CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP044411	Acidithiobacillus sp. 'AMD consortium' chromosome, complete genome	2 crisprs	DEDDh,cas3,csa3,PrimPol,DinG,RT,cas3HD,WYL	1	0	5	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP044411_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044411_1

923349-923447

Orphan

Consensus_repeat	Method
CGTAGTCGGCGTAATGGCGCCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044411_1

>merge|NZ_CP044411|1|923349-923447|CRISPRCasFinder
CGTAGTCGGCGTAATGGCGCCACCTTGGGATCGGCGTAATGGCGCCACTTCCGGATCGGCATAAAGGAGCCAGTTCGGAGTCGGCGTAATGGCGCCACC

>NZ_CP044411|1|1|923349-923447|CRISPRCasFinder
CGTAGTCGGCGTAATGGCGCCACC	TTGGGATCGGCGTAATGGCGCCACTTCCGGATCGGCATAAAGGAGCCAGTT
CGGAGTCGGCGTAATGGCGCCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044411.1\|WP_126605152.1\|926460_928950_-\|plasma-membrane-proton-efflux-P-type-ATPase	unknown	unknown	gnl\|CDD\|319771
NZ_CP044411.1\|WP_151528116.1\|925878_926418_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_126605157.1\|935702_935987_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_126605145.1\|913904_915302_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|341025
NZ_CP044411.1\|WP_126605149.1\|920724_920931_+\|heavy-metal-binding-protein	unknown	unknown	gnl\|CDD\|182635
NZ_CP044411.1\|WP_126605154.1\|930849_931743_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP044411.1\|WP_126605146.1\|915490_916876_-\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238233
NZ_CP044411.1\|WP_145987106.1\|919442_920240_+\|HAD-IC-family-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP044411.1\|WP_126605150.1\|921992_922955_-\|flippase-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|377103
NZ_CP044411.1\|WP_126605156.1\|934703_935021_-\|HigA-family-addiction-module-antidote-protein	unknown	unknown	gnl\|CDD\|274228
NZ_CP044411.1\|WP_113526787.1\|935037_935313_-\|plasmid-maintenance-system-killer	unknown	unknown	gnl\|CDD\|226079
NZ_CP044411.1\|WP_113527120.1\|921316_921622_+\|cytochrome-C	unknown	unknown	gnl\|CDD\|227001
NZ_CP044411.1\|WP_113526971.1\|920935_921175_+\|NrdH-redoxin	unknown	unknown	gnl\|CDD\|239274
NZ_CP044411.1\|WP_126605148.1\|920267_920663_+\|DUF302-domain-containing-protein	unknown	unknown	gnl\|CDD\|269820
NZ_CP044411.1\|WP_126605155.1\|931899_934329_-\|plasma-membrane-proton-efflux-P-type-ATPase	unknown	unknown	gnl\|CDD\|319771
NZ_CP044411.1\|WP_126605654.1\|925196_925859_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|366760
NZ_CP044411.1\|WP_126605153.1\|929512_930466_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|235548
NZ_CP044411.1\|WP_151528117.1\|935976_938001_-\|copper-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319850
NZ_CP044411.1\|WP_126605707.1\|913465_913675_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_113526975.1\|916889_918737_-\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238233

Protein	Function_ID	Function_description	E-value
NZ_CP044411.1\|WP_126605152.1\|926460_928950_-\|plasma-membrane-proton-efflux-P-type-ATPase	gnl\|CDD\|319771	cd02076, P-type_ATPase_H, plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+)-ATPases. This subfamily includes eukaryotic plasma membrane H(+)-ATPase which transports H(+) from the cytosol to the extracellular space, thus energizing the plasma membrane for the uptake of ions and nutrients, and is expressed in plants and fungi. This H(+)-ATPase consists of four domains: a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. This subfamily also includes the putative P-type H(+)-ATPase, MJ1226p of the anaerobic hyperthermophilic archaea Methanococcus jannaschii. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP044411.1\|WP_126605145.1\|913904_915302_-\|MFS-transporter	gnl\|CDD\|341025	cd17472, MFS_YajR_like, Escherichia coli inner membrane transport protein YajR and similar multidrug-efflux transporters of the Major Facilitator Superfamily. This family is composed of Escherichia coli inner membrane transport protein YajR and some uncharacterized multidrug-efflux transporters. YajR is a putative proton-driven major facilitator superfamily (MFS) transporter found in many gram-negative bacteria. Unlike most MFS transporters, YajR contains a C-terminal, cytosolic YAM domain, which may play an essential role for the proper functioning of the transporter. YajR-like transporters belong to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	3.00756e-134
NZ_CP044411.1\|WP_126605149.1\|920724_920931_+\|heavy-metal-binding-protein	gnl\|CDD\|182635	PRK10671, copA, copper-exporting P-type ATPase CopA.	1.03496e-13
NZ_CP044411.1\|WP_126605154.1\|930849_931743_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.33941e-43
NZ_CP044411.1\|WP_126605146.1\|915490_916876_-\|chloride-channel-protein	gnl\|CDD\|238233	cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel. The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function.	1.69546e-87
NZ_CP044411.1\|WP_145987106.1\|919442_920240_+\|HAD-IC-family-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	9.75368e-67
NZ_CP044411.1\|WP_126605150.1\|921992_922955_-\|flippase-like-domain-containing-protein	gnl\|CDD\|377103	pfam03706, LPG_synthase_TM, Lysylphosphatidylglycerol synthase TM region. LPG_synthase_TM is the N-terminal region of this family of bacterial phosphatidylglycerol lysyltransferases. The function of the family is to add lysyl groups to membrane lipids, and this region is the transmembrane domain of 7xTMs. In order to counteract attack by membrane-damaging external cationic antimicrobial molecules - from host immune systems, bacteriocins, defencins, etc - bacteria modify their anionic membrane phosphatidylglycerol with positively-charged L-lysine; this results in repulsion of the foreign cationic peptides.	9.26277e-14
NZ_CP044411.1\|WP_126605156.1\|934703_935021_-\|HigA-family-addiction-module-antidote-protein	gnl\|CDD\|274228	TIGR02607, Virulence-associated_protein_I, addiction module antidote protein, HigA family. Members of this family form a distinct clade within the larger family HTH_3 of helix-turn-helix proteins, described by pfam01381. Members of this clade are strictly bacterial and nearly always shorter than 110 amino acids. This family includes the characterized member HigA, without which the killer protein HigB cannot be cloned. The hig (host inhibition of growth) system is noted to be unusual in that killer protein is uncoded by the upstream member of the gene pair. [Regulatory functions, DNA interactions, Regulatory functions, Protein interactions, Mobile and extrachromosomal element functions, Other].	7.30869e-36
NZ_CP044411.1\|WP_113526787.1\|935037_935313_-\|plasmid-maintenance-system-killer	gnl\|CDD\|226079	COG3549, HigB, Plasmid maintenance system killer protein [General function prediction only].	4.22414e-19
NZ_CP044411.1\|WP_113526971.1\|920935_921175_+\|NrdH-redoxin	gnl\|CDD\|239274	cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile. In vitro, it displays protein disulfide reductase activity that is dependent on TRX reductase, not glutathione (GSH). It is part of the NrdHIEF operon, where NrdEF codes for class Ib ribonucleotide reductase (RNR-Ib), an efficient enzyme at low oxygen levels. Under these conditions when GSH is mostly conjugated to spermidine, NrdH can still function and act as a hydrogen donor for RNR-Ib. It has been suggested that the NrdHEF system may be the oldest RNR reducing system, capable of functioning in a microaerophilic environment, where GSH was not yet available. NrdH from Corynebacterium ammoniagenes can form domain-swapped dimers, although it is unknown if this happens in vivo. Domain-swapped dimerization, which results in the blocking of the TRX reductase binding site, could be a mechanism for regulating the oxidation state of the protein.	1.51565e-16
NZ_CP044411.1\|WP_126605148.1\|920267_920663_+\|DUF302-domain-containing-protein	gnl\|CDD\|269820	cd14797, DUF302, Uncharacterized domain family DUF302. These domains are mostly found in bacterial single-domain proteins and have been shown to form homodimers; they may also bind zinc. Also characterized as COG3439.	5.85759e-46
NZ_CP044411.1\|WP_126605155.1\|931899_934329_-\|plasma-membrane-proton-efflux-P-type-ATPase	gnl\|CDD\|319771	cd02076, P-type_ATPase_H, plant and fungal plasma membrane H(+)-ATPases, and related bacterial and archaeal putative H(+)-ATPases. This subfamily includes eukaryotic plasma membrane H(+)-ATPase which transports H(+) from the cytosol to the extracellular space, thus energizing the plasma membrane for the uptake of ions and nutrients, and is expressed in plants and fungi. This H(+)-ATPase consists of four domains: a transmembrane domain and three cytosolic domains: nucleotide-binding domain, phosphorylation domain and actuator domain, and belongs to the P-type ATPase type III subfamily. This subfamily also includes the putative P-type H(+)-ATPase, MJ1226p of the anaerobic hyperthermophilic archaea Methanococcus jannaschii. The P-type ATPases, are a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP044411.1\|WP_126605654.1\|925196_925859_+\|ATP-binding-protein	gnl\|CDD\|366760	pfam01695, IstB_IS21, IstB-like ATP binding protein. This protein contains an ATP/GTP binding P-loop motif. It is found associated with IS21 family insertion sequences. The function of this protein is unknown, but it may perform a transposase function.	3.77072e-53
NZ_CP044411.1\|WP_126605153.1\|929512_930466_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|235548	PRK05657, PRK05657, RNA polymerase sigma factor RpoS; Validated.	1.63567e-100
NZ_CP044411.1\|WP_151528117.1\|935976_938001_-\|copper-translocating-P-type-ATPase	gnl\|CDD\|319850	cd07552, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to Archaeoglobus fulgidus CopB, a Cu(2+)-ATPase. Archaeoglobus fulgidus CopB transports Cu(2+) from the cytoplasm to the exterior of the cell using ATP as energy source, it transports preferentially Cu(2+) over Cu(+), it is activated by Cu(2+) with high affinity and partially by Cu(+) and Ag(+). This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP044411.1\|WP_113527120.1\|921316_921622_+\|cytochrome-C	gnl\|CDD\|227001	COG4654, COG4654, Cytochrome c551/c552 [Energy production and conversion].	7.3336e-11
NZ_CP044411.1\|WP_113526975.1\|916889_918737_-\|chloride-channel-protein	gnl\|CDD\|238233	cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel. The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function.	1.73709e-108

