CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP031223	Psychrobacillus sp. PB01 chromosome, complete genome	1 crisprs	cas3,DEDDh,WYL,DinG,RT,csa3	0	0	10	0
NZ_CP031224	Psychrobacillus sp. PB01 plasmid pPB01, complete sequence	0 crisprs	NA	0	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP031223_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP031223_1

576828-576901

Orphan

Consensus_repeat	Method
TTTACCATTTGGCTTTATGCTCCT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP031223_1

>merge|NZ_CP031223|1|576828-576901|CRISPRCasFinder
TTTACCATTTGGCTTTATGCTCCTGCGCAAAGCTCGTCGCAGAAAAGCCATTTACCATTTGGCTTTATGCTCCT

>NZ_CP031223|1|1|576828-576901|CRISPRCasFinder
TTTACCATTTGGCTTTATGCTCCT	GCGCAAAGCTCGTCGCAGAAAAGCCA
TTTACCATTTGGCTTTATGCTCCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP031223.1\|WP_151698758.1\|578084_578573_+\|amidase	unknown	unknown	gnl\|CDD\|378910
NZ_CP031223.1\|WP_151698751.1\|570235_570961_+\|glycerophosphodiester-phosphodiesterase	unknown	unknown	gnl\|CDD\|176506
NZ_CP031223.1\|WP_151698764.1\|584842_585310_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031223.1\|WP_151698762.1\|583029_583608_+\|nitroreductase	unknown	unknown	gnl\|CDD\|380312
NZ_CP031223.1\|WP_151698754.1\|573699_574632_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238558
NZ_CP031223.1\|WP_151698767.1\|587956_588181_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031223.1\|WP_151698749.1\|567651_568260_+\|hydrolase	unknown	unknown	gnl\|CDD\|376406
NZ_CP031223.1\|WP_151698766.1\|587084_587798_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031223.1\|WP_151698747.1\|566062_566929_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP031223.1\|WP_151698748.1\|567198_567618_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP031223.1\|WP_151698763.1\|584169_584607_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031223.1\|WP_151698759.1\|579539_580391_-\|DegV-family-EDD-domain-containing-protein	unknown	unknown	gnl\|CDD\|273257
NZ_CP031223.1\|WP_151698756.1\|575550_576591_+\|thioredoxin-reductase	unknown	unknown	gnl\|CDD\|223566
NZ_CP031223.1\|WP_151698750.1\|568412_569711_-\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|223659
NZ_CP031223.1\|WP_151698761.1\|581120_582944_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP031223.1\|WP_151698752.1\|571637_572645_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP031223.1\|WP_151698753.1\|572641_573640_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP031223.1\|WP_151698765.1\|586536_586917_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP031223.1\|WP_151698755.1\|574636_575428_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224045
NZ_CP031223.1\|WP_151698760.1\|580497_581070_-\|glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|376884

Protein	Function_ID	Function_description	E-value
NZ_CP031223.1\|WP_151698758.1\|578084_578573_+\|amidase	gnl\|CDD\|378910	pfam12671, Amidase_6, Putative amidase domain.	9.96089e-41
NZ_CP031223.1\|WP_151698751.1\|570235_570961_+\|glycerophosphodiester-phosphodiesterase	gnl\|CDD\|176506	cd08563, GDPD_TtGDE_like, Glycerophosphodiester phosphodiesterase domain of Thermoanaerobacter tengcongensis and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Thermoanaerobacter tengcongensis glycerophosphodiester phosphodiesterase (TtGDE, EC 3.1.4.46) and its uncharacterized homologs. Members in this family show high sequence similarity to Escherichia coli GP-GDE, which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. Despite the fact that most of GDPD family members exist as the monomer, TtGDE can function as a dimeric unit. Its catalytic mechanism is based on the general base-acid catalysis, which is similar to that of phosphoinositide-specific phospholipases C (PI-PLCs, EC 3.1.4.11). A divalent metal cation is required for the enzyme activity of TtGDE.	2.5591e-96
NZ_CP031223.1\|WP_151698762.1\|583029_583608_+\|nitroreductase	gnl\|CDD\|380312	cd02135, YdjA-like, nitroreductase family protein similar to Escherichia coli YdjA. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to nitroreductase YdjA from Escherichia coli. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer. Members of this family are also called NADH dehydrogenase, oxygen-insensitive NAD(P)H nitrogenase or dihydropteridine reductase.	2.74772e-53
NZ_CP031223.1\|WP_151698754.1\|573699_574632_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238558	cd01138, FeuA, Periplasmic binding protein FeuA. These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.	3.95047e-84
NZ_CP031223.1\|WP_151698749.1\|567651_568260_+\|hydrolase	gnl\|CDD\|376406	pfam00882, Zn_dep_PLPC, Zinc dependent phospholipase C.	0.00262786
NZ_CP031223.1\|WP_151698747.1\|566062_566929_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.8986e-16
NZ_CP031223.1\|WP_151698748.1\|567198_567618_+\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	1.79186e-07
NZ_CP031223.1\|WP_151698759.1\|579539_580391_-\|DegV-family-EDD-domain-containing-protein	gnl\|CDD\|273257	TIGR00762, DegV, EDD domain protein, DegV family. This family of proteins is related to DegV of Bacillus subtilis and includes paralogous sets in several species (B. subtilis, Deinococcus radiodurans, Mycoplasma pneumoniae) that are closer in percent identity to each than to most homologs from other species. This suggests both recent paralogy and diversity of function. DegV itself is encoded immediately downstream of DegU, a transcriptional regulator of degradation, but is itself uncharacterized. Crystallography suggested a lipid-binding site, while comparison of the crystal structure to dihydroxyacetone kinase and to a mannose transporter EIIA domain suggests a conserved domain, EDD, with phosphotransferase activity. [Unknown function, General].	3.63216e-83
NZ_CP031223.1\|WP_151698756.1\|575550_576591_+\|thioredoxin-reductase	gnl\|CDD\|223566	COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones].	3.8997e-68
NZ_CP031223.1\|WP_151698750.1\|568412_569711_-\|phosphatase-PAP2-family-protein	gnl\|CDD\|223659	COG0586, DedA, Uncharacterized membrane-associated protein [Function unknown].	1.17584e-33
NZ_CP031223.1\|WP_151698761.1\|581120_582944_+\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	9.72908e-56
NZ_CP031223.1\|WP_151698752.1\|571637_572645_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	2.78756e-80
NZ_CP031223.1\|WP_151698753.1\|572641_573640_-\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	4.83983e-80
NZ_CP031223.1\|WP_151698755.1\|574636_575428_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224045	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism].	2.83717e-131
NZ_CP031223.1\|WP_151698760.1\|580497_581070_-\|glycerol-3-phosphate-acyltransferase	gnl\|CDD\|376884	pfam02660, G3P_acyltransf, Glycerol-3-phosphate acyltransferase. This family of enzymes catalyzes the transfer of an acyl group from acyl-ACP to glycerol-3-phosphate to form lysophosphatidic acid.	8.13436e-40

