVLDGMRVHPLAELSVLLVDEDAMTELHVRWMDEPGPTDVLSFPMDELRPGHLSGGADEDDEADPGLLGDVVLCPSVAERQARTAGHSTEDELELLCTHGILHLLGYDHAEPEEHKEMFGLQAELLTSWREKRGRR
>NZ_CP044407.1|WP_151016438.1|7785598_7786654_+|PhoH-family-protein
MVESTHTGRDDRAQIKIVVPDDHSMVSLLGSRDELLQAVERAFGDGIDIHVRGNEITVTGSETDTGLVSRLFTEMLEMLKGGTQLTPDAVERSLAMLRGEGDARPAEVLNLNVLSGRGRTIRPKTLNQKRYVDAIDKHTIVFGIGPAGTGKTYLAMAKAVRALQEKQVNRIILTRPAVEAGERLGFLPGTLYEKIDPYLRPLYDALHDMVDPDSIPRLMAAGTIEVAPLAYMRGRSLNDSFIILDEAQNTSPEQMKMFLTRLGFGSKVVVTGDVTQVDLPNGTQSGLRVVQDILEGVEDIHFTRLTSHDVVRHKLVTDIVDAYNRYDESRVPQFKKDTARGGGSGRKRGQR
>NZ_CP044407.1|WP_151016437.1|7785057_7785402_+|HIT-domain-containing-protein
MTDCLFCKIVSGDVPAKVVRSSDRAVAFRDINPQAPTHVLVIPKDHHPTVGELAAADAELLAEVLREAHRVAEDEGISDTGYRVVFNTGAQAGQTVFHVHAHVLGGRGLNWPPG
>NZ_CP044407.1|WP_151016436.1|7784169_7784757_-|SigE-family-RNA-polymerase-sigma-factor
MPFRKPDGEGGRPTDVTETLVARGTAGAVAVAWDADQAVTALYSANYRSLVRLAAMLVRDAGTAEEVVQDAFVAMHGGWRRLRDPDKALSYLRQSVVNRSRSVLRHRAVVEKYAPKGLPDMPSAEAGAIGELERSAVIDALSGLPPRQREALVLRYYGDLSEAEIANAMGISRGAVKSHTARGMTALRNVLEQFS
>NZ_CP044407.1|WP_151016435.1|7783456_7784173_-|hypothetical-protein
MTTDPHDDHGEFLRRVLDAEAESVIPSDDGLERIRARIAEGERRRGRFGRLVPAHLRPAGFGVGWARPVLAVAAAVAVAGFGVTAGPQTIELIQHTVTGNGPSGGGDGDSGGDGTGAQAPPVVPGDPSSPAPTTTATPSTSEEAGEPPSSPGLSSCVIPRGGGAAATPGTPPPSGTPSPGAPSGTPCPGGQTPTESPSDAPTTSAPPPDTSPEPSDEPTPTASGTPSTTAEQGAQTAP
>NZ_CP044407.1|WP_151016434.1|7782659_7783391_+|16S-rRNA-(uracil(1498)-N(3))-methyltransferase
MSPPVFLAAADALERDRVVLDGPEGRHAATVRRLRPGERVDLTDGEGLLAECVVTAADRVSLTLEVAARHREPPPSPRLVVVQALPKGDRGELAVETMTEAGVDEIVPWAAARCVTQWRPDRREKALNRWRNAAREAGKQARRSRLPQLPDLASTAAVAGRLAGASAALVLHEDAAEPLSAVRPPADGEIVLVVGPEGGITEDELAAFGAAGGRPVRLGPTVLRTSTAGVAAAAVLLAATGRW
>NZ_CP044407.1|WP_151016433.1|7781405_7782542_+|molecular-chaperone-DnaJ
MANDYYATLGVRRDASADEVKKAYRRLARELHPDVNPDPETQEKFKEITQAYEVLSDPKKREMYDLGADPFAPGGGAGGAGGFGGAGFPFSDIMDAFFGTSASRGPRSRARRGRNATLRVELDLSETAFGTTRELTVDTAVACSACEATGCAPGTHPDTCDTCHGRGEVQQVQRSFLGQVMTARPCPACGGFGSVIRNPCTECSGDGRVRTRRTVKVKIPAGVENGIHIQLAGEGEVGPGGGPPGDLFLEIVERAHPIFEREGDDLHCTVEIPMTAAALGTSVTIETLDAAEEIDIKPGTQSGQVITLYNRGVRHLNESGRGDLMIHVNVETPGRLDEEQEELLRRLATLRGEERPPGKFAPGQRGMFSRLRDVFNQH