>NZ_CP044411.1|WP_126605150.1|921992_922955_-|flippase-like-domain-containing-protein
MILVIALGVSLIPLFLFINRQTLQLLLNIPPLILLVMVTLMLISWIFEGARLRILCSLLHIGLALHRSMGIVMAAEFAGAATPAASGMGVAYILFLRRRGVDIGHSGGLLVLIIIFDLLFIILLFSGATLIMVSASRHVPNLSAFVTLLITVLSTFIIAILAWHIEHRRLLLWIDYLLRQVRWYRRHRFSVARSVHRFARAAGLIKTMNWRHRWLIFGSTAGYWLPRYLILWILMAYAGVVVSVPYLIVSQTLLNLTVQLSILPGGAGTVGAAYALLFGSTMARGDVGFSLLGWRFFTYYWYLLVGAPWFFLELKSGFQG
>NZ_CP044411.1|WP_113527120.1|921316_921622_+|cytochrome-C
MVAVQHSLPRQAPAAISRYGCMSCHAVGHGVVGPAFEWVAWKYQKQPDALARVSSFIEHGGTSTWGGMMPDLNVPDATARDIAQWILKLKPVQPPQTQGEH
>NZ_CP044411.1|WP_113526971.1|920935_921175_+|NrdH-redoxin
MAKVLLYTSPGCPDCAAVKRYLEMHGVAFDERDVTAPGVAEEAKSRYGVRVAPITVIDGGALYGTFAEQKSRLDAAFGG
>NZ_CP044411.1|WP_126605149.1|920724_920931_+|heavy-metal-binding-protein
MSETHLKITGMTCGHCVRAVTKALEGVSCVEKADVALTPGEAVVHGQASAAALIAAVKEEGYDAAVQD
>NZ_CP044411.1|WP_126605148.1|920267_920663_+|DUF302-domain-containing-protein
MSQFVFSVPAKGDFETTVAQVTAALKVEGFGVLTTIDVAATLKAKLGIEGQPYVILGACNPHYAHQALEADPDIGALLPCNVVVRTEADGSVSVVFMDPAAVLGMVDRPQITALGIEVRDKLQRVADAVRG
>NZ_CP044411.1|WP_145987106.1|919442_920240_+|HAD-IC-family-P-type-ATPase
MASMFIMDIWSVIARLSAASVNVTYSWLCREEVHLMDDKTGGHLEIGIDGMTCASCSTRVERALGKLPGVTSANVNLATERAEVLFDPQQLDAARIAEAIRESGYTPAEVLPQDKAKVVTQLQEQCRRVAFIGDGINDAPALAQANVGIALASGTDIVIEAAEVTLSRRQLGEVVTALTAARRTLSNIRGNLFWAFFYNILLIPVAAGVAAPIGIHLNPMVAGVAMGLSSVFVLSNSLPLKRLKAYVPTVTPGAVQNTALEPAHS
>NZ_CP044411.1|WP_113526975.1|916889_918737_-|chloride-channel-protein
MVNDASLPANMDTLVMERNVQGWQGVFRTNPAFHLVLAFFVGIVAGLGAVAFRRLIGLMHNAFFFGQISSSFDDLQHSAASFWGLGVVLVPVLGGLVVVWLVRTFAPEAKGHGVPEVMDAIYYGSGVIRPVVVLVKALASSISIGSGGSVGREGPIIQIGAAFGSSLAQWLRLQEWQRLGLIAAGAGAGIAATFNTPVGGILFAIELMLVEVSARTLVPVMIATGTAAFVSRLFLGDYPSFIISQHIINRTMHQSAGAYAAYVLLGLLAGGAGLLFTSSLYWTEARFERWIKNPYARHAAGMLGVGLVIYFMITFTGHYYVEGVGYATVQDILDGVITQPGFLLLLLLLKILTFSVTLGSGGSGGVFSPSLYVGAVLGGLYAVIANHLLPGIGISMTIAAALGMAGMVAASTGAAVTGAVMIFEMTSDYHIIIPLIIVASLAFGVRRLITRETIYTRKLIRRGHFIPEARHSNLYLMRPAGEFMETPLIRVKGNRTLADIAVLLHRGREIPHILVLEGTQPRAVLTAPRVRELLRHRQTSTPIENFASEDWFSVPVDCQIYDLVARFRATHQECALLCRIDPPLHHEDVIAIVTIEDVLAYTSLPMRLLRPHAAQ
>NZ_CP044411.1|WP_126605146.1|915490_916876_-|chloride-channel-protein
MKPSAWFHRSFGPHHEGPGLILLGAGVGLLAGLGAVLFHYLIAGIHNAAILGSYGIVQNAREHTPVSPWGAWIILVPVVGALLVTVLVRNFAPEAQGAGVSQVLRAVHADRGQMRPVIAIMRPVATAITIGTGGSAGREGPAMQFGAAIGAMVGHLFRVPDHRRIHLLGCGVGAGIAAVFNAPLGGWFLAMEVIVPDWRPWTVLSTLVATASASWVTQEVFGNGHLFAHADISHWNGSLMLPTFAVLGSFMALMSIGFIRLMDGVDAYSRQLLQNPYTRHMSGMLLVGILIYLTDRLTGHYYLIGGSYAGISDVLVQQIQWPLLLLILLVLKAVATSLTIGTGGSGGIFSPSLFMGAALGSCLGMLLEPVIGVPHLAALFALCGMAGMVAATTGALLSAPVMVVELTGNYHVLLPAMVTALTAFAVRRVFLQDSIYTLPLHREGLPVPENHYIVEEKMDDK
>NZ_CP044411.1|WP_126605145.1|913904_915302_-|MFS-transporter
MTTSQNALDGRERRSIIALAGIFGLRLLGLFLVLPVFSVYAHGLHGAMRHPVLIGIALGAYGLTQAIFQIPFGRLSDKWGRKPVIAVGLLIFAIGSVIAAQATSIEWLLVGRIIQGAGAVAAAIIALTADLVREERWTKAMATIGITIGISFSVSLVLSAPLAQWIGVQGIFWLTAALSILAIGVLYKVIPAVPARFHRDAEMNPAALKDVLRNPNLLRLDFGIFSLHTGLTALFVVLPLVLIDPQHPLLSEADQWMLYLPVMLLSFVAMIPFIIVGEAKHRLREVFVLAIAILLAAVVWMALSNHSIWSIAIALFLFFVGFNVLEASLPSLVAKFCHPGAKGTATGVYTTAEFLGAFSGGLLGGLLYLPGQHNYSDVFWAVAAIYLVWLIVALTMQQPRYVATRIFPLPADSQDNSQLTRQLLQLPGVVEVAIFPDENAVYCKVESKIYDDERVRSIIGYASQT
>NZ_CP044411.1|WP_126605707.1|913465_913675_-|hypothetical-protein
MSKSMIKAIKYFLFFSITPAVGILVYFSFKFFGIDIAFKYIIYLLILILFVKIIVGGVVITVLKKAKEG
>NZ_CP044411.1|WP_126605654.1|925196_925859_+|ATP-binding-protein
MLLQDEVARRDQRKFDTLLRQAHFRNHKTLEDFAFDRLPNLNRSLVHDLATGRYLQEQAPILIVGPCGTGKSHLAQALGHCAIRQGVDVLFITQGDLVGSLHAARATGGFDRRFRQLAKVTLLIIDDFGLKPMRPPHDEDFHDLIAERYERVSTMLTSNLDFAEWGDVFPANRMLGVATLDRLRHGAYRLILEGDSFRAPRPLPESPKNTIAKGAKNTHS
>NZ_CP044411.1|WP_151528116.1|925878_926418_-|hypothetical-protein
MAGSHPAYADMPEDSIITNGFWLGKSAGFSIRPYRNADRAKIRHICCETGFLGNPIDAIFCDRELFADLMVNPYLDYAEDWAYVATHNGRVVGYLLGAPPSFDRYLVYAGSAATLRMLLKSVSGAYAHHPRSSQFVEWLLTHSFRERPRRPRQAAHMHLSLTGNMAPPMCGVMAPFQSA
>NZ_CP044411.1|WP_126605152.1|926460_928950_-|plasma-membrane-proton-efflux-P-type-ATPase
MTDPDKTPPIEKTLADLHASPAGLTSNEAQQRLQQYGPNALQEKKVSPLMRFLHYFWGPIPWMIEVAAILSAAVGHWADLTIISLLLLFNAGIGFWQEYKASSALEALKSQLALKARVLRDNQWQEILAADLVPGDVIRIRLGDIIPADVQLLEGDYLSADQSALTGESLPVSKKVADVAYSGTIVKQGEMVAVITATGMNTFFGKTAGLVQKAGAVSHFQKAVLRIGDYLIYIALGLVAVLITVEMFRGQAFLTLLQFALILTVASIPVAMPAVLSVTMALGALRLSRMKAIVTRLQSIEEMAGAQILCSDKTGTLTQNKLTLGPLEPTAGIGEEDVLRAAALASKAEDQDTIDLAVLGAVQDPQLLAGWEQTHFTPFDPVGKRTEAQVKDSSGQEWTVTKGAPQVILGLCHLSKPLLQQTQGRVQALAGKGYRTLGVARKSGSEDWQFLGIVPLFDPPREDSRDTIAQAEAHGIHVKMVTGDNGAIAKEIAGQLGLGTNILPADEVFGKRMDGGHLPPQLRQRIADADGFAQVFPEHKYDIVKALQSDGYLVAMTGDGVNDAPALKQADVGIAVSGATDAARAAAALVLMAPGLNVIIRAVEEARRIFERMNSYAIYRIVETIRIMVFVVLAMLIFDFYPITAIMIILLAFFNDVPIMAIATDNTWLDPKPVRWDMHRVLTVSTVLGLIGVVETFGMLLIAKDYFHMGIPHLQTLIFLKLAVAGHLTLFIARTRSSFLKKPYPSAILLWSAILTKAAATLFVVYPMGLVPSITWGEAGAVWIYCILWIFIEDWAKIRVYKHLEFDTPRHRDFVDRLNQPLMGPISSR
>NZ_CP044411.1|WP_126605153.1|929512_930466_-|sigma-70-family-RNA-polymerase-sigma-factor
MLTGDTDWDIPDTLEEEITEVGQGEACLRPETPEFDSTADLAWEAGPPDHVDAIRLYLQEIGHNPLLTAEEEVSLGLKIQQGDLAARNRLVECNLRLVVRIARRYQRQHTLPLLDLIEEGNLGLIRAAELFDPARGFRFSTYAAWWIREGIERGIMNQSRVVRLPIHIIKNLSAVLRSSRQIAQTMQGEPRVEEVAQVMGKSVAHVKDCLQQDRHMVSLDAPSRWEGSPSLAQTLVDADQSGLETSLEEQDVQRQIQRALLRLDMRHRTVLIRRFGMDGEEGETLSAISKELGVSHERVRQLQEEALELLRQYAELQ
>NZ_CP044411.1|WP_126605154.1|930849_931743_+|LysR-family-transcriptional-regulator
MKIDAEQLLTLLAVAETGSVSEAALRLERGQPAISERLHKLTREIGEPLYVREGGGIQLTPVGQALIPDIRQLRAKLQDIENLLLRQKSLQAGELHIASTSLIANYLLPQYLQSFQSQNPGVNLYIKSGVTYWGDINLSKLDVFFFEGEMDIPHLPDSYEIQPWLTGEIVAVMPKTHPLASVSVLSLEDIQPFPVVWREPSSGVRRRLEKAFRQKNIVPAHFIEVADVESVGAMVKAGLGIGFMTHTVFEQRPDWDLLYKPLSSSQLIWRSFMAIPNPARRSRALSVFLDLMGSIPF
>NZ_CP044411.1|WP_126605155.1|931899_934329_-|plasma-membrane-proton-efflux-P-type-ATPase
MTINPDPTSAPDIPAVVRQLQSDTRRGLSAAEASRRLAQYGANAIPEKRLSPICQFLGYFWGPIPWMIEIAAVLSAVVAHWADFAIIMTLLLVNAGVGFWQEHKAGNAIAMLQRKLALRARVLRDGLWQEIAAQDLVPGDIILLKLGNIVPADVLLLSGDYLSVDQSVLTGESLPVDKGRGDSAYSGSIVGKGEMQGLVTATGLQTFFGKTAQLVERAESVSHFRKAVLAIGNFLIVSALVLIAVILFVALAIRHEPMIRTILFALVLTVAAIPVALPAVLSVTMAVGAERLARLKAIVSRLVAIEEMAGMDVLCADKTGTLTQNRLTLGEPVVIGARDAEELILAAALASERDTGDPIDTAVLGGLPVSAPLASYSVLKYQPFDPVSKRSEAEVAAGVERFRVAKGAPQVILDLAQPDVGIRQTVTRQIDALAGKGYRTLGVARKDEDGAWRFLGLLPLFDPPREDSAQTIAAGQRMGIEIKMVTGDHLAIAKQVSMLLHLGQSIVPAEALSTDANAAQVQAEKADGFAQVFPEHKFAIVKALQARGHIVGMTGDGVNDAPALKQADVGIAVSGATDAARAAADLVLTAPGLTVIVGAVQEARRIFARMNSYAIYRIAETIRVLLFMTLSILVFDFYPVTAVMIVMIALLNDFPIMMIAYDNAPTAPQPVRWDMTRVLIISILLGVLGVVASFFLFWIAETYLHLPAGVIRTLIFLKLLVAGHLTIFLTRNTGAIWQRPWPSWSFFNVTIATKIIGTFAAVYGWLIPPIGWGYALLVWAYSLAWFFVNSGAKIIAYRTLEAYRKSPTH
>NZ_CP044411.1|WP_126605156.1|934703_935021_-|HigA-family-addiction-module-antidote-protein
MDEMTVEQVDRTPTHPGEILREEVLPALDISVAEFARGLRVSRQTVHGILSERKGITPEMALRIGKYLGNGPGIWLRMQQAYDLTIAERRLAEELAAIHKPEQAA
>NZ_CP044411.1|WP_113526787.1|935037_935313_-|plasmid-maintenance-system-killer
MIRSFVHKGLKQVFETGQSAKVGADLVTRCKRRLDAINAAVSPEELNVPGFDFHALEGKPKRYTVYVNGPYCITFEWREGDAWRVDLENYH
>NZ_CP044411.1|WP_126605157.1|935702_935987_+|hypothetical-protein
MLLGEFAQGAGLHRWLEREMPKPGLSLIIAAVIIGSSLNMAVHSGPHYLGIPLQGLIGYSVASALGLWWVTAILRSGSSEQATCWLLVDPCARW
>NZ_CP044411.1|WP_151528117.1|935976_938001_-|copper-translocating-P-type-ATPase
MDHSGHQEHGMGNAHPGAHGGHNHGAMIADFRRRFWVSLALTIPILLLSPLIQRLLGLEAALAFTGSSYVLFALSSGVYFYGGWPFLKGLFAELETRKPAMMTLIALAISVAYFYSSAVVFGVQGEVFFWELATLIDVMLLGHWIEMKSVLGASGALEKLVQMMPSEAHLVTPEGMKDVPVANLQRGDRVLVKPGEKIPTDGRVIEGQTTINQAMLTGESQPVEKGDGDEVIGGSVNGESSITVEVHKTGSETYLSQVIEMVRRAQESRSRTQDLADRAALVLTLTALSVGGLTLAIWLVLGQHFEFALARMVTVMVIACPHALGLAIPLVVAVSTAMAAQHGLLIRDRSAFERARQLQAVVFDKTGTLTEGRFGVTDVVVLGGYAEDEVVRLAAALESQSEHPIAAGIVAYAKAKGIGFEPPKEFKAIPGKGAQAVVNGRNVKVVSPGYLKESGLDVSDKRIAALASQGKTVIYLLVDEKPEGAVALADIIRAESREALARLKGMGVQVMMLTGDSAAVARWVAQEMGLDDYFAEVLPGQKAEKIKEVKARGLRVAMVGDGVNDAPALVEADVGIAIGAGTDVAIESADIVLVRSDPRDVAAILELSRATYRKMIQNLWWGAGYNIVAIPLAAGVAYSVGLVLSPAVGAALMSISTVIVAINAKLLQRVRLTT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP044411_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP044411_2