>NZ_CP031223.1|WP_151698756.1|575550_576591_+|thioredoxin-reductase
MENIFDVTIIGGGPAGLYSAFYSGLREMKAKIIEYQQQLGGKIHVYPEKMIWDVGGQTPISGEKLIGQLVQQGLTFDPEVVLNEKVESIDKDENGIFVLHTTSGEMHYSKTIIIAVGSGILNPTKLEIEGAERFEVGNLNYTVKSLHRFKGKTVIISGGGNAAIDWANELEPIAKKVYVTYRKDALNGHEAQVTQLLESSITCYFNTTISKLIASENHDVIQQVVLTNHETGEISLLDIDEVVINHGYEQDADLLKKSEIDIQIAENFYVAGNSLSESSVEGVYAAGDILQHPGKLYLIAGTFHDAANAVNQAKQYIQPDADSIAMVSSHNEVFKERNKELIKQLI
>NZ_CP031223.1|WP_151698755.1|574636_575428_-|ATP-binding-cassette-domain-containing-protein
MVRLYTDDLSIAYDDRLIVKELSVEIPDQKITTIIGPNGCGKSTLLKAITRIISHQSGSVVLDGKNVAKENTKQLAKKMAILPQTPESASGLTVGELVSYGRFPYQTGFGRLSKKDFEVIEWALQVTGTSEFKYSPVDALSGGQRQRVWIAMALAQETEIIFLDEPTTYLDMAHQLEVLELLQKLNQDEKRTIVMVLHDLNQAARFADYIIALKEGEIVKAGSCHEVITQEVLQDVFNINAEIGVDPRTNKPMCITYNLLKGD
>NZ_CP031223.1|WP_151698754.1|573699_574632_-|ABC-transporter-substrate-binding-protein
MKKLLMPILFLFVLILAACGNDSTDTKTDSKATEEKEEPTTITYQSEEGPVEVPANPKRVVVVSSFVGNVAALGVKMVGVDSWSKQNPRYDSYLSGVEEVSEDNLEKIIELDPDLIIGLSTTQNLDKLKEIAPTVTFTYGKLDYLTQHLEIGKLLNKEKEAQNWINDFKERSKSAGEEIKGAIGKDATVSVIENFDKQLYVFGNNWARGTEVLYQAMGLAMPEKVKEMALKDGYYALSLEVLPQFAGDYVIFSKASDQDNSFQDTDVYKNIPAVKNNRVFEANAKEFYFNDPISLDYQLDFFKDHFLNSK
>NZ_CP031223.1|WP_151698753.1|572641_573640_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MKSSAHFSKKFIVSLVLLFAMFIVAMVFGAAQTSIQDLWQAMFSNLKNDQINILREIRFPREVAAIIVGAALAVSGAIMQGITRNPLADPGLLGLTSGANAALAITIALLPVSNYLGITIACFIGAAVGAIMVFSISAAKKGGFSPLRIVLAGAAVSAFLYAIADGVGIYFKVSKDVSMWTAGGLIGTSWKQLAIISPFIGIGILVALLLSRQLTILSLNEEVAVGLGQKTAQIKMILFIVVILLAGASVAIVGNMAFVGLMVPHIVRAVVGTDYRFIIPMSVVVGAIMMLIADTLGRTINIPYETPVAAIIAIMGLPFFLLIVRKGGSVFQ
>NZ_CP031223.1|WP_151698752.1|571637_572645_-|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MIQSHLLKKQRIILLILLALIVLTAFISAGIGYSSLSFDRLLPTILGNGTFKEEFVLFSVRLPRIVITFLAGMALALSGAILQGITRNDLADPGIIGINAGAGVAIALFFLFFPIQPGSFVYMLPLVAFIGALLTAFFIYILSYNRKVGLQPVRLILVGIGFSMALSGLMIVLISSADRQKVDFIAKWLAGNIWGSDWPFILALLPWLIVLIPFTFYKANKLNLLGLSEPVAVGVGVSIEKERIVLLLAAVALAASAVSVTGGIAFIGLMAPHIAKSLVGPRHQLFIPIAILIGGWLLLFADTIGRNIVEPNGIPAGVMVALIGAPYFMYLLLKK
>NZ_CP031223.1|WP_151698751.1|570235_570961_+|glycerophosphodiester-phosphodiesterase