>NZ_CP044407.1|WP_151016443.1|7794700_7795636_+|GTPase-Era
MTSTGDLTTAPPPEGFRAGFACFIGRPNVGKSTLMNALVGTKVAITSSRPQTTRRAIRGIVHRPDGQLVVVDTPGLHKPRTLLGERLDSLVRSTLTEVDVIGFCVPADQPVGPGDKYIARELAGVKKTPVVAIVTKTDLAAPEQVAEQLLAVGRLGEFADIVPCSAQDGFQVDLVGELLVSRLPEGMPLYPEGDLTDEPEQLMVGELIREAALEGVRDELPHSIAVVVDEMAPREGRDDLVDVYAHLFVERPSQKGIIIGHRGARLREVGAAARRQIEALLGTRIYLDLRVSVLKDWQRDPKQLRRLGFYD
>NZ_CP044407.1|WP_151016444.1|7795626_7796439_-|hypothetical-protein
MTGDLGSDAGRARSRPQFLPPDDGLPPPLPEDAAPPPPPPEPEPRRGGIGWSIALIASAAALLVSAFLPWARASVVVDLFGSAITREVATAAGIDADDVVLAVPVFAVVAIVMASWDLLARDTRITALAAVPGVLSLLACLLFLLRLDDAADDLPTGGLDVGYEISVQYGWYVAVGASLLVTGFSLARPISARLGAGRARQAAYPQDGYAADQYAHDPYAQHPYYGQYAGDPNAVWPQQNGWEAQPGEPAPHDPSEPRADSRDERRDDQS
>NZ_CP044407.1|WP_151016445.1|7796848_7798561_+|2-isopropylmalate-synthase
MYPAQQPSGMPFERYRPFTPVKLTDRTWPDAAITQAPRWCAVDLRDGNQALIDPMDADRKLRMFELLVRMGYKEIEVGFPAASQTDYDFVRQIIDEGRIPDDVVIQVLTQARPELIERTFESVRGAKQAIVHLYNSTSTLQRRVVFGQDRDGITAIAVEGAKLCAKLAEDMGDTEIFFQYSPESFTGTELEYAVEICNAVNDVWKPTPDKKVIVNLPATVEMATPNVYADQIEWMNRHLAYRDSVILSLHPHNDRGTAVAAAELGYQAGADRIEGCLFGNGERTGNVCLVTLGLNMFTQGVDPQIDFSDIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGFDHLRIDAAAAGTPVEEYRWEVPYLPIDPHDVGRTYEAVIRVNSQSGKGGVAYIMKTEHSLELPRRLQIEFSRVVQEHTDSEGGEVDAARMWEIFEGEFLSNGPRVGLLAHRTTSRVDEKDALSCDVRVDGEIREIEGLGNGPVSAFEDALATVGIDVRVLDYAEHAMSAGGDARAAAYVECDVDGATVWGVGIDGNIVTASLKAMLSAVNRVARAQTK
>NZ_CP044407.1|WP_151016446.1|7798595_7799636_+|substrate-binding-domain-containing-protein
MARRLAEVAKKVGVSEATVSRVLNDKPGVSAATRAAVLTALDVLGYERPTQLRGERARLVGLVLPELGNPIFPALAEVVGGALAQRGFTPVLCTLTPGGLSEADYVEMLLQQQASGVIFAGGLYAEADAVHDHYHRLLDVRLPVVLVNAAADRLDFPQVSTDDAVAAEQAFGHLLSLGHERIGVVLGPEDHVPCRRKLAAVRAAAERAGVDLPGSRIRRAMFSLEGGQAVTGRLIRDGVTGVICASDPLALGVIRAVRRLGMSVPGDVSVVGYDDSAFMNCVDPPLTTVRQPIESIGRAAVTLLVNQVEGGSVTAEELLYEPELVVRASTAPSAPSAPSAPSRVPA
>NZ_CP044407.1|WP_151016447.1|7799820_7801176_+|extracellular-solute-binding-protein