1363070-1363161

Orphan

Consensus_repeat	Method
CCTGGTCAGTACAACAACGGCTACGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP044411_2

>merge|NZ_CP044411|2|1363070-1363161|CRISPRCasFinder
CCTGGTCAGTACAACAACGGCTACGGCAATCCACCACCGCCGCCACCTCCTCCTCCCGGTCAGGGGCCTGGTCAGTACAACAATGGCTACGG

>NZ_CP044411|2|2|1363070-1363161|CRISPRCasFinder
CCTGGTCAGTACAACAACGGCTACGG	CAATCCACCACCGCCGCCACCTCCTCCTCCCGGTCAGGGG
CCTGGTCAGTACAACAATGGCTACGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP044411.1\|WP_012536707.1\|1356187_1357204_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|274292
NZ_CP044411.1\|WP_012536711.1\|1359643_1362130_+\|TraM-recognition-domain-containing-protein	unknown	unknown	gnl\|CDD\|237540
NZ_CP044411.1\|WP_009564689.1\|1353222_1354080_+\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|378343
NZ_CP044411.1\|WP_080515401.1\|1366726_1367731_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP044411.1\|WP_012607192.1\|1373466_1373724_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_012536709.1\|1358677_1358980_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_080515400.1\|1351780_1352779_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176111
NZ_CP044411.1\|WP_009564688.1\|1354389_1355058_+\|type-IV-secretion-system-protein	unknown	unknown	gnl\|CDD\|377310
NZ_CP044411.1\|WP_012536708.1\|1357206_1358667_+\|TrbI/VirB10-family-protein	unknown	unknown	gnl\|CDD\|319755
NZ_CP044411.1\|WP_009562016.1\|1372239_1373139_-\|GTP-binding-protein	unknown	unknown	gnl\|CDD\|197226
NZ_CP044411.1\|WP_012536720.1\|1375047_1375818_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP044411.1\|WP_012536710.1\|1358976_1359633_+\|lytic-transglycosylase-domain-containing-protein	unknown	unknown	gnl\|CDD\|381613
NZ_CP044411.1\|WP_049756718.1\|1364292_1366788_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP044411.1\|WP_009566825.1\|1367868_1368579_-\|PilZ-domain-containing-protein	unknown	unknown	gnl\|CDD\|377796
NZ_CP044411.1\|WP_009569339.1\|1362239_1362434_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_054609017.1\|1373807_1375046_-\|ParB/RepB/Spo0J-family-partition-protein	unknown	unknown	gnl\|CDD\|319251
NZ_CP044411.1\|WP_009563488.1\|1375796_1376237_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_054609015.1\|1355070_1356186_+\|conjugal-transfer-protein	unknown	unknown	gnl\|CDD\|377058
NZ_CP044411.1\|WP_009562011.1\|1371813_1372002_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP044411.1\|WP_012536716.1\|1368749_1371389_-\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|236645