MKIYAHRGSAGTLPENTIASFRATAILPVHGVEFDVHMTKDGELVVIHDESINRTSNGKGFIKDMTLAELKSYDFGEWFSTKFKGEKIPTLREVLYVFKDTHHHLNIELKSDVFPYEGMEDKVLEMLKEYRLERRVVISSFNHEMVSNFKMQAPQIETAILFMEVMIRPDDYANIVGADALHAFFPTAFRAMGKEAIASGRQFRVFTVNEEIYANMLQEIGVHAIFTDFPERMYQFLNRRV
>NZ_CP031223.1|WP_151698750.1|568412_569711_-|phosphatase-PAP2-family-protein
MAHFIQSLMDQYGYFVLGISLFLELLALPLPGEVLMTYAGLMVYQGHYSWLLSILTAGIGTSIGMTLSYWIGMKLGPRFFEKHGHRIHFGPEKLKKTSLWFERFGVKLLVIAFFIPGIRHITGYFSGITRMPFRTYALYAYAGAFLWTSTFISLGKVLGPQWEQYQQTITKYLVIIGITLVTLAIIYYLFTKYHEKLYFSISVLLNKLIETFQSLRKVRFLLLFSFILFLTLFFLMVGLIQDFLAHEFADFDNITSFIVQAIFDESWKVWMTIFSYLYSYYLLFTISFITFVFIMFQKENRLLEVSFLLFVLLGGAYLTEVLTEIFLRVGPSLLPESFPSEQTLITVTVLGFTSFLFARHIHLTWIKTSLFLFVIGVSFLVGLSQIYFNNHFPSDVVAGYVFGGVWASLNMVLLEIFRFVKLQSMKSNTKED
>NZ_CP031223.1|WP_151698749.1|567651_568260_+|hydrolase
MGSRIMHLVIANRIAESLTIEDRRAFLLGGIAPDAVSTKDLSHFFEGEVQDYSRSVDYKEFLHKYSSQVESQYILGYFTHLIADDIWLKGFYLPWLKNRMEANKETFNFYHNDFRLLNGKLLEYYGFTDELREMLKFLPTIPDLQEVKSKDVEVFIPYVLGDMQYDKEVINEKLHVFTFEQIIGYIETSVDKGLLSIKPLLT
>NZ_CP031223.1|WP_151698748.1|567198_567618_+|VOC-family-protein
MKEKLLRIGTTYIPVTNVEFSAEWYVSRLGAELSYKDDDKAILNFANQSIFLVKSKENESSNFYDFYGEERFSLTFEVNGLNALEAIHKDFIEKEIKVGEIENRGHTGRNFIFYDLDANKFDVWSELSPIFKERYLSSN
>NZ_CP031223.1|WP_151698747.1|566062_566929_+|GNAT-family-N-acetyltransferase
MNISIMTVSIPLDVETTEEINVLVKESFLRDKVNYTSLLSVDELSNYYLKGFCVLAYEDETDKLVGVLSAVDRIATLDFEWSAVVLPNARRKGIGEQLVKELAKNLKLRGAETELVLVPENSKNGQQLLKKLGYLHDFSEITMAANAEANESFNKLQITSYNMEESELIEVLVSAFGDTEEEAREMIVFNNETPKRKLMLAIVDKEVVGTVAIVDDSDKLWVTGLAVHKKSRGKGIGTSLLNWSKNEAHHLGKTAVYLDVETDNEKALSVYKKAGFKKTNHTDFYRKG
>NZ_CP031223.1|WP_151698758.1|578084_578573_+|amidase
MATYNRKAAVAYAQKWWNSHNPKFPVFDVDCTNYISQCLFAGGAPMRGQPNRGKGWWLGNHTWSYSWSTPHGLRWYLAGSTKGLQATQVDSPTQLIPGDLIFYDFEGDGRYDHSTIVTSIKDGMPYVNAHTNNSRDRYWNYEDSYAHTPKTSYIFFQIKDNF
>NZ_CP031223.1|WP_151698759.1|579539_580391_-|DegV-family-EDD-domain-containing-protein
MNTRKIAWVIDSSAFVNTMLKEHPDVYIIPLNIHFGQQQFIDGVDLTSEQLYERIRNGTESAKTSQPSAGEFVELYTKLSKEYESIIAIHVSNGLSGTMSSSLNGAQIAKVHVECVDSLSLSAGITGLVERGFHLEGQGLSFEEIASSLRIEATKFRNYILIGNLTQLYKGGRLSSAQFYLGSLLKIKPIIQINNKGELQELDKVRSHKKAIQYLIQKVIASFQSEGVELVYIMHANAIEQAKDLKDAIQLELPSLQVSIGEISSSLAVHAGEETLAVLWYVK
>NZ_CP031223.1|WP_151698760.1|580497_581070_-|glycerol-3-phosphate-acyltransferase
MYLYWIISYFIGTFLTAWWVGKWKKTDLRSIRSGNLGARNAGAVLGKSAFFVTFLGDALKGILVMYIGFYYNFSLAIIATGGLLVILGHLYPFWLKFKGGKGIATFIGVALVYNPMLFGILAVFFVVLLVMIRSATLSMLLAFLSYAFICWINSAFYSAWPISVAIIVILVRHRNDLAESWHARWWKKQS
>NZ_CP031223.1|WP_151698761.1|581120_582944_+|diguanylate-cyclase
MKIRLLLLFFPLLFILASCYTNIDTHPHPSAKDGELVLSREDFTSPELIQLNGEWKFFWEELVTENEIQQRIQQKNQANITIPSSWEDKVGTSFGYGTYYLKVIIPEEKVGNTLAITMTNQNTSYTLSIDGVRVASNGYVGTSFSTTEPVYSNRFVYFTPRNKEINIVLHISNFSNPIGGATKPIYLGSSEQVTRTYDNTLAYTMFIIGSILVMGIYELFIFFFRRKEKVFAYFGLISIFISLYSILKPPYYFNYFFPMIPWIWVNKLEVICIYVLFLLYLNFVGTMYPKEMKKTPVVIGIIVSMGAIIVTLFTKPIFYQPLLNYFFVIVALFMVYILYALILAYKRNRPTIFVNLLANLIFFGSVINDVLLSLNWIHSIPFTTIGFFLYVLIQSINLSKEYARKFEEAENLSIDLQQLNESLDEKIKERTKELKQKNGELKKLTQVDGLTGIYNRRYFNENLGKYFDEAISFDSHLSLLMIDVDNFKTYNDNKGHIAGDELLIKYSQLLQVMCNGNTFVARYGGEEFSIVLPHVSLQEAAGFAENLRLLIEEQKYSANVDDNYVTISIGVSSTEHHAFEQKEELIERADNALYESKKNGKNRVTLL
>NZ_CP031223.1|WP_151698762.1|583029_583608_+|nitroreductase
MIDQSLTVRDAIIQRRSIKQFNGQPVERDALLAILEDAIWAPNHQLRQPWRFVVACGKELVELYDVLKEFAIPKWKELSEDELEKQMKKFKTPGGYVFVIVPEDARQKERLEDYAAASMLVQNVQLLAWDRGIGSCWKTPGYLDNPKFREALGVKSGERIISMLQVGYFDEMPKPKPRKSVDELITIFEKQA
>NZ_CP031223.1|WP_151698763.1|584169_584607_+|hypothetical-protein
MKYFTTLFTGLFSIVLLAGCNFIAESYDYSPPSVTFSHSGLKLAEANINWEKDGTVKKIDSLELAREQKQGAVKAGQEDSIYFGGQDFDILELTVSVWRDDEQIQLDVNYLKEFNFPDEKGEYLIEVNLTSDFGTAQYVGNIVVD
>NZ_CP031223.1|WP_151698764.1|584842_585310_+|hypothetical-protein
MGNFIGESNRKVIFIFILFFISITGYYLFSSLAISSYKSLITIEQVPEVLRLENVPDLPTKWAVESVEKYDDGFISPLVTIKYKNEVILRLTTSHWDFSKDFAKKKQLNIGEKKVDYYFNEKEVAYVCNVANINYAIISPKHLQSEVKVFIENLN
>NZ_CP031223.1|WP_151698765.1|586536_586917_+|hypothetical-protein
MRKNSSKFVFVILFLSYFLSGCNQHPKINIGEALTKSEEEFKKEGIECVSAFGGEKIIKFRLLLKEPPTNEEATNQFKKILDIIATHSNNNDIWDIYNADFDLSYEDNVIYEGKKDAGNDLKVKAH
>NZ_CP031223.1|WP_151698766.1|587084_587798_+|hypothetical-protein
MKIFNKMIFISVFAMLLSACSNSISLKGCPDAEIEWVDMLMIDDIKYEHHYPEPANENLPITIEKGRELGKVTYEMSDNACSNHKMQNGDAAFLKEGTNIYEIKGYPTSLIVAANDVVYVANTNKKAKTAGELYPMDKLVNNIYIQSTEDGKRIHTFSQSSKDKFLAAFYDLKLEDVQSLIDVGKLEGTRLFLEIELNNGVSIRLLYWGDSNTFHIGAIGNDEIKEVINEELTNLNK
>NZ_CP031223.1|WP_151698767.1|587956_588181_+|hypothetical-protein
MLKVMRIILGIILVVLLTYNLLTGNYGTAVSTFFMSFFIAVISIETLKNNLKSGYGYFMAFLALIIFVTALYKF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

588846 : 641254

Bacillus_phage(33.33%)

tRNA,protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151701939.1\|588846_590082_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_151698768.1\|591695_592295_+	hypothetical protein	NA	NA	NA	NA
WP_151698769.1\|592597_593113_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151698770.1\|595003_596281_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_151698771.1\|596817_597480_+	peptidase E	NA	NA	NA	NA
WP_151698772.1\|598285_598768_-	DUF2798 domain-containing protein	NA	NA	NA	NA
WP_151698773.1\|600047_600263_+	hypothetical protein	NA	NA	NA	NA
WP_151698774.1\|600830_602246_-	dipeptidase	NA	NA	NA	NA
WP_151701940.1\|602525_603488_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_151698775.1\|606288_606837_+	sigma-70 family RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	4.6e-05	30.4
WP_151698776.1\|607186_608755_-	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	1.3e-41	26.1
WP_151698777.1\|608931_609114_-	hypothetical protein	NA	NA	NA	NA
WP_151698778.1\|609161_610166_-	hypothetical protein	NA	NA	NA	NA
WP_151698779.1\|610252_611011_+	NAD-dependent epimerase/dehydratase family protein	NA	NA	NA	NA
WP_151701941.1\|611199_611763_+	NADH-dependent FMN reductase	NA	NA	NA	NA
WP_151698780.1\|612096_612546_+	DUF1569 domain-containing protein	NA	NA	NA	NA
WP_151701942.1\|613116_613572_+	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_151698781.1\|613564_614875_+	DUF4179 domain-containing protein	NA	NA	NA	NA
WP_151698782.1\|615136_615988_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.7e-35	37.3
WP_151698783.1\|615884_616301_-	helix-turn-helix domain-containing protein	A0A0N7GFG6	Staphylococcus_phage	5.3e-14	47.8
WP_151698784.1\|616545_617634_+	sensor histidine kinase	NA	NA	NA	NA
WP_151698785.1\|617636_618272_+	response regulator	W8CYM9	Bacillus_phage	2.8e-06	22.7
WP_151698786.1\|618680_619613_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	6.5e-28	35.6
WP_151698787.1\|619629_620856_+	hypothetical protein	NA	NA	NA	NA
WP_151698788.1\|620852_621944_+	ABC transporter permease	NA	NA	NA	NA
WP_151698789.1\|622069_623368_+	arsenical efflux pump membrane protein ArsB	A0A2H4PQU3	Staphylococcus_phage	2.6e-152	63.2
WP_151698790.1\|623692_624103_+	hypothetical protein	NA	NA	NA	NA
WP_151698791.1\|624234_624639_+	neutral trehalase	NA	NA	NA	NA
WP_151698792.1\|624786_625269_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151698793.1\|625507_625687_-	hypothetical protein	NA	NA	NA	NA
WP_151698794.1\|625717_626026_-	hypothetical protein	NA	NA	NA	NA
WP_151698795.1\|626387_628577_-	DNA topoisomerase III	NA	NA	NA	NA
WP_151698796.1\|628766_629180_+	BlaI/MecI/CopY family transcriptional regulator	NA	NA	NA	NA
WP_151698797.1\|629183_630032_+\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_151698798.1\|630083_630728_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_151698799.1\|630717_631068_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_151698800.1\|631717_631897_+	hypothetical protein	NA	NA	NA	NA
WP_151698801.1\|631968_633255_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_151701943.1\|633579_633867_+	metal-sensing transcriptional repressor	NA	NA	NA	NA
WP_151698802.1\|633882_634092_+	copper chaperone CopZ	NA	NA	NA	NA
WP_151698803.1\|634168_636586_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.8e-117	38.6
WP_151698804.1\|636698_637244_+	DUF1541 domain-containing protein	NA	NA	NA	NA
WP_151698805.1\|637309_637894_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_151698806.1\|638130_638805_+	hypothetical protein	NA	NA	NA	NA
WP_151698807.1\|638816_639308_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_151698808.1\|639407_640055_+	YitT family protein	NA	NA	NA	NA
WP_151698809.1\|640088_641254_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.8e-35	37.3

DBSCAN-SWA_2

766014 : 778132

Synechococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151698930.1\|766014_769269_+	glycosyltransferase	A0A1V0SKE1	Klosneuvirus	7.6e-07	33.1
WP_151698931.1\|769338_770712_+	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	3.3e-44	29.4
WP_151698932.1\|771066_772035_+	GDP-mannose 4,6-dehydratase	M4QRT5	Synechococcus_phage	1.3e-100	57.1
WP_151698933.1\|772050_773004_+	SDR family NAD(P)-dependent oxidoreductase	M4QRT5	Synechococcus_phage	1.4e-30	30.5
WP_151698934.1\|773542_774550_+	acyltransferase family protein	NA	NA	NA	NA
WP_151698935.1\|774808_775681_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	3.0e-107	67.5
WP_151698936.1\|775695_776259_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.0e-40	45.3
WP_151698937.1\|776264_777287_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.2e-80	47.4
WP_151698938.1\|777283_778132_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	3.4e-39	38.3

DBSCAN-SWA_3

836403 : 872598

Bacillus_phage(42.86%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151698977.1\|836403_837966_+\|transposase	IS21 family transposase	NA	NA	NA	NA
WP_151698978.1\|837962_838709_+	AAA family ATPase	U5N3V8	Enterobacteria_phage	2.2e-42	38.1
WP_151698979.1\|838760_839324_-	hypothetical protein	NA	NA	NA	NA
WP_151698980.1\|840572_841589_+	hypothetical protein	NA	NA	NA	NA
WP_151698981.1\|842450_843389_+	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	4.9e-15	30.7
WP_151698982.1\|843398_843815_+	hypothetical protein	NA	NA	NA	NA
WP_151698983.1\|844706_845840_+	hypothetical protein	NA	NA	NA	NA
WP_151698984.1\|846223_847549_+	MFS transporter	NA	NA	NA	NA
WP_151698985.1\|848199_849444_+	hypothetical protein	NA	NA	NA	NA
WP_151698986.1\|850326_850527_-	hypothetical protein	NA	NA	NA	NA
WP_151698987.1\|851081_852368_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_151698988.1\|853298_856307_+	response regulator	A0A1V0SGX0	Hokovirus	4.7e-35	31.8
WP_151698989.1\|856307_857399_+	response regulator	NA	NA	NA	NA
WP_151698990.1\|857634_861660_+	hypothetical protein	NA	NA	NA	NA
WP_151698991.1\|861767_862619_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.4e-40	38.3
WP_151698992.1\|862624_863026_-\|transposase	transposase	NA	NA	NA	NA
WP_151698993.1\|863630_864635_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_151698994.1\|864646_865603_+	nucleoside hydrolase	NA	NA	NA	NA
WP_151698995.1\|865629_866232_+	ECF transporter S component	NA	NA	NA	NA
WP_151701953.1\|866341_867052_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_151701954.1\|867057_867909_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	5.6e-18	34.4
WP_151698996.1\|867901_868714_+	ATP-binding cassette domain-containing protein	F2Y165	Organic_Lake_phycodnavirus	5.7e-12	28.1
WP_151698997.1\|868732_869644_+	ribokinase	NA	NA	NA	NA
WP_151698998.1\|870682_871225_-	hypothetical protein	NA	NA	NA	NA
WP_151698999.1\|871339_872191_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	4.0e-40	38.0
WP_151698992.1\|872196_872598_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_4

936699 : 949877

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151699032.1\|936699_941250_+	S8 family serine peptidase	A0A217EQY2	Bacillus_phage	1.5e-29	35.8
WP_151699033.1\|942294_942957_-	response regulator	W8CYM9	Bacillus_phage	2.8e-09	27.8
WP_151699034.1\|943057_945136_+	hypothetical protein	W8CYF6	Bacillus_phage	3.8e-20	27.3
WP_151699035.1\|945405_945762_+	response regulator	Q6XM27	Feldmannia_irregularis_virus	1.0e-05	31.2
WP_151699036.1\|946320_947253_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-25	42.5
WP_151699037.1\|947429_949877_+	DUF4073 domain-containing protein	B8QTT6	Erwinia_phage	1.2e-07	51.7

DBSCAN-SWA_5

1764941 : 1780007

uncultured_Caudovirales_phage(33.33%)

integrase,tail

attL 1757865:1757879|attR 1773377:1773391

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1757865:1757879	attL	NA	NA	NA	NA
WP_151699713.1\|1764941_1766108_-\|integrase	tyrosine-type recombinase/integrase	A0A1S5S7K9	Streptococcus_phage	3.8e-57	35.3
WP_151699714.1\|1766181_1767189_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151699715.1\|1767348_1767585_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151699716.1\|1767581_1767848_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151699717.1\|1767913_1770172_+	DNA primase	A0A2H4JCU9	uncultured_Caudovirales_phage	9.3e-153	40.3
WP_151699718.1\|1770465_1770702_+	hypothetical protein	NA	NA	NA	NA
WP_151699719.1\|1770698_1771007_+	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.8e-12	38.0
WP_151699720.1\|1771007_1771382_+	hypothetical protein	A0A288WG73	Bacillus_phage	1.0e-08	29.5
WP_151699721.1\|1771387_1771738_+	hypothetical protein	A0A1W6JNN5	Staphylococcus_phage	1.6e-08	37.7
WP_151699722.1\|1771756_1772446_+	hypothetical protein	NA	NA	NA	NA
WP_151699723.1\|1772483_1772750_+	hypothetical protein	NA	NA	NA	NA
WP_151699724.1\|1772892_1773084_+	DUF3954 domain-containing protein	NA	NA	NA	NA
WP_151699725.1\|1773172_1776526_+\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	1.4e-88	47.0
1773377:1773391	attR	NA	NA	NA	NA
WP_151699726.1\|1776525_1777239_+	hypothetical protein	NA	NA	NA	NA
WP_151699727.1\|1777243_1777561_+	hypothetical protein	NA	NA	NA	NA
WP_151699728.1\|1777678_1777870_+	hypothetical protein	NA	NA	NA	NA
WP_151699729.1\|1777866_1778193_+	DUF771 domain-containing protein	NA	NA	NA	NA
WP_151699730.1\|1778353_1778545_+	hypothetical protein	R9TQ08	Paenibacillus_phage	3.2e-14	61.0
WP_151699731.1\|1778561_1778762_+	hypothetical protein	NA	NA	NA	NA
WP_151699732.1\|1778835_1779390_-	hypothetical protein	A0A2H4JA12	uncultured_Caudovirales_phage	2.7e-21	51.5
WP_151699733.1\|1779404_1780007_-	hypothetical protein	A0A1S5QTS6	Bacillus_phage	6.0e-51	49.5

DBSCAN-SWA_6

2272826 : 2339509

Pseudomonas_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151700172.1\|2272826_2274092_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_151700173.1\|2274292_2274517_+	hypothetical protein	NA	NA	NA	NA
WP_151700174.1\|2274578_2275211_-	signal peptidase I	NA	NA	NA	NA
WP_151700175.1\|2275459_2275900_-	hypothetical protein	NA	NA	NA	NA
WP_151702026.1\|2276084_2276906_-	DUF4111 domain-containing protein	NA	NA	NA	NA
WP_151700176.1\|2279086_2279530_-	carbon monoxide dehydrogenase	NA	NA	NA	NA
WP_151700177.1\|2280259_2280442_-	PspC domain-containing protein	NA	NA	NA	NA
WP_151700178.1\|2280962_2282876_-	squalene--hopene cyclase	NA	NA	NA	NA
WP_151700179.1\|2283041_2283236_-	hypothetical protein	NA	NA	NA	NA
WP_151700180.1\|2283361_2283889_-	hypothetical protein	NA	NA	NA	NA
WP_151700181.1\|2284025_2284868_-	hypothetical protein	NA	NA	NA	NA
WP_151700182.1\|2285363_2285936_-	hypothetical protein	NA	NA	NA	NA
WP_151700183.1\|2285950_2286496_-	hypothetical protein	NA	NA	NA	NA
WP_151700184.1\|2287891_2288131_-	hypothetical protein	NA	NA	NA	NA
WP_151700185.1\|2288632_2289142_-	hypothetical protein	NA	NA	NA	NA
WP_151700186.1\|2289431_2290277_+	hypothetical protein	NA	NA	NA	NA
WP_151700187.1\|2290600_2291023_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151700188.1\|2291117_2291645_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151700189.1\|2291955_2292237_-	hypothetical protein	NA	NA	NA	NA
WP_151700190.1\|2292523_2293114_-	DUF2441 domain-containing protein	NA	NA	NA	NA
WP_151700191.1\|2293147_2293369_-	hypothetical protein	NA	NA	NA	NA
WP_151700192.1\|2293409_2293916_-	nucleoside deaminase	NA	NA	NA	NA
WP_151699939.1\|2295343_2296485_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.3e-78	54.6
WP_151700193.1\|2296901_2298353_+	4-hydroxyphenylacetate 3-monooxygenase, oxygenase component	NA	NA	NA	NA
WP_151700194.1\|2298387_2298591_-	hypothetical protein	NA	NA	NA	NA
WP_151700195.1\|2302142_2303339_-	MFS transporter	NA	NA	NA	NA
WP_151700196.1\|2303450_2303837_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_151700197.1\|2303889_2304735_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.2e-75	52.4
WP_151700198.1\|2306043_2306523_-	hypothetical protein	NA	NA	NA	NA
WP_151700199.1\|2308261_2309479_-	MFS transporter	NA	NA	NA	NA
WP_151700200.1\|2309647_2310136_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_151700201.1\|2310321_2311776_-	hypothetical protein	NA	NA	NA	NA
WP_151700202.1\|2311956_2312502_-	hypothetical protein	NA	NA	NA	NA
WP_151700203.1\|2313779_2314340_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_151700204.1\|2315613_2316003_-	hypothetical protein	NA	NA	NA	NA
WP_151700205.1\|2316393_2316588_+	hypothetical protein	NA	NA	NA	NA
WP_151700206.1\|2316626_2317175_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_151700207.1\|2317325_2317970_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_151700208.1\|2317982_2318327_+	DoxX family membrane protein	NA	NA	NA	NA
WP_151700209.1\|2319599_2319926_-	hypothetical protein	NA	NA	NA	NA
WP_151700210.1\|2320180_2321131_-	hypothetical protein	NA	NA	NA	NA
WP_151700211.1\|2321216_2322461_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.7e-26	29.1
WP_151700212.1\|2322980_2323850_-	RNA-directed DNA polymerase	A0A0U4J920	Pseudomonas_phage	1.3e-22	36.0
WP_151699916.1\|2325519_2326797_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_151699902.1\|2327026_2328192_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	2.4e-35	37.3
WP_151700213.1\|2328572_2329106_-	hypothetical protein	NA	NA	NA	NA
WP_151700214.1\|2329347_2330145_-	hypothetical protein	NA	NA	NA	NA
WP_151700215.1\|2330137_2330656_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_151700216.1\|2331163_2331367_+	hypothetical protein	NA	NA	NA	NA
WP_151700217.1\|2331661_2331853_-	hypothetical protein	NA	NA	NA	NA
WP_151700218.1\|2332072_2332453_-	hypothetical protein	NA	NA	NA	NA
WP_151700219.1\|2332966_2333242_+	DUF3888 domain-containing protein	NA	NA	NA	NA
WP_151700220.1\|2333392_2333770_-	hypothetical protein	NA	NA	NA	NA
WP_151700221.1\|2335154_2335550_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_151700222.1\|2335698_2335944_-	hypothetical protein	NA	NA	NA	NA
WP_151700223.1\|2336141_2336510_-	hypothetical protein	NA	NA	NA	NA
WP_151700224.1\|2336785_2337951_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.1e-35	36.9
WP_151702027.1\|2338273_2339509_+\|transposase	IS110 family transposase	NA	NA	NA	NA

DBSCAN-SWA_7

3448940 : 3457231

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151701178.1\|3448940_3449513_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.7e-21	34.2
WP_151701179.1\|3449512_3450568_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	4.9e-64	41.3
WP_151701180.1\|3450579_3452001_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.3e-51	34.0
WP_151701181.1\|3451976_3454208_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.0e-164	42.2
WP_151701182.1\|3454191_3454878_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_151701183.1\|3454874_3455129_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_151701184.1\|3455125_3455842_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	2.0e-48	44.0
WP_151701185.1\|3455935_3457231_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.7e-16	24.5

DBSCAN-SWA_8

3551707 : 3607291

Tupanvirus(38.46%)

integrase,transposase

attL 3543008:3543022|attR 3564965:3564979

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3543008:3543022	attL	NA	NA	NA	NA
WP_151701252.1\|3551707_3552841_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6A8	Bacillus_phage	1.8e-56	35.4
WP_151702092.1\|3552945_3553131_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151701253.1\|3553457_3554357_-	hypothetical protein	NA	NA	NA	NA
WP_151701254.1\|3555010_3556291_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_151701255.1\|3556305_3557400_+\|integrase	tyrosine-type recombinase/integrase	A0A2I6UG75	Salinibacter_virus	8.2e-06	21.0
WP_151701256.1\|3557396_3558356_+\|integrase	tyrosine-type recombinase/integrase	Q8SBN2	Clostridium_phage	2.1e-05	25.6
WP_151701257.1\|3559483_3559912_-	DUF4181 domain-containing protein	NA	NA	NA	NA
WP_151702093.1\|3561022_3561253_-	hypothetical protein	NA	NA	NA	NA
WP_151700231.1\|3561556_3562507_-	hypothetical protein	NA	NA	NA	NA
WP_151701258.1\|3562592_3563837_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	9.6e-27	29.9
WP_151700233.1\|3564357_3565224_-	RNA-directed DNA polymerase	A0A0U4J920	Pseudomonas_phage	2.6e-23	35.3
3564965:3564979	attR	NA	NA	NA	NA
WP_151701259.1\|3566997_3567585_+	hypothetical protein	Q0ILF6	Lactococcus_phage	3.9e-10	35.4
WP_151701260.1\|3568096_3571318_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.0e-64	32.7
WP_151701261.1\|3571651_3571930_-	hypothetical protein	NA	NA	NA	NA
WP_151701262.1\|3571962_3572142_-	hypothetical protein	NA	NA	NA	NA
WP_151701263.1\|3572155_3572380_-	hypothetical protein	NA	NA	NA	NA
WP_151701264.1\|3572585_3573065_-	hypothetical protein	NA	NA	NA	NA
WP_151701265.1\|3573048_3573285_-	hypothetical protein	NA	NA	NA	NA
WP_151701266.1\|3573278_3573512_-	hypothetical protein	NA	NA	NA	NA
WP_151702094.1\|3573546_3573759_-	hypothetical protein	NA	NA	NA	NA
WP_151701267.1\|3573755_3574793_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_151701268.1\|3574827_3575969_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.8e-79	54.6
WP_151701269.1\|3576041_3576926_-	branched-chain-amino-acid transaminase	NA	NA	NA	NA
WP_151701270.1\|3576959_3578186_-	cytochrome P450	NA	NA	NA	NA
WP_151701271.1\|3578280_3578535_-	hypothetical protein	NA	NA	NA	NA
WP_151701272.1\|3578916_3579567_-	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_151701273.1\|3579591_3580353_-	putative thioesterase	NA	NA	NA	NA
WP_151701274.1\|3580408_3588109_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.3e-182	29.3
WP_151701275.1\|3588149_3598187_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.4e-170	28.9
WP_151701276.1\|3598191_3599973_-	amino acid adenylation domain-containing protein	A0A2K9L3I8	Tupanvirus	5.2e-58	28.5
WP_151701277.1\|3600019_3601927_-	hypothetical protein	A0A2K9KZV5	Tupanvirus	2.8e-25	23.1
WP_151701278.1\|3602156_3603440_+	MFS transporter	NA	NA	NA	NA
WP_151702095.1\|3604364_3605684_+	MFS transporter	NA	NA	NA	NA
WP_151701279.1\|3605727_3606948_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_151702096.1\|3607135_3607291_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	7.0e-12	70.0

DBSCAN-SWA_9

4058085 : 4090634

Lactococcus_phage(20.0%)

protease,integrase,transposase

attL 4061938:4061957|attR 4077866:4077885

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_151702102.1\|4058085_4059627_+\|transposase	IS21 family transposase	A0A059NT83	Lactococcus_phage	1.1e-16	24.8
WP_151701318.1\|4059623_4060397_+	AAA family ATPase	U5N3V8	Enterobacteria_phage	5.2e-31	32.6
WP_151701667.1\|4060343_4060715_-	DUF3221 domain-containing protein	NA	NA	NA	NA
WP_151701668.1\|4060921_4061398_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
4061938:4061957	attL	NA	NA	NA	NA
WP_151701669.1\|4062031_4062244_-	hypothetical protein	NA	NA	NA	NA
WP_151701670.1\|4062625_4063072_-	hypothetical protein	NA	NA	NA	NA
WP_151701671.1\|4063141_4064179_-	hypothetical protein	NA	NA	NA	NA
WP_151701672.1\|4064627_4065377_-	DUF2290 domain-containing protein	NA	NA	NA	NA
WP_151701673.1\|4065373_4067548_-	AAA family ATPase	NA	NA	NA	NA
WP_151702129.1\|4067771_4069631_-\|transposase	transposase	NA	NA	NA	NA
WP_151701674.1\|4069687_4071514_-\|transposase	transposase	NA	NA	NA	NA
WP_151701675.1\|4071599_4073291_-	AAA family ATPase	NA	NA	NA	NA
WP_151701676.1\|4073265_4075425_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_151701677.1\|4075421_4076261_-\|transposase	heteromeric transposase endonuclease subunit TnsA	NA	NA	NA	NA
WP_151701678.1\|4076267_4077713_-	hypothetical protein	NA	NA	NA	NA
WP_151702130.1\|4077917_4079720_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	M1H1Z3	Paramecium_bursaria_Chlorella_virus	2.1e-99	39.5
4077866:4077885	attR	NA	NA	NA	NA
WP_151701679.1\|4080314_4080842_-	chromate transporter	NA	NA	NA	NA
WP_151702131.1\|4080838_4081417_-	chromate transporter	NA	NA	NA	NA
WP_151701680.1\|4081428_4083033_-	gamma-glutamyltransferase	NA	NA	NA	NA
WP_151701681.1\|4083067_4084069_-	dipeptide ABC transporter ATP-binding protein	Q6GZ03	Mycoplasma_phage	7.5e-06	26.1
WP_151702132.1\|4084043_4085048_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.4e-20	31.2
WP_151701682.1\|4085056_4086613_-	glutathione ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_151701683.1\|4086636_4087533_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_151701684.1\|4087549_4088491_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_151701685.1\|4089373_4089823_-	AsnC family transcriptional regulator	NA	NA	NA	NA
WP_151701686.1\|4090118_4090634_-\|protease	DJ-1/PfpI/YhbO family deglycase/protease	NA	NA	NA	NA

DBSCAN-SWA_10

4298742 : 4308914