MRSRILATLLATSVLAGCGGDGGGGADTSPLGADTEVTITVGCMPAKSQEAQRKEWNEDVAAFQKLHPNIKVVGKDAFPCIDPNTFQAKLAGGQMEDLFYVYFTDVNSIVAKGQAADITPYLGQVENHGSLDPAVRKVFEKDGEVYGLPRQNYTMGLFYNRELFEKAGLDPDAPPRTWPEVRAAAKRISDLGDGVVGFAELSSQNQGGWHFTTSLYSQGGAMVTPDGKKTAFDGPQGRAVLQTLKDMRWTDDSMGGKQLLVAADVQRMMAAGELGMFLGAPDNATALVDQFNGDYGNYGMAPIPGAKGTLLGGDGYMFSPDASPEQIKAGLMWLEFYAITPGQGQLNYARAAGNGRPVGLPQPKLFGDNAVGRKDRELRAASANLPVANFRPYEDAYASVPAKLEPPHAQKLYAILDSVVSAVLTRRDANIDALLADAREKGDAVLARSVN
>NZ_CP044407.1|WP_151016448.1|7801294_7802230_+|ABC-transporter-permease-subunit
MLTLRTPARPAAPPRRHRKATRGRRAVRRNLTAYGFLCGALICFAFFSWYPIVREILLSFQQTNFVGDTRWVGLENFRTVLADPVFWDAWKNTAIFTVLALVIGYAVPFTIAIVLNELRHARGYLRFVVYLPVMLPPAVVVLLFKWFYDPGSGLFNQVLGLAGLPGLQWLDSTGTALLSLVLVSTWMNLGSGTLIYLAALQTIPGELYEAAELDGAGLFRRIRHITIPQTRLILLVMLLLQVIATMQVFIEPYLLTGGGPENATVTVVYLMYQYAFNFTNFGGGGALGLMLMVVLMLFSAVYLRVSRDDPR
>NZ_CP044407.1|WP_151016449.1|7802236_7803115_+|ABC-transporter-permease-subunit
MTQTRTLVSPHTLGTRRGKAVYWTVLTTVVVTFTFVFVFPLYWMVTGAMKSPEQLAEVPPSLWPGDVDLGAYREAWRQLDLGLYMRNTFVYAFGAWLFTLAVDVSAAYALSRLRPLFGRAVLGMMLATLMIPPMVILLPAYLTVKDLPLLGANLLNTPWAIWLPAAANAFNIFLLKRFFDSIPTELIDAAEVDGAAPARILWSIVLPVSRPIIGVVSIFTIVNVWRDFVWPLLVLPDGEKKTISVAISSLAVQVPQNVLIGSLVIASLPTIVVFFIFQRQIMAGLTAGGLKG
>NZ_CP044407.1|WP_151016450.1|7803170_7804766_+|DUF3459-domain-containing-protein
MPEAWWRDAVIYQVYPRSFADGNGDGVGDLAGLRARLPYLAGLGVDALWLNPWYPSPMADGGYDVADYRDVAPEFGTLADAEAFVAEAHAAGLRIILDVVPNHASDRTAWFREALAAGPGSRERARFWFRPGRGDRGAEPPNDWRSIFGGPAWTRVPDGEWYLHLFAPEQPDFNWNSRDVVRDFHDVLRFWYDRGVDGVRIDSAALLVKDPDAEPDGLDPYTDRDGVHEIYRGWRKITDGYPGRMLVGEVWLPDQERFARYLRPDEMHTAFNFDFLNCAWEPHALRKVIETTLATHGPIGAPPTWVLANHDVVRPVTRYGRADTSFDLQDRRLGAHTDRALGVRRARAAALLALALPGSAYIYQGEELGLPEVEDLPDDLRQDPIWHRSGRTDPGRDGCRVPLPWSGDEPPFGFGGDPWLPQPAEWKALTVEAQDADPGSMLALYRTALALRRDHLGDGTLRWRPAPEDVLAFTRETGLTCVVNLGEGPFPLPDGEVLLSSGEPPDGELPPDTAVWLLESTATAFTGGGNA
>NZ_CP044407.1|WP_151016451.1|7804832_7805087_-|hypothetical-protein
MKVTVVRSGGFAGIERRAESDSASDPVLAGLVRRVDLGAVPPPGRHPDQFLYEIEIDGRRTTVGEAQLSGPLRELVHHVLGRAH
>NZ_CP044407.1|WP_151016452.1|7805090_7806140_-|M4-family-metallopeptidase