Protein	Function_ID	Function_description	E-value
NZ_CP044411.1\|WP_012536707.1\|1356187_1357204_+\|conjugal-transfer-protein	gnl\|CDD\|274292	TIGR02775, probable_conjugal_transfer_protein_TrbG, P-type conjugative transfer protein TrbG. The TrbG protein is found in the trb locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for plasmid conjugative transfer. TrbG is a homolog of the F-type TraK protein (which is believed to be an outer membrane pore-forming secretin, TIGR02756) as well as the vir system VirB9 protein. [Cellular processes, Conjugation].	7.61925e-11
NZ_CP044411.1\|WP_012536711.1\|1359643_1362130_+\|TraM-recognition-domain-containing-protein	gnl\|CDD\|237540	PRK13880, PRK13880, conjugal transfer coupling protein TraG; Provisional.	8.85065e-174
NZ_CP044411.1\|WP_009564689.1\|1353222_1354080_+\|DUF2236-domain-containing-protein	gnl\|CDD\|378343	pfam09995, DUF2236, Uncharacterized protein conserved in bacteria (DUF2236). This domain, found in various hypothetical bacterial proteins, has no known function. This family contains a highly conserved arginine and histidine that may be active site residues for an as yet unknown catalytic activity.	0.00441316
NZ_CP044411.1\|WP_080515401.1\|1366726_1367731_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	4.902e-53
NZ_CP044411.1\|WP_080515400.1\|1351780_1352779_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176111	cd08419, PBP2_CbbR_RubisCO_like, The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold. CbbR, a LysR-type transcriptional regulator, is required to activate expression of RubisCO, one of two unique enzymes in the Calvin-Benson-Bassham (CBB) cycle pathway. All plants, cyanobacteria, and many autotrophic bacteria use the CBB cycle to fix carbon dioxide. Thus, this cycle plays an essential role in assimilating CO2 into organic carbon on earth. The key CBB cycle enzyme is ribulose 1,5-bisphosphate carboxylase/oxygenase (RubisCO), which catalyzes the actual CO2 fixation reaction. The CO2 concentration affects the expression of RubisCO genes. It has also shown that NADPH enhances the DNA-binding ability of the CbbR. RubisCO is composed of eight large (CbbL) and eight small subunits (CbbS). The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.6623e-111
NZ_CP044411.1\|WP_009564688.1\|1354389_1355058_+\|type-IV-secretion-system-protein	gnl\|CDD\|377310	pfam04335, VirB8, VirB8 protein. VirB8 is a bacterial virulence protein with cytoplasmic, transmembrane, and periplasmic regions. It is thought that it is a primary constituent of a DNA transporter. The periplasmic region interacts with VirB9, VirB10, and itself. This family also includes the conjugal transfer protein family TrbF, a family of proteins known to be involved in conjugal transfer. The TrbF protein is thought to compose part of the pilus required for transfer. This domain has a similar fold to the NTF2 protein.	2.40066e-35
NZ_CP044411.1\|WP_009566825.1\|1367868_1368579_-\|PilZ-domain-containing-protein	gnl\|CDD\|377796	pfam07238, PilZ, PilZ domain. PilZ is a c-di-GMP binding domain which is found C terminal to pfam07317. Proteins which contain PilZ are known to interact with the flagellar switch-complex proteins FliG and FliM. This interaction results in a reduction of torque generation and induces CCW motor bias. This domain forms a beta barrel structure.	0.0053367
NZ_CP044411.1\|WP_012536710.1\|1358976_1359633_+\|lytic-transglycosylase-domain-containing-protein	gnl\|CDD\|381613	cd16892, LT_VirB1-like, VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).	1.29002e-47
NZ_CP044411.1\|WP_049756718.1\|1364292_1366788_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.91281e-59
NZ_CP044411.1\|WP_012536708.1\|1357206_1358667_+\|TrbI/VirB10-family-protein	gnl\|CDD\|319755	cd16429, VirB10, VirB10 forms part of core complex in Type IV secretion system (T4SS). This family contains VirB10, a component of the type IV secretion system (T4SS), including homologs TrbI, TraF, TrwE and TraL. T4S system is employed by pathogenic bacteria to export virulence DNAs and/or proteins directly from the bacterial cytoplasm into the host cell. It forms a large multiprotein complex consisting of 12 proteins termed VirB1-11 and VirD4. VirB10, interacts with VirB7 and VirB9, forming the membrane-spanning 'core complex' (CC), around which all other components assemble. The CC is inserted in both, the outer and inner membranes, playing a fundamental role as a scaffold for the rest of the T4SS components and actively participating in T4S substrate transfer through the bacterial envelope via conformational changes regulating channel opening and closing. TrwE in R33 plasmid has been shown to be anchored to the inner membrane and its C-terminal is necessary for conjugation; the transmembrane domains of TrwB and TrwE are involved in TrwB-TrwE interactions. TraF protein of the RP4 plasmid is involved in circularization of pilin subunits of P-type pili. In gonococcal genetic island (GGI) of Neisseria gonorrhoeae, T4SS encodes TrbI and circularization occurs via a covalent intermediate between the C terminus of putative pilin protein TraA and TrbI.	3.04363e-69
NZ_CP044411.1\|WP_012536720.1\|1375047_1375818_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.63425e-38
NZ_CP044411.1\|WP_054609017.1\|1373807_1375046_-\|ParB/RepB/Spo0J-family-partition-protein	gnl\|CDD\|319251	cd16393, SPO0J_N, Thermus thermophilus stage 0 sporulation protein J-like N-terminal domain, ParB family member. Spo0J (stage 0 sporulation protein J) is a ParB family member, a critical component of the ParABS-type bacterial chromosome segregation system. The Spo0J N-terminal region acts in protein-protein interaction and is adjacent to the DNA-binding domain that binds to parS sites. Two Spo0J bind per parS site, and Spo0J interacts with neighbors via the N-terminal domain to form oligomers via an Arginine-rich patch (RRXR). This superfamily represents the N-terminal domain of ParB, a DNA-binding component of the prokaryotic parABS partitioning system. parABS contributes to the efficient segregation of chromosomes and low-copy number plasmids to daughter cells during prokaryotic cell division. The process includes the parA (Walker box) ATPase, the ParB DNA-binding protein and a parS cis-acting DNA sites. Binding of ParB to centromere-like parS sites is followed by non-specific binding to DNA ("spreading", which has been implicated in gene silencing in plasmid P1) and oligomerization of additional ParB molecules near the parS sites. It has been proposed that ParB-ParB cross-linking compacts the DNA, binds to parA via the N-terminal region, and leads to parA separating the ParB-parS complexes and the recruitment of the SMC (structural maintenance of chromosomes) complexes. The ParB N-terminal domain of Bacillus subtilis and other species contains a Arginine-rich ParB Box II with residues essential for bridging of the ParB-parS complexes. The arginine-rich ParB Box II consensus (I[VIL]AGERR[FYW]RA[AS] identified in several species is partially conserved with this family and related families. Mutations within the basic columns particularly debilitate spreading from the parS sites and impair SMC recruitment. The C-terminal domain contains a HTH DNA-binding motif and is the primary homo-dimerization domain, and binds to parS DNA sites. Additional homo-dimerization contacts are found along the N-terminal domain, but dimerization of the N-terminus may only occur after concentration at ParB-parS foci.	1.60591e-30
NZ_CP044411.1\|WP_054609015.1\|1355070_1356186_+\|conjugal-transfer-protein	gnl\|CDD\|377058	pfam03524, CagX, Conjugal transfer protein. This family includes type IV secretion system CagX conjugation protein. Other members of this family are involved in conjugal transfer to plant cells of T-DNA.	2.07449e-24
NZ_CP044411.1\|WP_009562016.1\|1372239_1373139_-\|GTP-binding-protein	gnl\|CDD\|197226	cd09128, PLDc_unchar1_2, Putative catalytic domain, repeat 2, of uncharacterized phospholipase D-like proteins. Putative catalytic domain, repeat 2, of uncharacterized phospholipase D (PLD, EC 3.1.4.4)-like proteins. PLD enzymes hydrolyze phospholipid phosphodiester bonds to yield phosphatidic acid and a free polar head group. They can also catalyze transphosphatidylation of phospholipids to acceptor alcohols. Members of this subfamily contain two HKD motifs (H-x-K-x(4)-D, where x represents any amino acid residue) that characterizes the PLD superfamily. The two motifs may be part of the active site and may be involved in phosphatidyl group transfer.	7.6164e-39
NZ_CP044411.1\|WP_012536716.1\|1368749_1371389_-\|EAL-domain-containing-protein	gnl\|CDD\|236645	PRK10060, PRK10060, cyclic di-GMP phosphodiesterase.	2.70464e-108