MRCHIVPPHMLERLARDAGDPVVSARARRTMALTSAQYVRRLVPAPARAPEEDFVPKRTIHDAEGRETLPGRAVRKEGDPATGDAVVDRSYDWLGATFDFFEEVHRRDSIDGAGLPLVSTVHYGDGYANAFWDGEQMVYGDGDGVVFTDFTGPLDVTGHELVHGITQHTANLEYYGQAGALNESVSDVFGSLVKQWHLGQTADRADWLIGVGLLAEGVRGVALRSMKEPGTAYDDPRLGKDPQPGHMDDYVETYRDNGGVHINSGIPNRAFHLAATAIGGNAWEKAGLVWYDVLTGGTLAVDVDFAGFAAATVRAAATRFGADAAETEAVRRGWTGVGVPVAAASEALR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP044407_6	6.1\|4721561\|51\|NZ_CP044407\|CRISPRCasFinder	4721561-4721611	51	NZ_CP044407.1	4721326-4721376	0	1.0
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	7596978-7596996	0	1.0
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	1073649-1073667	1	0.947
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2260041-2260059	1	0.947
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2260050-2260068	1	0.947
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	3588367-3588385	1	0.947
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	3588376-3588394	1	0.947
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	973232-973250	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2356496-2356514	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2617180-2617198	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	3780581-3780599	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	4441066-4441084	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	7455966-7455984	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	7596987-7597005	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	7950613-7950631	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	8168923-8168941	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	1588731-1588749	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	1732346-1732364	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2260059-2260077	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	2312456-2312474	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	3588349-3588367	2	0.895
NZ_CP044407_12	12.4\|7596951\|19\|NZ_CP044407\|CRISPRCasFinder	7596951-7596969	19	NZ_CP044407.1	3893388-3893406	2	0.895

1. spacer 6.1|4721561|51|NZ_CP044407|CRISPRCasFinder matches to position: 4721326-4721376, mismatch: 0, identity: 1.0

tgtgtttgtttgcaagaccctcggcgtcaggccccagggggccttccttca	CRISPR spacer
tgtgtttgtttgcaagaccctcggcgtcaggccccagggggccttccttca	Protospacer
***************************************************

2. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 7596978-7596996, mismatch: 0, identity: 1.0

acggcgtggacggcgcgga	CRISPR spacer
acggcgtggacggcgcgga	Protospacer
*******************

3. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 1073649-1073667, mismatch: 1, identity: 0.947

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgcgga	Protospacer
******.************

4. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2260041-2260059, mismatch: 1, identity: 0.947

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgcgga	Protospacer
******.************

5. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2260050-2260068, mismatch: 1, identity: 0.947

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgcgga	Protospacer
******.************

6. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 3588367-3588385, mismatch: 1, identity: 0.947

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgcgga	Protospacer
******.************

7. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 3588376-3588394, mismatch: 1, identity: 0.947

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgcgga	Protospacer
******.************

8. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 973232-973250, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgtggccgacgcgga	Protospacer
********* **.******

9. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2356496-2356514, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgtgcacggcgccga	Protospacer
******** ******* **

10. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2617180-2617198, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acgccgtcgacggcgcgga	Protospacer
*** *** ***********

11. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 3780581-3780599, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgaggacggcgagga	Protospacer
****** ******** ***

12. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 4441066-4441084, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcccggacggcgcgga	Protospacer
***** .************

13. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 7455966-7455984, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggtgtggtcggcgcgga	Protospacer
****.**** *********

14. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 7596987-7597005, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgcggacggcgtgga	Protospacer
******.********.***

15. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 7950613-7950631, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acgccgcggacggcgcgga	Protospacer
*** **.************

16. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 8168923-8168941, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acgtcgtggacggcgccga	Protospacer
*** ************ **

17. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 1588731-1588749, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcctcgacggcgcgga	Protospacer
***** * ***********

18. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 1732346-1732364, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcggggacggcgggga	Protospacer
****** ******** ***

19. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2260059-2260077, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcccggacggcgcgga	Protospacer
***** .************

20. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 2312456-2312474, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acgtcgtgggcggcgcgga	Protospacer
*** *****.*********

21. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 3588349-3588367, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgtgaacagcgcgga	Protospacer
********.**.*******

22. spacer 12.4|7596951|19|NZ_CP044407|CRISPRCasFinder matches to position: 3893388-3893406, mismatch: 2, identity: 0.895

acggcgtggacggcgcgga	CRISPR spacer
acggcgacgacggcgcgga	Protospacer
******  ***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP032322	Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence	86539-86564	2	0.923
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP023712	Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence	70680-70705	2	0.923
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP032346	Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence	77836-77861	2	0.923
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP012915	Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence	616956-616981	2	0.923
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP032340	Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence	1515417-1515442	2	0.923
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NC_017081	Phycisphaera mikurensis NBRC 102666 plasmid pPSMK1, complete sequence	24199-24224	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	806033-806058	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NC_004808	Streptomyces rochei plasmid pSLA2-L DNA, complete sequence	21003-21028	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP048281	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence	277032-277057	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP022666	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence	961727-961752	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP050086	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence	558863-558888	3	0.885
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_LR723678	Arsenite-oxidising bacterium NT-25 plasmid 2	171736-171761	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_FO082821	Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence	252957-252982	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP020399	Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence	271532-271557	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	511439-511464	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_AP022593	Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence	3581396-3581421	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP029830	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence	283707-283732	4	0.846
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_LR134467	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence	91749-91774	5	0.808
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_AP015030	Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence	68899-68924	5	0.808
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP020372	Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence	177875-177900	5	0.808
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_LR134468	Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence	102187-102212	6	0.769
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	853349-853374	6	0.769
NZ_CP044407_3	3.1\|2987938\|26\|NZ_CP044407\|CRISPRCasFinder	2987938-2987963	26	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	1301635-1301660	9	0.654

1. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP032322 (Azospirillum brasilense strain MTCC4035 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.923

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgtccgcggcaccgcggggcggcgg	Protospacer
***.******* **************

2. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP023712 (Rhodococcus ruber strain YC-YT1 plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.923

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gggcccgcgggcccgcggggcggcgg	Protospacer
* ******** ***************

3. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP032346 (Azospirillum brasilense strain MTCC4039 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.923

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgtccgcggcaccgcggggcggcgg	Protospacer
***.******* **************

4. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP012915 (Azospirillum brasilense strain Sp 7 plasmid ABSP7_p1, complete sequence) position: , mismatch: 2, identity: 0.923

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgtccgcggctccgcggggcggcgg	Protospacer
***.*******.**************

5. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP032340 (Azospirillum brasilense strain MTCC4038 plasmid p1, complete sequence) position: , mismatch: 2, identity: 0.923