>NZ_CP044411.1|WP_009569339.1|1362239_1362434_+|hypothetical-protein
MNAVLPSIISEFETAEQEASYTAWLRTKVASSLADQRPSIPHDEVMAEMDAIIAEAETSAQRKF
>NZ_CP044411.1|WP_012536711.1|1359643_1362130_+|TraM-recognition-domain-containing-protein
MTEKIHAPDRSVSDYKVQRLARGGRLKTTLAGVAAGVLGYTLGISYVARDVFPGYQWTDDFIQKAHAYIALPYGWRLYDPLPFLRPMILNIHYPVIHQAFYDAGLPAVVLGILTAGILGKKHKDAQKAVLDNPVHGSAHWAGKSDAIRAALLPSPPPKTVMDSLRPWLGMHPAKGMHPAKGLHPAKGLKGGSDWARWNDRQEKRKKEAAEWRKRRAEREKKRLSEIPEPTVFDRFDSPHVCYVGAFVENGAATPLQHTGAEHILVFAPTRSGKGVGLVLPTLLDGWMDSVVVHDIKGENFNLTAGYRKAMGHHILKFSPGSVSEEGCHFNPLDAVRVGTQYEVKDVMNIATMIVDPDGKGLNDHWQKTGFALLTSIILHVLYAMPDKTLRGVAAYLNDPTLESVDVAFERMMQTEHDPDEQYGWRDGNGQCSRVHPVIAQSAREMLNKAENEKSGVISTMMSFLSLYRDPIVAKWTEYSDFRIADLQDAEQPVSLYLVTSPEDKNRLKPLIRLVLNQIASQFTAEERLEAKDGRIVAKGKHRLLLLLDEFPSLGKLDVFLDSIAFLAGYNVKLYLITQDIAQLEDEGHGYGKAGAKTIIGNCHIRAAYAPNQVETAKWISDMLGTRTVTMENDNQSFDGSLFGQNKGYSTSLSYQSRPLLTADEVMTLRGPEKEGANIQTPGDMLVFAAGFHPIYGQQLLYFKNPEWLERASIRWPEKSDSIPGARKDYKAILGESGGTLPIPHIEKKPEGQDPVEEVSEAERAALAAAAGDLDAVAGECKPLAGCKPFAECKPLAGRKPTGDGKYDTSERDAERGVIGGLMGDDGDG
>NZ_CP044411.1|WP_012536710.1|1358976_1359633_+|lytic-transglycosylase-domain-containing-protein
MILLSQINAECAPMVAPSTMAAIVRVESGGNPLAMWNNSTQSMVIPGSRAQAIRYLRHAMAAGQRVDVGLAQVDTGNFAAFGLRPRNAFNACANLRAGGEILHMDWQQALSSGYRGQQALYHAFEAYNSGRLRGDAQYANRILGAAGVPTSAGCKLAGCKPAGRKPVAYGRLRTVSWGNQGNAALPSNPFPQFRWQAKSPQAVTSGPSDDSHSWPVLP
>NZ_CP044411.1|WP_012536709.1|1358677_1358980_+|hypothetical-protein
MRGSIIIRTEHDCAGLPPARRTAIVTQKVRSLSDEGLQDLARRREKQHPGRHLRPMSITLPADVLERLQCFQGSRWSVSALIDRILESEDARPASSRSSR
>NZ_CP044411.1|WP_012536708.1|1357206_1358667_+|TrbI/VirB10-family-protein
MKSGKDFFSDLLQKKKGLLPAGQQPAGDSRKGPGGQQDPCGQPGPSRPQGPQVSQPGIEVKPDRDRMATRIKRTPLYIAAAVVGLGAYGGYEYLQSHPMFGNAKPQVQAKTIQPASGTGAPVAPAHRKQVHKPTVPGGASDTSATAATNSDADQSHPAKAPASTVPKKNPYATQDAAFASALGTGSAGSGAGEGLAWKTPESTPSAQTPTVLPTALPGASLPGASLPDAEPSAAKKTKKKTPPSLVTRETSPYEILSGSVIPAVLQTGIKSYLPGEITAVVSQNVYSSVNGATLLIPAGAKLVGTYDTQTALGINRLAVAWTRIEFPNGTTMNLPGYEGAGGAGYAGFAGEVNDHTWLIFKNALLMSIVDAGMAIASPSTSTSVTGQMSGNVALQDSEQALAQTFGEAESQLLEKYIDIAPTITIPTGYLFSVVVAHDMVFPGPYDPAMQTGSAMVDQALGPNLNPYGLRPAKGLRPAKGLHPAKG
>NZ_CP044411.1|WP_012536707.1|1356187_1357204_+|conjugal-transfer-protein
MRYGAKTMKKRSVLMMATIAMAASVPASMASTVKVPGVAGQSAPIAGTVNTAQIFRHSLNIRYGEPIRAVEQQSVRAFALGTLSQLPVFTRPGGEVIVPLGQVLPVLQTAPGNFSVVILGKGVKPVSLVGAPRAEWVVKETAAGGLAAGRLAAGRHPILEIMPRFAGLKGSIQIVATSPHGYPLTYTVGLVSGTSRFTPVLSFYRVPHDFPQSREVGTRDQDRQATAPIAHASHANTPPVNATHADLDWKMQCFTGDCKPVQPISVVSDIKDRMTYIRLPTGKTPMVLVRNQAGKSLLVGYRMEGHTLAVGAVPYRIDLLTGNWNHLAEIRLTNEAGA
>NZ_CP044411.1|WP_054609015.1|1355070_1356186_+|conjugal-transfer-protein
MKTKTWLSLGLAVLPGLALAGVDAGLPAVKPIGSLQGKPPIQPAGTKTGSAHPSTTPSASGGTTSARQKVPAISPQAAERIAAVQVWQQSIATPPEGPESAATRALARQSLTASQAMDNTLPVISGANGTVDSLAGRPVLVCSPLHTCIIELPDGVRPVTTVGVSKSEWNVQQALVGKQPEIFLSPKFQGLHQNIVVAATDQGRPINYEIRLVSDAVRYIPALKIEDSGGEVRSWKTDLQSADSRTADNAPTDQSAADHKGNVLPLPNIRLNHVNLRWSIHCGGGGWFRSSDCKPIRPLRVYDDGTHTFIDMPQGLASHGGFPILQARNASGHLIGVDTQIRGNTYVVDSVPAEILLRLGSEVVTIHQEGK
>NZ_CP044411.1|WP_009564688.1|1354389_1355058_+|type-IV-secretion-system-protein
MSSNPDYLAARQEWLERYGSYIAQARNWRIAALSAIGIAALFGAGMVYEADRVHIVPYVVEVDKLGKAVELAQAVRAGSFAQPVVQHIVSRFTWLAFTRSPDKHVQKHFIDESYHYIASSAESSLDAFYAQHNPYAAYSNKTQGNTVTIQSAVPVGQVTGKGGSYIVDFLVKHYGPHGGVDGEQNWQGTVTYATVPPSNNPNVLKGNPFGIYITHFAFSPQV
>NZ_CP044411.1|WP_009564689.1|1353222_1354080_+|DUF2236-domain-containing-protein
MTTAYDREILQLDPVKDHCRITFLMATCVYPFDIARALELALFRTYAVPRISALLRHTGELTERTRKRYDDTDLLLSELIEHGYDSPQGQAAIENINRQHAKYTIRNKDYLYVLSTFIFEPIQWIARFGHRPLSEKERLAWFHFWRAIGVRMNIQDIHDEYAELEQFNRSYEAECFHYSNSNRCVAEKTIDLLLGFYMPPVLFRLGRPAVYALLDRPLLNALGLSGQSIWLSRVLTRALRLRGRIASALPIKNKPVMRTQLRRPTYPEGYRIEDLGPEKPTQQRD
>NZ_CP044411.1|WP_080515400.1|1351780_1352779_+|LysR-family-transcriptional-regulator
MWTICNYIKVKYIYYYNLVWFTIGMSIRHATLHQLKIFAAVARHMSFARAAEELHLTPPALSIQVRQLAEAVGQPLFNQIGKKIYLTPAGEALTSACHDVLDRLEYFTQEIAALQGLEKGSLKVATLSTAKYFIPRIIGGFCTEHPGVATALFIGNREALLERLARNQDDLYILGQPPEHINVVAEAFADNPLVVVSRSDHPLASEKDLEPSRLRDAPFILREPGSGTRLAAEKFFEQHGVVLRTRMEFGSNEAVKQTVAGGLGIAVLSASTIHAELASGELVILDVRGFPLERKWYAVYPAGKLLSPIVRAFMGCLFAVSAHGEKEWRAQE
>NZ_CP044411.1|WP_049756718.1|1364292_1366788_+|diguanylate-cyclase
MTAPDTANFLTLDALLTKINQMISGAEDESVLLQHICEIAVQQSGLKLAVVSRPDTQGRFQFLAAAGQVDYLKDLFISSDAQIPEGQGPAARAWREARVYFGTNFTKEPFLAPWKKRAQAYGLADSATLPIFRDGKVWAILSVYRGDEAQFDDALQTILQQLSLQISQGLERLQDVQRLRFLRASVEALEDGVTIADPQRHLIYVNQAFLKLTGYAMKEVLGRDCKFLQAPQTDAQTVRQIAIALAQEQSYTGDILNQRKDGTLFWNRLHIDPVLNDQGALTGFIGLQRDITQERENRNLIQTLLDNAAVGITVVRQRQIVQCNQHLAGMIGLSPERVIGQSSRLFYPDEATWERIGQAYAELLQTGSTIIRHVMLAHYHNQNPPVVDAFVKLLDDQETSIWTVVDVTESVQQAQQLKKLQNIYQALTVEADILLQGRNVQDMLETTCTRLGEMGIFHTVGVVRPDAQGRVRVLAGAGPGIEMMQPFQIHVDDPSSMSARAWREQRTIVHSDFSSSQADRPWGQVLATSGWVSALATPVWRDGTPFAVIKFISTEQVFDADTTTACERLASLLGHSLDEHDLKEHLRLLQEQEAKIARTDLLTGLPNRRFLEIQMEQAMARAERHNQLLAVCMLDLDGFKPVNDTYGHGAGDEVLVALGKRLSEALRKSDFVARLGGDEFVLLVEDLEDLDDLANIMKKIEDTITAPIPLSNGKSVQIGASMGVALYPFGDTDTGDKLLRLADQAMYESKANKAARERFWVLFGEEVQKEKCTPGQQLLDAGALEVWYQPVLDSRTRRVVGVEALARLRDTDGTLWTPAEFLPQLQIGNLS
>NZ_CP044411.1|WP_080515401.1|1366726_1367731_+|EAL-domain-containing-protein
MVPSGRRRSSCRNCRLEIFLDLTGKVLAQSLADLSLLDAHGWSLWVSVNLDPRSVSEGCVTCLEEMIAQSTVDPSRITLEILEGDNFLEQQKALDHLREIKALGVRLALDDVGSAYSSLLRLKDLPIDEIKLDQGFIRFLEQRPQDLHFVGAIQDLAAGMGVDLVVEGVETEDILDAIIVTGAQFLQGYAIAKPMPLSELQAFLQRPPCHGRPHPTSLLGFYAKQIAAHNALKKAMLHTPHLIDYVAVADATICPGHNHIRRLGIGDHKRLERLHQEYHQSIAAMGERSISSPNNGDWSDVDSAENAFEQAIIGAYWYKKMEDGNPACEAEKPT
>NZ_CP044411.1|WP_009566825.1|1367868_1368579_-|PilZ-domain-containing-protein
MEYLPLVFLSGADELPLPEPEALGAVEGRSAIVYGPEEDDDGLLCHAQGWDMGDLVLEPTTPANGEIPSYNKALIFLFAKPNLLGFFADWKSFQKGAHHFRRPNLVLTRRARQKQRLRLDGDIIVRRRNGSTLLSKLYDFGPSGASFYTDAADFRSGEMLLAEFEISGCGSCETTATIVRVETLSHSHYGYLVGIYFHLTKAQLQKAEQLYLCKKAEAIRQLSAPERHRWAPPETV
>NZ_CP044411.1|WP_012536716.1|1368749_1371389_-|EAL-domain-containing-protein
MIIDNSGTLPAFLGLQDSDFQVIDRYRDALDKEASALAHAFYDYLLSHPATAAVFRDFSSARLDALIQKQTEHAKGLLVSRLDRPWRESMRKIGALHHHLGIGPSWIAGAYILYWRHWQKILQVQVPESDRDLLRDALFRLLVGDLMVQLEGYAHASRETDSERLALSNVLMSVLAAPRGKVSLRPEDLLQQICDDLPAKSGSVRLAGYMVSDVMGETLTLEHQAGLLSPGLQLQKSTGDPCWKALGSGQSIIQAVDDPQAPEWIKALRNQVEEIGIFPFGTEDLRGAGLIGVREKGYFQRVGSAYFNAFAHLGELVFLLRNQFLRDPLTALPNRFLFMDFLENARNQTLRHERLLGVAILDLDGFKQVNDRLGHGAGDQVLQAVVQRLQVQLRAGDILARLGGDEFGLILPDLERLDDLDGVSERLLAALREPLEIDGEAASVTGSLGITLFPLDDSDASTLIRHADMALYAAKDAGRDQFQLHSLALDEAMRTEAGTRALLEQALQENRLVLYYQPVVSSAGAVIGVEALIRLQHPERGLIPPAAFFSALDHVRLARPIGRFVLNVALHQAALWQEAGHPLRVSVNISTRHLLDARFLEDLQEMLAKYPGLRPELVEIEITESAPLRDMLEAQRLLVACHRLGVRVALDDFGTGNASLTYLQRLPADSIKIDQSFVRDVIDDPKDLAIVTAVITASRMLGMNVIAEGVETADHVDLLVKTGCNHLQGYFFSKPIPAEDVPAWVAHFRPAPRTKDSLHPLNILSPILEGHILRVQKFIGALRQENPFPAHVIEKDAEEYCHLGLWLRGEGKQRFGATPQFMRLLTRHERLHQVARVAKLHFDAGDADGAMEQGKLLDMENGLLLAELLAMAGESRDNI
>NZ_CP044411.1|WP_009562011.1|1371813_1372002_-|hypothetical-protein
MNESYRQTRIAQLQNHRHILLQRREQRGAPIASIDMELNVVRAKLQALYEAGRMQLVTETDA
>NZ_CP044411.1|WP_009562016.1|1372239_1373139_-|GTP-binding-protein
MLSIEPQAGPAPIIQVIHSSRRELDVGVYYLSDRKILRALAAAHRRGVDVRVIIEGKPYGMKPWQVRREERTIAATGARWKVAPPRFTSHGNDYSFFHCKYCANGHEVEIGTANFDWSAFHRNREYVDVTRNATVVQAVNAVFNADWTAAQGGNQRAPAYAHRVLVLSPGTSAAQLLQVIDQPGPIDVESEELGPYAPILDALAAKGRNLRMILPASINAKDKRAVAFLREHGCRVRLLSKKPLYMHAKMIAGKSLAFIGSENFTQTSLDNNREMGLLLNGSDIGKLQTQFDKDWARAG
>NZ_CP044411.1|WP_012607192.1|1373466_1373724_-|hypothetical-protein
MFGFGEHNDHANVQQVICTCGTNMAYQGPHGLRMGGLTGMLGAGAAFLGGQVATDGEEAFEKKLEVDIYVCPQCQDVRLKYRKGL
>NZ_CP044411.1|WP_054609017.1|1373807_1375046_-|ParB/RepB/Spo0J-family-partition-protein
MAKVDLSENLFDEMKRTLAEMAGDSGETDTKADRLPGRRLPGQEAARADERNDVAGGTIGRGAASALFLELSEIEPDPEQPRKTFVASGAQDAIDNDLELLRESILQHGVLQPIAVHPVASGRYRIIAGERRWRASMAARDSGQPCRRKGYDLSRIPAVILEPDTDADRLEMQLVENLARADMTPVDTAKAVKQLMDSLDPKPSLADLGKRLGRSKAWVHQMLSLGSEDAQAVAEYLGVPLESIGQTDISRMKGWMKDEDKRIVLDAIRASLQAGETLSRVLVDREEDRYEQGLSGKPQEVDMQQENGAVMGSHPARAFDANGEEVDLSTIDLSEVDSDEDIEDGGAVDENGVVVGDPADGASLPGASLPNQVTVTLPRPLLERAFAKAGRALPGTMGTVEIVEVLELVLNE
>NZ_CP044411.1|WP_012536720.1|1375047_1375818_-|ParA-family-protein
MPQIITVTNQKGGVGKTALAVHIAAYASMAAKKKTLLVDMDGQRNATFITTGEQYGRGKSVLELWDGDTRLEFQDTRFGDLQILPGHQHVHLVEKQGLKSGQEAMSRLLDIDFDVVVIDTPPAAGVQQLAPLYLGGLLVAPVEPDLLALQGLTSLLKVWREIASQVDLGLSLVINKRVLNSTNQQMVVDAITESGFGQHVLPVHLTNRQIVSNAMKQGMPVWKLDPKDAAAAKWAMACKMILETDRVPTEETVKEG
>NZ_CP044411.1|WP_009563488.1|1375796_1376237_-|hypothetical-protein
MLTPSLFNGMPYAGESTVIPLKMHLYIQALAFVQGMTLRAVHEDCASRFLAEKAWEKGLRWRDGHPPAVSGPEWVEVHVRIPAHLADNLAEVSRRNGVGLPDVLYTMLYWYSWILYPPLQEQERRKTKFRASKAREERERCHRSLP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP044411_1	1.1\|923373\|51\|NZ_CP044411\|CRISPRCasFinder	923373-923423	51	NZ_CP044411.1	1717854-1717904	0	1.0
NZ_CP044411_1	1.1\|923373\|51\|NZ_CP044411\|CRISPRCasFinder	923373-923423	51	NZ_CP044411.1	1941657-1941707	0	1.0

1. spacer 1.1|923373|51|NZ_CP044411|CRISPRCasFinder matches to position: 1717854-1717904, mismatch: 0, identity: 1.0

ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	CRISPR spacer
ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	Protospacer
***************************************************

2. spacer 1.1|923373|51|NZ_CP044411|CRISPRCasFinder matches to position: 1941657-1941707, mismatch: 0, identity: 1.0

ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	CRISPR spacer
ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	Protospacer
***************************************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

334303 : 343092

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151528016.1\|334303_335548_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A219Y950	Aeromonas_phage	3.2e-99	54.4
WP_113527387.1\|335554_336046_+	transcriptional repressor NrdR	NA	NA	NA	NA
WP_113527388.1\|336035_337136_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.8e-43	34.1
WP_113527389.1\|337139_337796_+	riboflavin synthase	A0A2I2L4R9	Orpheovirus	6.6e-19	35.2
WP_113527390.1\|337792_338926_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.6e-52	36.3
WP_113527391.1\|338922_339387_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	3.6e-35	51.0
WP_113527392.1\|339397_339841_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_113527393.1\|339966_340254_+	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_113527394.1\|340411_340984_+	sel1 repeat family protein	NA	NA	NA	NA
WP_113527395.1\|341001_341355_-	LapA family protein	NA	NA	NA	NA
WP_113527396.1\|341409_343092_-	ubiquinone biosynthesis regulatory protein kinase UbiB	G9E5W0	Micromonas_pusilla_virus	1.7e-34	29.3

DBSCAN-SWA_2

926460 : 938001

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126605152.1\|926460_928950_-	plasma-membrane proton-efflux P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	3.2e-53	28.0
WP_126605153.1\|929512_930466_-	sigma-70 family RNA polymerase sigma factor	M4SMP8	Cyanophage	2.7e-37	33.4
WP_126605154.1\|930849_931743_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_126605155.1\|931899_934329_-	plasma-membrane proton-efflux P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	3.4e-44	25.4
WP_126605156.1\|934703_935021_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	1.4e-06	38.0
WP_113526787.1\|935037_935313_-	plasmid maintenance system killer	A0A2L1IV28	Escherichia_phage	3.9e-13	39.1
WP_126605157.1\|935702_935987_+	hypothetical protein	NA	NA	NA	NA
WP_151528117.1\|935976_938001_-	copper-translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.5e-73	34.2

DBSCAN-SWA_3

1410295 : 1418584

Bacillus_phage(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126605364.1\|1410295_1410907_-	AAA family ATPase	S5MMC6	Bacillus_phage	4.2e-07	25.0
WP_113525706.1\|1410903_1411473_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	S4W084	Pandoravirus	2.1e-13	35.4
WP_126605365.1\|1411430_1412783_-\|tRNA	CCA tRNA nucleotidyltransferase	B5LJ39	Mycobacterium_phage	4.0e-18	26.5
WP_126605366.1\|1412804_1414298_-	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	3.0e-27	36.4
WP_113525703.1\|1414432_1415437_-	glycosyltransferase family 2 protein	F1C5B0	Cronobacter_phage	7.2e-81	49.7
WP_126605367.1\|1415575_1417036_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.0e-91	41.1
WP_126605368.1\|1417039_1418584_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.4e-14	31.4

DBSCAN-SWA_4

1715417 : 1723297

uncultured_Mediterranean_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126605654.1\|1715417_1716080_-	ATP-binding protein	U5N3V8	Enterobacteria_phage	2.9e-30	37.9
WP_113525485.1\|1717957_1718272_-	HigA family addiction module antidote protein	I6ZVM3	Aeromonas_phage	9.6e-08	40.7
WP_126604202.1\|1718287_1718566_-	peptidase	A0A2L1IV28	Escherichia_phage	1.3e-19	45.7
WP_126604203.1\|1719051_1720002_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	3.1e-49	38.8
WP_126604204.1\|1720009_1721794_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_126604205.1\|1721805_1722141_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	4.3e-14	47.3
WP_126604206.1\|1722181_1723297_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	1.5e-87	47.9

DBSCAN-SWA_5

1942542 : 2018172

Bacillus_phage(23.08%)

tRNA,transposase,integrase

attL 2014855:2014886|attR 2018237:2018268

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_126605549.1\|1942542_1944180_-\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	6.4e-103	42.4
WP_012536650.1\|1944229_1944577_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_151528173.1\|1944567_1944900_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_151528174.1\|1945306_1946092_-	hypothetical protein	NA	NA	NA	NA
WP_151528175.1\|1946105_1946606_-	hypothetical protein	NA	NA	NA	NA
WP_151528176.1\|1947368_1948493_-	DNA polymerase IV	NA	NA	NA	NA
WP_151528426.1\|1948903_1950682_-	SLC13 family permease	NA	NA	NA	NA
WP_151528177.1\|1950823_1951588_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_151528178.1\|1951709_1953047_+	cardiolipin synthase B	NA	NA	NA	NA
WP_151528179.1\|1953614_1954058_+	hypothetical protein	NA	NA	NA	NA
WP_151528180.1\|1954234_1955158_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_151528427.1\|1955640_1956168_+	NADH-quinone oxidoreductase subunit F	NA	NA	NA	NA
WP_151528181.1\|1956352_1956802_-	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_151528182.1\|1956798_1957035_-	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_151528183.1\|1957087_1957720_-\|integrase	tyrosine-type recombinase/integrase	A0A142F2H8	Mycobacterium_phage	3.1e-05	29.1
WP_151528184.1\|1957985_1959320_+	hypothetical protein	NA	NA	NA	NA
WP_151528185.1\|1959430_1959874_+	hypothetical protein	NA	NA	NA	NA
WP_151528186.1\|1961224_1961461_+	hypothetical protein	NA	NA	NA	NA
WP_151528187.1\|1961550_1966119_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_151528188.1\|1966858_1967845_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	3.4e-67	45.8
WP_151528189.1\|1967883_1970169_+	UDP-forming cellulose synthase catalytic subunit	A0A1V0S9E5	Catovirus	2.3e-05	26.2
WP_151528190.1\|1970195_1972277_+	cellulose synthase	NA	NA	NA	NA
WP_151528191.1\|1972273_1975120_+	hypothetical protein	NA	NA	NA	NA
WP_151528192.1\|1975149_1976400_+	cellulase	NA	NA	NA	NA
WP_151528193.1\|1976444_1977791_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.7e-16	36.9
WP_151528194.1\|1977787_1978111_+	hypothetical protein	NA	NA	NA	NA
WP_151528195.1\|1978161_1978557_+	hypothetical protein	NA	NA	NA	NA
WP_151528196.1\|1978978_1979761_-	HNH endonuclease	NA	NA	NA	NA
WP_151528197.1\|1979991_1980309_-	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	4.1e-06	36.7
WP_054608893.1\|1982009_1982246_+	AbrB family transcriptional regulator	NA	NA	NA	NA
WP_126605660.1\|1982245_1982635_+	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_126604279.1\|1982824_1986679_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	2.6e-99	50.5
WP_113526534.1\|1986749_1987472_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3HI61	Synechococcus_phage	7.3e-43	40.5
WP_126604280.1\|1987468_1988776_-	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	5.4e-20	34.6
WP_126604281.1\|1988772_1989906_-	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_113526531.1\|1989943_1990819_-	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_126604282.1\|1991091_1991745_-	hemolysin III family protein	NA	NA	NA	NA
WP_113526530.1\|1991818_1993147_-	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	3.0e-10	41.9
WP_113526529.1\|1993231_1993666_-	thioredoxin TrxC	V5L6J2	Insectomime_virus	1.5e-14	37.5
WP_113526618.1\|1993696_1993981_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	2.3e-08	40.8
WP_113526528.1\|1993980_1994406_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_113526527.1\|1994409_1994631_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_126604283.1\|1994637_1997913_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_126604284.1\|1997905_1998988_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_113526524.1\|1998984_2000406_-	TolC family protein	NA	NA	NA	NA
WP_012537155.1\|2000654_2000957_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_126604285.1\|2001256_2002729_-	4-hydroxy-3-polyprenylbenzoate decarboxylase	NA	NA	NA	NA
WP_113526522.1\|2002753_2003626_-	phosphate/phosphite/phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_113526521.1\|2003638_2004031_-	SCP2 sterol-binding domain-containing protein	NA	NA	NA	NA
WP_113526520.1\|2004141_2004888_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_113526519.1\|2004887_2005703_-	TatD family deoxyribonuclease	NA	NA	NA	NA
WP_113526617.1\|2005835_2007065_+	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_126604286.1\|2007054_2008242_+	2-octaprenyl-6-methoxyphenyl hydroxylase	NA	NA	NA	NA
WP_113526517.1\|2008253_2008517_+	accessory factor UbiK family protein	NA	NA	NA	NA
WP_151528198.1\|2008520_2009411_+	ATPase	NA	NA	NA	NA
WP_012537166.1\|2009482_2011327_+	hypothetical protein	NA	NA	NA	NA
2014855:2014886	attL	NA	NA	NA	NA
WP_012535982.1\|2014998_2016243_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_012535983.1\|2016239_2017181_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_009561339.1\|2017173_2018172_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	1.5e-17	26.5
2018237:2018268	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP044411.1|WP_126604202.1|1718287_1718566_-|peptidase

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP044411.1|WP_126604202.1|1718287_1718566_-|peptidase

1718287_1718566_-

92 aa aa

HTH_XRE

Identity	Hit_domain_coverage
NA	NA

1715417-1723297

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP044411_1	Orphan	1.1\|923373\|51\|NZ_CP044411\|CRISPRCasFinder	923373-923423	51	1717904-1717854	0

1. spacer 1.1|923373|51|NZ_CP044411|CRISPRCasFinder matches to NZ_CP044411 position: 1717904-1717854, mismatch: 0

ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	CRISPR spacer
ttgggatcggcgtaatggcgccacttccggatcggcataaaggagccagtt	Protospacer
***************************************************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP044411

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information