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgtccgcggctccgcggggcggcgg	Protospacer
***.*******.**************

6. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NC_017081 (Phycisphaera mikurensis NBRC 102666 plasmid pPSMK1, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgcccgcggccccgggggccggcgc	Protospacer
*************** *** *****

7. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
ccgcccgcggccccgccggccggcgg	Protospacer
 *************** ** ******

8. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NC_004808 (Streptomyces rochei plasmid pSLA2-L DNA, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gcgtccgcggcgccgcggggcggcgc	Protospacer
***.******* *************

9. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP048281 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248e, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gagcccgcggccccgcgcgacggcgg	Protospacer
* *************** *.******

10. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP022666 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR1, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gagcccgcggccccgcgcgacggcgg	Protospacer
* *************** *.******

11. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP050086 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b7, complete sequence) position: , mismatch: 3, identity: 0.885

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gagcccgcggccccgcgcgacggcgg	Protospacer
* *************** *.******

12. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_LR723678 (Arsenite-oxidising bacterium NT-25 plasmid 2) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
acgcacgcagccccgcggggcggcgc	Protospacer
.*** ***.****************

13. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_FO082821 (Rhizobium sp. NT-26 plasmid NT26_p1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
acgcacgcagccccgcggggcggcgc	Protospacer
.*** ***.****************

14. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP020399 (Burkholderia multivorans strain FDAARGOS_246 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
ccgcccgcggccgcgccgggcggccg	Protospacer
 *********** *** ******* *

15. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
ccgcccccggccgcgcggggcggccg	Protospacer
 ***** ***** *********** *

16. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_AP022593 (Mycolicibacterium arabiense strain JCM 18538 plasmid pJCM18538, complete sequence) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
tcgcccgcggccgcgcggggcagcag	Protospacer
 *********** ********.**.*

17. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP029830 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.846

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
tcacccgcggctccgcggtgcggcgg	Protospacer
 *.********.****** *******

18. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_LR134467 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 25, complete sequence) position: , mismatch: 5, identity: 0.808

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
tcgcccgcggcaccgcggagcggctc	Protospacer
 ********** ******.*****

19. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_AP015030 (Pseudomonas putida strain KF715 plasmid pKF715A, complete sequence) position: , mismatch: 5, identity: 0.808

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
acgtccgcggccccgcggcgcggcca	Protospacer
.**.************** ***** .

20. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP020372 (Candidatus Thiodictyon syntrophicum strain Cad16T plasmid pTs485, complete sequence) position: , mismatch: 5, identity: 0.808

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
gggcacgcggccccgcggggcggacc	Protospacer
* ** ******************

21. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_LR134468 (Tsukamurella tyrosinosolvens strain NCTC13231 plasmid 26, complete sequence) position: , mismatch: 6, identity: 0.769

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
cgattcgcggccccgcggcgcggcgg	Protospacer
  ...************* *******

22. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 6, identity: 0.769

gcgcccgcggccccgcggggcggcgg	CRISPR spacer
ttcggcgcggcccggcggggcggcgg	Protospacer
 .   ******** ************

23. spacer 3.1|2987938|26|NZ_CP044407|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 9, identity: 0.654

gcgcccgcggccccgcggggcggcgg----	CRISPR spacer
----cggccgccccgcgcggccgggggcgg	Protospacer
    * ** ******** *** * **

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

4247581 : 4292691

Synechococcus_phage(25.0%)

integrase,holin,transposase

attL 4281599:4281614|attR 4293930:4293945

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151010499.1\|4247581_4247971_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_151010501.1\|4248706_4249366_+	HAD-IA family hydrolase	A0A1D8KNV9	Synechococcus_phage	2.9e-06	25.3
WP_151010503.1\|4249401_4251234_+	DNA helicase RecQ	A0A1V0SBK0	Catovirus	1.4e-77	34.9
WP_151010505.1\|4251322_4252330_+	esterase family protein	NA	NA	NA	NA
WP_151010507.1\|4252363_4253251_-	diiron oxygenase	NA	NA	NA	NA
WP_151010509.1\|4253355_4253817_-	macro domain-containing protein	A0A2L1IVW3	Streptomyces_phage	4.7e-27	47.5
WP_151010511.1\|4255238_4255664_+	hypothetical protein	NA	NA	NA	NA
WP_151010513.1\|4256058_4257663_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_151010515.1\|4257705_4258014_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_151010517.1\|4258153_4258372_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151010519.1\|4258533_4259496_-	C40 family peptidase	A0A1S5SEZ8	Streptococcus_phage	8.0e-13	37.0
WP_151010521.1\|4259529_4259808_-	excisionase family DNA-binding protein	NA	NA	NA	NA
WP_151010523.1\|4260039_4260480_+	hypothetical protein	NA	NA	NA	NA
WP_151010525.1\|4260467_4260761_+	hypothetical protein	NA	NA	NA	NA
WP_151010527.1\|4260757_4261468_+	hypothetical protein	NA	NA	NA	NA
WP_151010529.1\|4261563_4262880_+	hypothetical protein	NA	NA	NA	NA
WP_151010531.1\|4262842_4264345_+	hypothetical protein	NA	NA	NA	NA
WP_151010533.1\|4264390_4265812_+	hypothetical protein	NA	NA	NA	NA
WP_151010535.1\|4265823_4266444_-	hypothetical protein	NA	NA	NA	NA
WP_151010537.1\|4266524_4268333_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_151010539.1\|4268399_4268807_+	DUF4913 domain-containing protein	NA	NA	NA	NA
WP_151010541.1\|4268852_4269665_+	hypothetical protein	NA	NA	NA	NA
WP_151010543.1\|4269709_4270546_+	hypothetical protein	NA	NA	NA	NA
WP_151010545.1\|4270691_4271093_+	hypothetical protein	NA	NA	NA	NA
WP_151010547.1\|4271097_4271784_+	hypothetical protein	NA	NA	NA	NA
WP_151010549.1\|4271846_4272230_+	hypothetical protein	NA	NA	NA	NA
WP_151010551.1\|4272250_4273711_+	hypothetical protein	NA	NA	NA	NA
WP_151010553.1\|4274106_4275147_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_151010555.1\|4275364_4275943_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151010557.1\|4275939_4277370_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151010559.1\|4277562_4278018_+	hypothetical protein	NA	NA	NA	NA
WP_151010561.1\|4278295_4279198_+	ATP-binding protein	NA	NA	NA	NA
WP_151010563.1\|4279194_4279644_+	roadblock/LC7 domain-containing protein	NA	NA	NA	NA
WP_151018140.1\|4279709_4280036_+	DUF742 domain-containing protein	NA	NA	NA	NA
WP_151010565.1\|4279971_4280658_+	HAD family hydrolase	NA	NA	NA	NA
WP_151010567.1\|4280650_4281460_+	hypothetical protein	NA	NA	NA	NA
WP_151010569.1\|4281525_4282371_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
4281599:4281614	attL	NA	NA	NA	NA
WP_151010571.1\|4282399_4282960_-	N-acetyltransferase	NA	NA	NA	NA
WP_151010573.1\|4284083_4285331_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_151018141.1\|4286765_4287014_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_151010575.1\|4286977_4287313_-	hypothetical protein	NA	NA	NA	NA
WP_151018142.1\|4287546_4288134_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_151008099.1\|4288037_4288634_-	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151010577.1\|4288860_4289364_+	hypothetical protein	NA	NA	NA	NA
WP_151010579.1\|4289350_4290706_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_151010581.1\|4291569_4292691_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
4293930:4293945	attR	NA	NA	NA	NA

DBSCAN-SWA_2

7551479 : 7570938

Mycobacterium_phage(45.45%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151015871.1\|7551479_7551719_-	hypothetical protein	K4NZI5	Streptomyces_phage	7.3e-08	45.8
WP_151015873.1\|7551861_7552218_-	HNH endonuclease	A0A2H5BLP3	Streptomyces_phage	6.6e-05	42.0
WP_151015875.1\|7552902_7553361_+	hypothetical protein	NA	NA	NA	NA
WP_151015877.1\|7553508_7553706_+	hypothetical protein	NA	NA	NA	NA
WP_151015879.1\|7553773_7554169_+	PD-(D/E)XK nuclease family protein	J7KKY4	Mycobacterium_virus	9.2e-16	40.7
WP_151015881.1\|7554057_7554576_+	PD-(D/E)XK nuclease family protein	A0A1C9LYM3	Mycobacterium_phage	1.7e-14	37.4
WP_151015883.1\|7554623_7554887_+	hypothetical protein	NA	NA	NA	NA
WP_151015885.1\|7555026_7555848_+	hypothetical protein	A0A2H4PDK6	Mycobacterium_phage	2.7e-41	39.9
WP_151018453.1\|7555941_7556313_+	hypothetical protein	A0A1B3B151	Gordonia_phage	8.1e-22	47.5
WP_151015887.1\|7556377_7556761_+	hypothetical protein	G9FHN5	Rhodococcus_virus	1.3e-11	40.2
WP_151015889.1\|7556816_7557233_+	toprim domain-containing protein	A0A109QIR2	Mycobacterium_phage	3.0e-25	45.8
WP_151015891.1\|7557237_7557495_+	DUF3310 domain-containing protein	A0A222YY07	Mycobacterium_phage	6.0e-24	77.3
WP_151015893.1\|7557469_7558279_+	metallophosphoesterase family protein	A0A249XU40	Mycobacterium_phage	5.6e-68	52.8
WP_151015894.1\|7558310_7559039_+	sigma-70 family RNA polymerase sigma factor	G8IRD0	Mycobacterium_virus	2.3e-12	31.4
WP_151018454.1\|7559054_7561130_+	ribonucleoside-triphosphate reductase, adenosylcobalamin-dependent	A0A2P1JTQ6	Streptomyces_phage	8.9e-219	55.3
WP_151015896.1\|7561137_7561464_+	hypothetical protein	A0A2L1IW10	Streptomyces_phage	7.9e-05	37.6
WP_151015898.1\|7561581_7562094_+	hypothetical protein	A0A222ZKI3	Rhodococcus_phage	1.0e-14	54.9
WP_151018455.1\|7562398_7564162_+	hypothetical protein	A0A1P8VW08	Streptomyces_phage	2.0e-49	31.1
WP_151015900.1\|7564171_7564864_+	FAD-dependent thymidylate synthase	A0A2P1N1X6	Mycobacterium_phage	5.0e-57	53.4
WP_151015902.1\|7564856_7565084_+	hypothetical protein	NA	NA	NA	NA
WP_151015904.1\|7565094_7565286_+	hypothetical protein	NA	NA	NA	NA
WP_151015906.1\|7565394_7566051_+	hypothetical protein	A0A249XS09	Mycobacterium_phage	1.1e-40	46.4
WP_151015908.1\|7566281_7566503_+	hypothetical protein	NA	NA	NA	NA
WP_151015910.1\|7566499_7566883_+	DUF2493 domain-containing protein	H6U5L8	Mycobacterium_phage	1.1e-21	43.7
WP_151015912.1\|7566879_7567119_+	hypothetical protein	A0A2L1IVU9	Streptomyces_phage	1.2e-13	45.1
WP_151015914.1\|7567106_7567520_+	cell division protein DedD	W0LN94	Mycobacterium_phage	3.8e-36	56.5
WP_151015916.1\|7567697_7569212_-	recombinase family protein	H9NCR1	Mycobacterium_phage	9.5e-77	35.9
WP_151015918.1\|7569441_7569795_-	YraN family protein	NA	NA	NA	NA
WP_151018456.1\|7570038_7570938_+	tyrosine recombinase	A0A0K0MWE8	Gordonia_phage	4.0e-14	31.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044407

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection