CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP045013	Enterococcus faecium strain LAC7.2 plasmid pI, complete sequence	0 crisprs	RT,csa3,WYL,cas14j	3
NZ_CP045012	Enterococcus faecium strain LAC7.2 chromosome, complete genome	1 crisprs	RT,DEDDh,cas2,DinG,cas3,csa3,cas14j	7
NZ_CP045014	Enterococcus faecium strain LAC7.2 plasmid pII, complete sequence	0 crisprs	NA	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

40468 : 88027

Enterococcus_phage(25.0%)

holin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002295624.1\|40468_40591_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_002324498.1\|40744_41005_+	hypothetical protein	A0A0S2MYI8	Enterococcus_phage	8.2e-13	52.0
WP_002324499.1\|41452_41659_+	hypothetical protein	NA	NA	NA	NA
WP_002287517.1\|41658_41910_+	hypothetical protein	NA	NA	NA	NA
WP_002305049.1\|41925_42363_+	hypothetical protein	NA	NA	NA	NA
WP_002305050.1\|42355_43051_+	hypothetical protein	NA	NA	NA	NA
WP_002305052.1\|43890_44322_+	antitoxin HicB	F0PIL2	Enterococcus_phage	4.3e-43	64.9
WP_151901652.1\|44495_45446_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	9.6e-35	36.1
WP_167746204.1\|55567_55735_-	hypothetical protein	NA	NA	NA	NA
WP_151901653.1\|56327_57489_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.0e-78	50.9
WP_151901654.1\|62617_62800_+	hypothetical protein	NA	NA	NA	NA
WP_151901655.1\|71132_71324_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_151901656.1\|71399_71786_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_151901657.1\|72491_73388_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002293868.1\|74819_76766_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002302078.1\|76950_78390_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.4e-16	25.1
WP_002302077.1\|78391_79354_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	2.3e-20	25.8
WP_002301718.1\|81192_81648_+\|transposase	IS200/IS605 family transposase	I4AZI8	Saccharomonospora_phage	1.3e-13	31.6
WP_002289255.1\|82233_82464_-	resolvase	NA	NA	NA	NA
WP_002289254.1\|82693_83512_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_002289253.1\|83672_84362_+	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002289252.1\|84375_85878_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_002300328.1\|85890_86367_+	PTS glucose transporter subunit IIA	NA	NA	NA	NA
WP_086956687.1\|86864_88027_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3

DBSCAN-SWA_2

93133 : 166997

Streptococcus_phage(33.33%)

integrase,transposase

attL 94465:94482|attR 159401:159418

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002324528.1\|93133_93799_-\|integrase	site-specific integrase	A0A0S2MV79	Bacillus_phage	3.9e-19	31.1
WP_002290356.1\|93952_94102_-	hypothetical protein	NA	NA	NA	NA
WP_085057629.1\|94094_94304_-	DUF3173 domain-containing protein	NA	NA	NA	NA
94465:94482	attL	NA	NA	NA	NA
WP_002335326.1\|95808_97269_-	sucrose phosphorylase	NA	NA	NA	NA
WP_002342361.1\|97265_98486_-	hypothetical protein	NA	NA	NA	NA
WP_002324534.1\|98546_100730_-	alpha-galactosidase	NA	NA	NA	NA
WP_002290368.1\|100769_101600_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002290370.1\|101611_102484_-	sugar ABC transporter permease	NA	NA	NA	NA
WP_002290371.1\|102493_103753_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_085057628.1\|103900_105211_-	alpha-glucosidase/alpha-galactosidase	NA	NA	NA	NA
WP_002290373.1\|105242_106067_-	carbohydrate ABC transporter permease	NA	NA	NA	NA
WP_002290378.1\|108087_109113_-	LacI family transcriptional regulator	NA	NA	NA	NA
WP_085057627.1\|109357_110629_-	substrate-binding domain-containing protein	A0A1B1IVR3	uncultured_Mediterranean_phage	4.1e-17	45.0
WP_002290382.1\|111871_112345_+\|integrase	tyrosine-type recombinase/integrase	A0A097PAS9	Streptococcus_pyogenes_phage	2.3e-13	44.2
WP_002290383.1\|112517_113072_-\|integrase	tyrosine-type recombinase/integrase	W8CYP1	Bacillus_phage	8.6e-36	46.1
WP_002371918.1\|114417_115035_-	hypothetical protein	NA	NA	NA	NA
WP_002338094.1\|117538_118126_-	YdhK family protein	NA	NA	NA	NA
WP_002307659.1\|118155_118362_-	hypothetical protein	NA	NA	NA	NA
WP_002307657.1\|118376_119771_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.2e-39	32.8
WP_002294790.1\|119770_120451_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-36	37.4
WP_002371871.1\|120478_122062_-	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_151901658.1\|122072_122297_-	heavy-metal transporter	NA	NA	NA	NA
WP_002338096.1\|122930_123149_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002338097.1\|123165_125616_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	2.8e-86	30.5
WP_002307652.1\|125599_125965_-	hypothetical protein	NA	NA	NA	NA
WP_002319974.1\|125980_126595_-	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_002294779.1\|126750_127554_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002307648.1\|127537_127762_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002307645.1\|127758_127944_+	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_025479532.1\|128057_129608_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	4.8e-92	37.9
WP_002325571.1\|130318_131602_-	hypothetical protein	NA	NA	NA	NA
WP_002307641.1\|131780_132188_-	NusG domain II-containing protein	NA	NA	NA	NA
WP_002307639.1\|132459_133959_+	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	6.0e-15	40.5
WP_002307630.1\|135187_135484_-	hypothetical protein	NA	NA	NA	NA
WP_002307629.1\|135565_135832_-	YfhO family protein	NA	NA	NA	NA
WP_086953888.1\|136025_137188_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.6e-79	51.3
WP_002320192.1\|137907_139839_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.7e-97	36.7
WP_002320191.1\|140137_140452_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002320190.1\|140493_141402_+	cation transporter	NA	NA	NA	NA
WP_002338102.1\|141503_142115_-	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_002300950.1\|142131_142494_-	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	8.4e-16	41.3
WP_002338103.1\|142802_144707_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.8e-99	35.5
WP_002292161.1\|144904_145138_-	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002322689.1\|145284_146139_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002300938.1\|146123_146462_-	hypothetical protein	NA	NA	NA	NA
WP_002316708.1\|146689_147307_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_002292150.1\|147538_148111_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	3.9e-23	42.6
WP_002323279.1\|148665_149838_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	2.5e-133	99.6
WP_002298232.1\|150593_151886_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002297218.1\|152065_153361_+\|transposase	ISL3-like element ISEfa11 family transposase	A0A1S5SBP9	Streptococcus_phage	1.0e-42	29.1
WP_151901659.1\|162325_162655_-	AbrB family transcriptional regulator	NA	NA	NA	NA
159401:159418	attR	NA	NA	NA	NA
WP_002296840.1\|165809_166997_+\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3

DBSCAN-SWA_3

173811 : 189913

Streptococcus_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002285820.1\|173811_175017_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.5e-35	30.7
WP_167746205.1\|175070_175739_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.9e-123	98.2
WP_167746206.1\|175780_176209_-	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	1.0e-68	97.8
WP_001240982.1\|176438_179357_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-169	36.1
WP_000576156.1\|179360_179915_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.3e-36	52.1
WP_001038790.1\|180272_181010_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
WP_001814874.1\|181134_181218_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001096887.1\|181759_182554_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_000627290.1\|182646_183189_-	streptothricin N-acetyltransferase Sat4	A0A1B0RXL7	Streptococcus_phage	8.9e-94	100.0
WP_001255866.1\|183185_184094_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|184126_184861_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_002303392.1\|184841_185711_-	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	5.7e-151	90.3
WP_002303393.1\|185725_185950_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002294514.1\|187601_188405_-	lincosamide nucleotidyltransferase Lnu(B)	NA	NA	NA	NA
WP_167746207.1\|188458_189913_-	ABC-F type ribosomal protection protein Lsa(E)	A0A2H4UUX5	Bodo_saltans_virus	2.5e-26	26.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045012

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045012_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045012_1

2250191-2250300

Orphan

Consensus_repeat	Method
CTTTGCTCAACCAGTATTATTCATCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045012_1

>merge|NZ_CP045012|1|2250191-2250300|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCACCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCGCTTTGCTCAACCAGTATTGTTCATCA

>NZ_CP045012|1|1|2250191-2250300|CRISPRCasFinder
CTTTGCTCAACCAGTATTATTCATCA	CCTATTCACTTCGTTCATAGTGATTCTACTCGCTTTGCTCGAAAGGAAACTCCTTTCG
CTTTGCTCAACCAGTATTGTTCATCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045012.1\|WP_002294588.1\|2249193_2249562_-\|50S-ribosomal-protein-L7/L12	unknown	unknown	gnl\|CDD\|234671
NZ_CP045012.1\|WP_002294578.1\|2256725_2256878_-\|50S-ribosomal-protein-L33	unknown	unknown	gnl\|CDD\|234783
NZ_CP045012.1\|WP_002294584.1\|2252766_2253639_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	unknown	unknown	gnl\|CDD\|129801
NZ_CP045012.1\|WP_002291638.1\|2251320_2251743_-\|50S-ribosomal-protein-L11	unknown	unknown	gnl\|CDD\|234661
NZ_CP045012.1\|WP_002296327.1\|2248398_2249088_-\|TVP38/TMEM64-family-protein	unknown	unknown	gnl\|CDD\|223475
NZ_CP045012.1\|WP_002287791.1\|2240993_2242133_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP045012.1\|WP_002295743.1\|2246265_2247174_-\|IS982-like-element-ISEfm1-family-transposase	unknown	unknown	gnl\|CDD\|372648
NZ_CP045012.1\|WP_002290558.1\|2244343_2245876_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP045012.1\|WP_002287792.1\|2239939_2240905_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	unknown	unknown	gnl\|CDD\|275027
NZ_CP045012.1\|WP_002320938.1\|2247267_2248317_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340882
NZ_CP045012.1\|WP_002294579.1\|2256531_2256702_-\|preprotein-translocase-subunit-SecE	unknown	unknown	gnl\|CDD\|376355
NZ_CP045012.1\|WP_002294580.1\|2255885_2256431_-\|transcription-termination/antitermination-protein-NusG	unknown	unknown	gnl\|CDD\|180161
NZ_CP045012.1\|WP_002294585.1\|2252085_2252754_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	unknown	unknown	gnl\|CDD\|224674
NZ_CP045012.1\|WP_002294581.1\|2254921_2255809_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|283645
NZ_CP045012.1\|WP_002287787.1\|2243408_2244110_-\|glucosamine-6-phosphate-deaminase	unknown	unknown	gnl\|CDD\|238693
NZ_CP045012.1\|WP_002291634.1\|2249614_2250118_-\|50S-ribosomal-protein-L10	unknown	unknown	gnl\|CDD\|234632
NZ_CP045012.1\|WP_002294583.1\|2253729_2254749_-\|L-lactate-oxidase	unknown	unknown	gnl\|CDD\|240088
NZ_CP045012.1\|WP_002287788.1\|2242441_2243155_-\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP045012.1\|WP_002294587.1\|2250527_2251217_-\|50S-ribosomal-protein-L1	unknown	unknown	gnl\|CDD\|180071
NZ_CP045012.1\|WP_002294577.1\|2257039_2257684_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341358

Protein	Function_ID	Function_description	E-value
NZ_CP045012.1\|WP_002294588.1\|2249193_2249562_-\|50S-ribosomal-protein-L7/L12	gnl\|CDD\|234671	PRK00157, rplL, 50S ribosomal protein L7/L12; Reviewed.	5.30333e-45
NZ_CP045012.1\|WP_002294578.1\|2256725_2256878_-\|50S-ribosomal-protein-L33	gnl\|CDD\|234783	PRK00504, rpmG, 50S ribosomal protein L33; Validated.	3.12722e-17
NZ_CP045012.1\|WP_002294584.1\|2252766_2253639_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha	gnl\|CDD\|129801	TIGR00718, Probable_L-serine_dehydratase_alpha_chain, L-serine dehydratase, iron-sulfur-dependent, alpha subunit. This enzyme is also called serine deaminase. L-serine dehydratase converts serine into pyruvate in the gluconeogenesis pathway from serine. This model describes the alpha chain of an iron-sulfur-dependent L-serine dehydratase, found in Bacillus subtilis. A fairly deep split in a UPGMA tree separates members of this family of alpha chains from the homologous region of single chain forms such as found in Escherichia coli. This family of enzymes is not homologous to the pyridoxal phosphate-dependent threonine deaminases and eukaryotic serine deaminases. [Energy metabolism, Amino acids and amines, Energy metabolism, Glycolysis/gluconeogenesis].	2.63238e-103
NZ_CP045012.1\|WP_002291638.1\|2251320_2251743_-\|50S-ribosomal-protein-L11	gnl\|CDD\|234661	PRK00140, rplK, 50S ribosomal protein L11; Validated.	9.059e-96
NZ_CP045012.1\|WP_002296327.1\|2248398_2249088_-\|TVP38/TMEM64-family-protein	gnl\|CDD\|223475	COG0398, COG0398, Uncharacterized conserved protein [Function unknown].	2.9371e-19
NZ_CP045012.1\|WP_002287791.1\|2240993_2242133_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	2.06838e-61
NZ_CP045012.1\|WP_002295743.1\|2246265_2247174_-\|IS982-like-element-ISEfm1-family-transposase	gnl\|CDD\|372648	pfam13612, DDE_Tnp_1_3, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.39418e-18
NZ_CP045012.1\|WP_002290558.1\|2244343_2245876_+\|ABC-F-family-ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	5.56109e-170
NZ_CP045012.1\|WP_002287792.1\|2239939_2240905_+\|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta	gnl\|CDD\|275027	TIGR04171, ribonucleotide-diphosphate_reductase_subunit_beta, ribonucleoside-diphosphate reductase, class 1b, beta subunit. Members of this family are NrdF, the beta subunit of class 1b ribonucleotide reductase. This form uses a dimanganese moiety associated with a tyrosine radical to reduce the cellular requirement for iron. [Purines, pyrimidines, nucleosides, and nucleotides, 2'-Deoxyribonucleotide metabolism].	0
NZ_CP045012.1\|WP_002320938.1\|2247267_2248317_-\|MFS-transporter	gnl\|CDD\|340882	cd17324, MFS_NepI_like, Purine ribonucleoside efflux pump NepI and similar transporters of the Major Facilitator Superfamily. This family is composed of purine efflux pumps such as Escherichia coli NepI and Bacillus subtilis PbuE, sugar efflux transporters such as Corynebacterium glutamicum arabinose efflux permease, multidrug resistance (MDR) transporters such as Streptomyces lividans chloramphenicol resistance protein (CmlR), and similar proteins. NepI and PbuE are involved in the efflux of purine ribonucleosides such as guanosine, adenosine and inosine, as well as purine bases like guanine, adenine, and hypoxanthine, and purine base analogs. They play a role in the maintenance of cellular purine base pools, as well as in protecting the cells and conferring resistance against toxic purine base analogs such as 6-mercaptopurine. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The NepI-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.96069e-56
NZ_CP045012.1\|WP_002294579.1\|2256531_2256702_-\|preprotein-translocase-subunit-SecE	gnl\|CDD\|376355	pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex.	1.48e-13
NZ_CP045012.1\|WP_002294580.1\|2255885_2256431_-\|transcription-termination/antitermination-protein-NusG	gnl\|CDD\|180161	PRK05609, nusG, transcription antitermination protein NusG; Validated.	1.97252e-86
NZ_CP045012.1\|WP_002294585.1\|2252085_2252754_+\|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta	gnl\|CDD\|224674	COG1760, SdaA, L-serine deaminase [Amino acid transport and metabolism].	1.41351e-73
NZ_CP045012.1\|WP_002294581.1\|2254921_2255809_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|283645	pfam06028, DUF915, Alpha/beta hydrolase of unknown function (DUF915). This family consists of several bacterial proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.	4.81944e-80
NZ_CP045012.1\|WP_002287787.1\|2243408_2244110_-\|glucosamine-6-phosphate-deaminase	gnl\|CDD\|238693	cd01399, GlcN6P_deaminase, GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P) deaminase subfamily; GlcN6P deaminase catalyzes the reversible conversion of GlcN6P to D-fructose-6-phosphate (Fru6P) and ammonium. The reaction is an aldo-keto isomerization coupled with an amination or deamination. It is the last step of the metabolic pathway of N-acetyl-D-glucosamine-6-phosphate (GlcNAc6P). GlcN6P deaminase is a hexameric enzyme that is allosterically activated by GlcNAc6P.	8.8122e-119
NZ_CP045012.1\|WP_002291634.1\|2249614_2250118_-\|50S-ribosomal-protein-L10	gnl\|CDD\|234632	PRK00099, rplJ, 50S ribosomal protein L10; Reviewed.	3.03735e-67
NZ_CP045012.1\|WP_002294583.1\|2253729_2254749_-\|L-lactate-oxidase	gnl\|CDD\|240088	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain. LOX is a member of the family of FMN-containing alpha-hydroxyacid oxidases and catalyzes the oxidation of l-lactate using molecular oxygen to generate pyruvate and H2O2. This family occurs in both prokaryotes and eukaryotes. Members of this family include flavocytochrome b2 (FCB2), glycolate oxidase (GOX), lactate monooxygenase (LMO), mandelate dehydrogenase (MDH), and long chain hydroxyacid oxidase (LCHAO).	0
NZ_CP045012.1\|WP_002287788.1\|2242441_2243155_-\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	6.15701e-49
NZ_CP045012.1\|WP_002294587.1\|2250527_2251217_-\|50S-ribosomal-protein-L1	gnl\|CDD\|180071	PRK05424, rplA, 50S ribosomal protein L1; Validated.	1.66496e-146
NZ_CP045012.1\|WP_002294577.1\|2257039_2257684_+\|CBS-domain-containing-protein	gnl\|CDD\|341358	cd02205, CBS_pair_SF, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains superfamily. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.69774e-14

>NZ_CP045012.1|WP_002291634.1|2249614_2250118_-|50S-ribosomal-protein-L10
MSEAIIAKKAAIVDEVSEKFTAAASVVVVDYRGLTVDEVTRLRKQLRDANVEMKVIKNSILSRAAKKAGLEGMDEVFTGPTAVAFSNEDVVAPAKIMDEFAKEAKALEIKGGIIEGKVSSLEEITALAKLPNREGLLSMLLSVLQAPVRNVAYAVKAVADKEDGDAA
>NZ_CP045012.1|WP_002294588.1|2249193_2249562_-|50S-ribosomal-protein-L7/L12
MALNIENIVAELKEATILELNDLVKAIEEEFGVSAAAPVAVAAAGGAAAAEEQTEFTVELTAAGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGVSKEEAEELKAKLEEVGASVTVK
>NZ_CP045012.1|WP_002296327.1|2248398_2249088_-|TVP38/TMEM64-family-protein
MKKKIIRLMLISLGIILILVVGYRLYLEYQTDIQLFLNPRASKAELLAHIRSHGTFASILLIVLTAVMCAVPGIPTSVVGVIAGLSFGPLTGAIINILGNALGNITAIFLMHRLKFLDKKTETNHWVQAIRQMKHPKIGVMLGYMIPVIPSSMVNFAADAMKLPLQQIILSIVIGVIPSSVLYACGGEALFHGYNKTAVTLVASVTVLVGLVVFIYKDRKKKQGKQKHK
>NZ_CP045012.1|WP_002320938.1|2247267_2248317_-|MFS-transporter
MKSNEKTPLTTSLILLLSITCGVVVANMYYIQPIGTKVAASLSVSTSAVGILTMLTQLGYALGLLFLVPLGDVVDRPKLIIRMVALSAVSLLAAFFAPSFTLFACASFLIGLLSIVPQIIIPYGAVLAGPKARGKVMGTLLSGLLVGILLSRTVSGIVASLFSWRMIYLFALCAVGILTLLLYWKMPRSVQQSSTAVSYLDSLKSLPHLVASQRLLREAAVSGFFMFGTFSIFWSTLIFYISSPAYNWGTFEAGILAIFGLSGAVAAPIVGRLADSYSERKIVYMGLVMQTISFIALLVGGSHLAILLLAIILLDVGNQFGQVANQTRVQGLGEAASNRNNTVFTRGAS
>NZ_CP045012.1|WP_002295743.1|2246265_2247174_-|IS982-like-element-ISEfm1-family-transposase
MRSSKYTEHYTDTFITFKEIMRTVSNIYHNCVPDKIKNRRNTDQLKQRDTVIIACVIWGIINGYTSQRATYRAVCSVLFPNGDFPSRSRFTRLSSNLAYTIKIIRYFFIKKLTKGELVGIIDSFPSPLCKPVRNRQAKLLNQIAKVGYNSTKKSYFYGLKIHMIVTKTGFPITYSITNPGVHDVKVLETLSEEANLPNILGDKGYISHKIHEKLALKGITISVPPRKNMDKSEKLDHSLLGKQRKTVETVFSSLEKLGCQNFNSRSVKGLESRFESILLAYSVLLSRAQRRFEGTLRYSLGY
>NZ_CP045012.1|WP_002290558.1|2244343_2245876_+|ABC-F-family-ATP-binding-cassette-domain-containing-protein
MSILTLNNITQQFGDKILYEGVDLQLNAGEHLGLIGQNGAGKSTLIKIITGEILPDDGQIHWQKNIHKGYLDQYVEVDETLTIEEFLKTAYAKEYEKEEKIAFLYQTYSETFDDSLLEKAGKLQTELDQGVFYQIDTLVAEMSSGLGIDVLGLDSLLKNLSGGQRSKVILAKLLLENPDVLILDEPTNHLDDQHIQWLTQFLQDFDGAYIVISHDQEFLDQITTHIADIEFGKITKYTGHLKQALKQKEQNRESYLRQYHAQQKQIEKTEAYIRKYKAGSRSTMAKSRQKQLDKIERLTPPASASKAVFDFPFSPIVTTLAVETTDLVIGYDRPLLAPINLTIRFGENIAIRGFNGIGKSTLLKTLIGEIEKISGDFHFPDNTKINYFSQDLYWENPLETPLQYLSSQFPKATIKELRRQLAKAGLVNQLASEPLTTLSGGEQTKVKLAQLTMNQGNLLILDEPTNHIDQETKESLQDGIQKFPGTVIIVSHEQEFYQDLVQRVIEIEPK
>NZ_CP045012.1|WP_002287787.1|2243408_2244110_-|glucosamine-6-phosphate-deaminase
MEIIRVKNAEEGGKKAFEIIKEGMNKGAKVLGLATGSTPVTLYKEMTSSDLDFSEMTSVNLDEYVGLGGSDEQSYRHFMDVQLFDKKPFKETFVPDGKAEDLEAACKKYDQIIDAHPIDIQILGIGQNGHIGFNEPGASFDGTTSVVDLTESTINANKRFFDKAEDVPTKAVSMGIGSIMKSKEIVLMAFGESKADAIKGMIEGPVTNHLPASVLQNHDNVVVIIDEEAASKL
>NZ_CP045012.1|WP_002287788.1|2242441_2243155_-|MgtC/SapB-family-protein
MNDMVLTIPEIILRLGIAMLFGGAIGFERQYKNRPAGMRTHILVCMGACIIALIQVEIASGALRDALEYPQLAGTIRSDEARLIAQVVSGVGFLGAGTIIVTKQSVTGLTTAASLWAIAGLGIAIGMGYYSIAIISFIGIAIALTVVKRVIHVPTTKKLEIQFIHRKETKDFLTDYFEEKNIVIEDVNFDVKFVDDYRVYKNIYTIDLPKGLTYADVIEELSVHKNITKLHLVSIAQ
>NZ_CP045012.1|WP_002287791.1|2240993_2242133_-|AI-2E-family-transporter
MQSRFKQSKLFFWTVELVLTIIGVYFILQMPNIFSPILKMLSAIFLPLLVAGFIYYMFDPIVVFLEKHRIPRVFGFLLTFLVVIILVVLTVMNVVPQLMEQTIQLTQSLPMYADETSKWLNELAQREEFKNFNLEEQLASANLSLSNLFNIILVSLSASVSKIISFMMQFFILLFTVPFILLFMFKDGHKFIDALSHFFPKAIRKELRQTVKELNETLSAYISSTILDALIIGVMSFLAMRIFDQPYSLLLAVICGITNIIPYVGPFIGAVPAIIVGLFISPFQALYMALSILVIQQLDGNLIKPLLFGKSMNIHPLTIILVLIGAGSVAGILGMLICIPVYAVIKTIILNIRKIYLLRRMEHVSEKLDSPKVLEETSE
>NZ_CP045012.1|WP_002287792.1|2239939_2240905_+|class-1b-ribonucleoside-diphosphate-reductase-subunit-beta
MSETYYEAINWNEIEDIIDKSTWEKLTEQFWLDTRIPLSNDLDDWRTLSQLEKDTVGHVFGGLTLLDTVQSESGMDQLRKDVRTPHEEAVLNNIQFMESVHAKSYSSIFSTLNTKKEIEEIFDWTNTNPYLQKKAERINEIYKHGTPLEKKIASVFLETFLFYSGFYTPLYYLGNNKLANVAEIIKLIIRDESVHGTYIGYKFQLGFNELPEAEQETLKDWMYNLLYELYENEERYTEELYDPIGWTEEVKTFLRYNANKALMNLGMDPLFPDTANDVNPIVMNGISTGTSNHDFFSQVGNGYLLGHVEAMKDDDYLIGLE
>NZ_CP045012.1|WP_002294587.1|2250527_2251217_-|50S-ribosomal-protein-L1
MAKKSKKMQDALKKVDSSKVYPVAEAVALAKETNIAKFDATVEVAYRLNVDPKKADQQIRGAVVLPNGTGKTQTVLVFAKGDKAKEAEAAGADFVGDDDMVQKIQNGWFDFDVVVATPDMMATVGRLGRVLGPKGLMPNPKTGTVTMDVTKAVNEVKAGKVTYRVDKAGNIHVPIGKVSFDDEKLVENFAAIHDVLLKAKPSAAKGQYMKNVTITTTFGPGIHVDQASF
>NZ_CP045012.1|WP_002291638.1|2251320_2251743_-|50S-ribosomal-protein-L11
MAKKVEKIVKLQIPAGKATPAPPVGPALGQAGINIMGFTKEFNARTADQAGLIIPVVISVYEDRSFTFVTKTPPAAVLLKKAAKIEKGSGEPNKNKVAKVSSDQVREIAELKMEDLNAANVEAAMRMVEGTARSMGITVE
>NZ_CP045012.1|WP_002294585.1|2252085_2252754_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-beta
MKDLRYRSVFDIIGPVMIGPSSSHTAGAARIGKIIRSIFGEQPDSVDIYLYESFAKTYRGHGTDIALVGGLLGMEPDDERLADSLKLAYEAGMEVLFVPKSEKAEHPNSVKMLLKKGTRKLSVTGISIGGGNIQISELNGFKISLSMGTPTLIVVHQDVPGMIAKVTSILSETNTNIGTMTVTRESKGENAIMIIEVDDPQVEETVKRLKQLPNIDSVNYFD
>NZ_CP045012.1|WP_002294584.1|2252766_2253639_+|L-serine-ammonia-lyase,-iron-sulfur-dependent,-subunit-alpha
MFLSIEELVDQAKAYPSVAELMIAVEMEMSGRSRSHIIEIMEKNLSVMEQSINEGKEGVTSVTGITGGDAKKLDDYLNEADFLSGETILKAVRNAVAVNEVNAKMGLICATPTAGSAGVVPGVLMAVRDRLDLTHEQQLEFLFTAGAFGLVIANNASISGAEGGCQAEVGSASAMAAAALVCAKNGTPHQAAQAVAITLKNMMGLICDPVAGLVEVPCVKRNALGSSQAFISADMALAGIESVIPPDEVVAAMYQVGRQMPSIFKETAEGGLAVTPTAKRLAEEILNKRA
>NZ_CP045012.1|WP_002294583.1|2253729_2254749_-|L-lactate-oxidase
MEAGAFGYIRGGSEDEWTMKENTTSFNTKKIMPRILRGIDSADLHTSVFGIELDTPIIQAPSAAQGLAHEKGEADTAKGVAAAGSIFSISTYANTTIKDAADAAPGAPQFFQLYMSKDDRFNEFILNKAVEAGAKAIILTADSTLGGYREEDVINQFQFPLPMPNLAAYSEQSASGNGEGKGIAEIYAAAKQGLTPDDIKTIKEITHLPVIVKGIQSPEDAVIAISAGADGIWVSNHGGRQLDGGPASFEVLPKIAEVVNKRVPVIFDSGVRRGEHVFKALASGADLVAIGRPVIYGLNLGGAEGVTSVFEHLNKELSITMQLAGTKTIDEVKNTKLMD
>NZ_CP045012.1|WP_002294581.1|2254921_2255809_-|alpha/beta-fold-hydrolase
MTEPIKNLCKRATAAALVLISLFALSGCQTTKINTTEVSDKEKTAESSKVIEKTTIPTLFFHGYSGTENSFKGMLRRLEKNQQAVKELVLTVGTDGQIQATGDLSGKADNPMVQVLFEDNKNNEWNQAEWIKTCLLYLKENYGIDKVNIVGHSMGGVSALRYLGTYGQDTSLPQVQTLTAIGAPFNDFVDDSAQSLTDELAKGPAVVSNRYQDYQQMIGNIPITTRFFLIAGQLDETDLSDGTVPLNSALAVYALLKQRGNEIEEKVVTGENASHSMLHENQEVDQLVSRFIWKE
>NZ_CP045012.1|WP_002294580.1|2255885_2256431_-|transcription-termination/antitermination-protein-NusG
MESFEKNWYVLHTYSGYENKVKANIESRAQSMKMADFIFRVVVPEEKETEVKNGKEKEIVHKTFPGYVLVEMIMTDASWYVVRNTPGVTGFVGSHGAGSKPAPLLPEEVNHILRSIGMSLRQNDLEVEVGEVVKIIEGAFAGLEGQVTEVDGEKEKLKVNIDMFGRETSTELDFDQVDKID
>NZ_CP045012.1|WP_002294579.1|2256531_2256702_-|preprotein-translocase-subunit-SecE
MKFLKSVKDEIKQVTWPSRKQLRKDTLVVIETSIIFGLMFYVMDTAIQSLFGWILK
>NZ_CP045012.1|WP_002294578.1|2256725_2256878_-|50S-ribosomal-protein-L33
MAKKKAALACSVCGSRNYTKSVSEGKSGERLEINKFCKYCNQYTLHKETK
>NZ_CP045012.1|WP_002294577.1|2257039_2257684_+|CBS-domain-containing-protein
MLLKTLVYKKKDLTTVTETSTLEEALKILETSGYRCVPILDSSGNIFRGNIYKMHIYRHKANGGDMTLPVTHLLKNATKFIYLDTSFFKVFFTIKELPYIAVLDSENHFYGILTHSTLLNMLSQSWSVEQGSYVLTIASTGKQGDLAAIAKIISKHSSIASCITLDIEKDEYIRRTLITLPANTEAKVCETIVNHLEKKNYKVVEIENLQNQEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

240784 : 259803

Streptococcus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002319485.1\|240784_242074_-	PDZ domain-containing protein	A0A1B1IT49	uncultured_Mediterranean_phage	5.7e-22	30.2
WP_002345011.1\|242501_242981_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_000420682.1\|243333_243648_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	5.2e-54	100.0
WP_000985015.1\|243663_244050_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	3.0e-64	100.0
WP_000813488.1\|244078_245464_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	1.1e-265	100.0
WP_000398284.1\|245642_246848_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	2.8e-233	100.0
WP_002286940.1\|247631_249542_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.1e-37	29.8
WP_032509114.1\|249645_249870_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	8.5e-27	97.1
WP_002345010.1\|249986_250484_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.3e-88	97.6
WP_002345009.1\|250570_250963_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.6e-68	99.2
WP_000331148.1\|250946_253394_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	98.4
WP_002345008.1\|253396_255580_+	membrane protein	A0A1S5SF30	Streptococcus_phage	2.9e-305	82.3
WP_002345007.1\|255576_256578_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	1.3e-183	95.5
WP_002345006.1\|256592_257507_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	4.7e-156	92.1
WP_001814923.1\|257751_257868_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_002345005.1\|257883_259803_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	96.6

DBSCAN-SWA_2

754462 : 762934

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002294039.1\|754462_755107_+	dTMP kinase	M1PSC7	Streptococcus_phage	4.2e-58	52.6
WP_002292340.1\|755121_755451_+	hypothetical protein	NA	NA	NA	NA
WP_002288071.1\|755464_756403_+	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	3.3e-35	34.4
WP_002288073.1\|756438_757263_+	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002288076.1\|757255_757603_+	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	5.1e-18	41.1
WP_002288078.1\|757671_758544_+	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	3.1e-88	60.4
WP_002294035.1\|758652_759774_+	DNA polymerase IV	NA	NA	NA	NA
WP_002288081.1\|759827_760430_-	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A288TZV3	Enterococcus_phage	1.7e-53	58.6
WP_002288083.1\|760744_762934_-	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.8e-286	66.6

DBSCAN-SWA_3

815944 : 886066

Bacillus_phage(27.27%)

transposase,tail,tRNA,terminase,protease,integrase,portal,head,holin,capsid

attL 884481:884496|attR 887832:887847

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002286621.1\|815944_818743_+\|tRNA	isoleucine--tRNA ligase	A0A2H4UVG0	Bodo_saltans_virus	1.6e-74	26.4
WP_002286618.1\|818791_820318_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	8.9e-75	35.3
WP_002286616.1\|820332_820980_-	metal-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286678.1\|821163_821493_-	DUF4828 domain-containing protein	NA	NA	NA	NA
WP_002286614.1\|821669_822398_+	DNA/RNA nuclease SfsA	NA	NA	NA	NA
WP_002286612.1\|822413_823427_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_002286608.1\|823426_824704_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-35	28.8
WP_002286607.1\|824766_827469_+	sigma-54-dependent transcriptional regulator	NA	NA	NA	NA
WP_002286606.1\|827620_827938_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_002286604.1\|827967_828288_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002286601.1\|828395_829856_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002286598.1\|829923_830145_+	hypothetical protein	NA	NA	NA	NA
WP_002286596.1\|830175_830358_+	DUF3188 domain-containing protein	NA	NA	NA	NA
WP_002286592.1\|830357_830771_+	DUF3284 domain-containing protein	NA	NA	NA	NA
WP_002286589.1\|830893_832075_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002286676.1\|832145_832310_-	hypothetical protein	NA	NA	NA	NA
WP_002286587.1\|832605_833745_-\|integrase	site-specific integrase	Q9AZR0	Lactococcus_phage	2.6e-95	47.1
WP_002296617.1\|834043_834679_-	hypothetical protein	NA	NA	NA	NA
WP_002296616.1\|834791_835427_-	hypothetical protein	NA	NA	NA	NA
WP_002303013.1\|835460_835922_-	DUF4429 domain-containing protein	A0A0F6N4L7	Staphylococcus_phage	4.5e-06	34.8
WP_002296613.1\|836051_836483_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_010721531.1\|836500_836821_-	helix-turn-helix transcriptional regulator	A0A182BQC8	Lactococcus_phage	2.1e-18	49.1
WP_002323901.1\|837114_837306_+	hypothetical protein	Q9T1I7	Lactobacillus_phage	1.4e-06	35.5
WP_002323902.1\|837319_837580_+	hypothetical protein	NA	NA	NA	NA
WP_167746203.1\|837628_837802_+	hypothetical protein	NA	NA	NA	NA
WP_002323904.1\|837915_838323_-	hypothetical protein	NA	NA	NA	NA
WP_002323905.1\|838375_839101_+	phage regulatory protein	D2IYT0	Enterococcus_phage	3.3e-27	35.1
WP_002339931.1\|839279_839621_+	hypothetical protein	NA	NA	NA	NA
WP_002339932.1\|839613_840348_+	DUF1071 domain-containing protein	A0A1X9IGE5	Lactococcus_phage	2.1e-42	48.4
WP_002339933.1\|840353_841040_+	hypothetical protein	C9E2N1	Enterococcus_phage	4.9e-89	70.0
WP_151901613.1\|841043_841790_+	helix-turn-helix domain-containing protein	A0A1L2BY83	Clostridium_phage	2.0e-32	55.6
WP_002286696.1\|841801_842071_+	hypothetical protein	NA	NA	NA	NA
WP_002296607.1\|842075_842240_+	hypothetical protein	NA	NA	NA	NA
WP_002286695.1\|842232_842535_+	hypothetical protein	NA	NA	NA	NA
WP_002296606.1\|842531_842693_+	antitoxin	NA	NA	NA	NA
WP_002286694.1\|842689_842995_+	hypothetical protein	NA	NA	NA	NA
WP_002286550.1\|842994_843351_+	DUF1140 family protein	A0A2H4JAZ4	uncultured_Caudovirales_phage	3.1e-10	37.4
WP_002296604.1\|843310_843556_+	hypothetical protein	NA	NA	NA	NA
WP_002286547.1\|843552_843972_+	hypothetical protein	D2IZL0	Enterococcus_phage	4.1e-30	54.3
WP_002286545.1\|843968_844526_+	DUF1642 domain-containing protein	A0A0C5KKV2	Enterococcus_phage	2.8e-10	36.2
WP_002286693.1\|844522_844819_+	hypothetical protein	NA	NA	NA	NA
WP_002286542.1\|844895_845309_+	autolysin	C9E2P5	Enterococcus_phage	1.5e-56	81.0
WP_002296602.1\|845617_845770_+	hypothetical protein	NA	NA	NA	NA
WP_002300143.1\|845766_846042_-	hypothetical protein	A0A2H4JEH2	uncultured_Caudovirales_phage	9.9e-17	45.7
WP_002311723.1\|846495_846702_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|846897_847065_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|847090_847435_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|847439_847721_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|847823_848138_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|848115_849810_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|849829_851008_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|850970_851657_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|851656_852817_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|852826_853702_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|853698_854010_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|853999_854353_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|854342_854744_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|854736_855141_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|855152_855761_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|855780_856143_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|856145_856328_+	hypothetical protein	NA	NA	NA	NA
WP_151901614.1\|856344_859764_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002311723.1\|860213_860420_+	hypothetical protein	NA	NA	NA	NA
WP_002296600.1\|860615_860783_+	thymidylate synthase	NA	NA	NA	NA
WP_002286540.1\|860808_861153_+	HNH endonuclease	A0A1B1P757	Bacillus_phage	3.8e-26	57.1
WP_002296599.1\|861157_861439_+	hypothetical protein	NA	NA	NA	NA
WP_002286538.1\|861541_861856_+\|terminase	terminase	A0A1S7FYW6	Listeria_phage	3.3e-08	37.9
WP_002286533.1\|861833_863528_+\|terminase	terminase large subunit	A0A1B1P766	Bacillus_phage	3.0e-148	49.6
WP_002286530.1\|863547_864726_+\|portal	phage portal protein	A0A1B1P754	Bacillus_phage	5.4e-80	40.4
WP_002286527.1\|864688_865375_+\|protease	Clp protease ClpP	A0A2I6PDD0	Staphylococcus_phage	1.0e-30	39.7
WP_002286525.1\|865374_866535_+\|capsid	phage major capsid protein	A0A1B1P752	Bacillus_phage	1.8e-99	50.1
WP_002286524.1\|866544_867420_+	hypothetical protein	D2IYX3	Enterococcus_phage	5.6e-130	74.2
WP_002286523.1\|867416_867728_+	hypothetical protein	A0A1B1P751	Bacillus_phage	6.3e-12	42.1
WP_002286522.1\|867717_868071_+\|head	phage head closure protein	NA	NA	NA	NA
WP_002296598.1\|868060_868462_+	hypothetical protein	A0A1B1P759	Bacillus_phage	1.1e-13	33.3
WP_002286516.1\|868454_868859_+	hypothetical protein	R4IBU7	Listeria_phage	6.1e-07	29.5
WP_002286512.1\|868870_869479_+	hypothetical protein	Q8W5Z9	Listeria_phage	3.0e-34	41.1
WP_002286510.1\|869498_869861_+	hypothetical protein	NA	NA	NA	NA
WP_002305377.1\|869863_870046_+	hypothetical protein	NA	NA	NA	NA
WP_151901615.1\|870062_873494_+\|tail	phage tail tape measure protein	A0A1D3SNL5	Enterococcus_phage	3.1e-67	44.4
WP_002334516.1\|873544_874282_+\|tail	phage tail protein	NA	NA	NA	NA
WP_002296595.1\|874291_876583_+	hypothetical protein	A0A1D3SNL1	Enterococcus_phage	1.6e-88	30.0
WP_002290627.1\|878749_878899_+	hypothetical protein	NA	NA	NA	NA
WP_002286491.1\|878895_879342_+	hypothetical protein	NA	NA	NA	NA
WP_002296594.1\|879343_879481_+	XkdX family protein	NA	NA	NA	NA
WP_002286686.1\|879518_879812_+	hypothetical protein	NA	NA	NA	NA
WP_002286683.1\|879808_880033_+\|holin	holin	NA	NA	NA	NA
WP_002286484.1\|880029_881055_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	2.1e-64	61.3
WP_087046766.1\|881994_883156_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	4.1e-80	54.2
WP_002286474.1\|884083_884491_+	hypothetical protein	NA	NA	NA	NA
884481:884496	attL	NA	NA	NA	NA
WP_002296902.1\|884504_884906_+	hypothetical protein	NA	NA	NA	NA
WP_002286473.1\|884907_885279_+	hypothetical protein	NA	NA	NA	NA
WP_002286680.1\|885314_885617_-	hypothetical protein	NA	NA	NA	NA
WP_002286470.1\|885865_886066_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	4.6e-08	75.7
887832:887847	attR	NA	NA	NA	NA

DBSCAN-SWA_4

1182255 : 1191316

Gordonia_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002288023.1\|1182255_1183551_+	adenylosuccinate lyase	A0A1B3B081	Gordonia_phage	4.5e-19	33.1
WP_002297115.1\|1183730_1184108_-	hypothetical protein	NA	NA	NA	NA
WP_002288021.1\|1184363_1185092_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	E3SPA9	Prochlorococcus_phage	4.6e-45	41.4
WP_002295474.1\|1185091_1185346_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002288017.1\|1185347_1186019_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002288015.1\|1186019_1188242_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.9e-150	41.3
WP_002288013.1\|1188226_1189666_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.3e-53	33.1
WP_002321731.1\|1189697_1190741_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SE90	Cyanophage	2.7e-62	43.7
WP_002288010.1\|1190737_1191316_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.3e-26	37.4

DBSCAN-SWA_5

1715166 : 1724982

Streptococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002293934.1\|1715166_1716420_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4PQX1	Staphylococcus_phage	4.5e-24	55.3
WP_002288577.1\|1716490_1716976_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_002293935.1\|1716998_1717757_-	type I 3-dehydroquinate dehydratase	W6LP76	Streptococcus_phage	8.5e-26	36.9
WP_002293936.1\|1717772_1718951_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	7.8e-103	49.2
WP_002293938.1\|1719180_1721301_+	LTA synthase family protein	W6LM83	Streptococcus_phage	3.7e-220	58.3
WP_002297641.1\|1721523_1722249_+	hypothetical protein	NA	NA	NA	NA
WP_002288586.1\|1722238_1722748_+	hypothetical protein	NA	NA	NA	NA
WP_002293941.1\|1722817_1724266_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	2.3e-19	29.3
WP_002293942.1\|1724265_1724982_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.0e-33	35.7

DBSCAN-SWA_6

1960451 : 1983543

uncultured_Caudovirales_phage(40.0%)

transposase,tail,terminase,portal,head,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002300314.1\|1960451_1961621_-\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_002323810.1\|1961748_1963113_-	NAD(P)/FAD-dependent oxidoreductase	A0A2K5B2C5	Erysipelothrix_phage	9.3e-07	25.7
WP_002305555.1\|1963109_1964669_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002326300.1\|1964724_1967205_-	hypothetical protein	NA	NA	NA	NA
WP_002295066.1\|1967188_1967524_-	hypothetical protein	NA	NA	NA	NA
WP_002296471.1\|1967537_1968572_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_002296472.1\|1968661_1969342_-	WxL domain-containing protein	NA	NA	NA	NA
WP_002296473.1\|1969625_1970729_-	L-lactate oxidase	NA	NA	NA	NA
WP_002296474.1\|1971357_1971828_-	DUF4809 family protein	NA	NA	NA	NA
WP_002296476.1\|1972157_1973798_+	NAD-dependent malic enzyme	NA	NA	NA	NA
WP_002301062.1\|1973951_1975274_+	2-hydroxycarboxylate transporter family protein	NA	NA	NA	NA
WP_002296478.1\|1975341_1975776_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002296480.1\|1975840_1976677_-	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_002296483.1\|1978340_1978676_-\|head	phage head closure protein	V5UQC7	Enterococcus_phage	4.7e-13	35.6
WP_002296484.1\|1978662_1978947_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_002296485.1\|1979002_1980526_-\|capsid	phage major capsid protein	A0A1W6JPR8	Staphylococcus_phage	1.4e-48	37.4
WP_002296486.1\|1980518_1981694_-\|portal	phage portal protein	A0A2H4J5A4	uncultured_Caudovirales_phage	3.2e-64	35.6
WP_002317249.1\|1981697_1981883_-	hypothetical protein	NA	NA	NA	NA
WP_002296487.1\|1981848_1983543_-\|terminase	terminase large subunit	A0A2H4JBN3	uncultured_Caudovirales_phage	9.1e-129	43.8

DBSCAN-SWA_7

2213722 : 2247174

uncultured_virus(15.38%)

transposase,bacteriocin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002296840.1\|2213722_2214910_-\|transposase	IS256-like element IS16 family transposase	A0A0K2CZ57	Paenibacillus_phage	8.2e-92	46.3
WP_002288864.1\|2215322_2216948_-	chaperonin GroEL	A0A219YK78	uncultured_virus	2.2e-156	56.8
WP_002288862.1\|2216998_2217283_-	co-chaperone GroES	A0A221S4M3	uncultured_virus	2.0e-12	40.2
WP_002288860.1\|2217507_2218170_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_002288858.1\|2218245_2219538_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002288856.1\|2219707_2220337_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_002288854.1\|2220439_2221249_-	MBL fold metallo-hydrolase	A0A0C5AJ83	Bacteriophage	3.1e-34	33.6
WP_002288853.1\|2221303_2222173_-	hypothetical protein	NA	NA	NA	NA
WP_002288852.1\|2222173_2223490_-	hypothetical protein	NA	NA	NA	NA
WP_002288851.1\|2223486_2225322_-	cell wall metabolism sensor histidine kinase WalK	W8CYF6	Bacillus_phage	4.0e-37	37.7
WP_002288850.1\|2225326_2226031_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.8e-45	41.6
WP_002288847.1\|2226220_2227081_-	DegV family protein	A0A1X9I5J4	Streptococcus_phage	2.7e-12	24.4
WP_002322652.1\|2227067_2227637_-	DUF1836 domain-containing protein	NA	NA	NA	NA
WP_151901641.1\|2228266_2229220_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_002321654.1\|2229216_2229363_-\|bacteriocin	EntF family bacteriocin induction factor	NA	NA	NA	NA
WP_002287810.1\|2229466_2229778_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_002304799.1\|2229779_2229977_-	enterocin	NA	NA	NA	NA
WP_002287807.1\|2230370_2232098_-	ABC transporter permease/substrate binding protein	NA	NA	NA	NA
WP_002287805.1\|2232090_2233284_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.2e-29	37.0
WP_002287801.1\|2233470_2234115_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_002290587.1\|2234208_2234343_-	hypothetical protein	NA	NA	NA	NA
WP_002287799.1\|2234344_2236477_-	ferrous iron transport protein B	NA	NA	NA	NA
WP_002287797.1\|2236473_2236947_-	ferrous iron transport protein A	NA	NA	NA	NA
WP_002287795.1\|2237347_2237572_+	glutaredoxin-like protein NrdH	A0A0M7REK7	Lactobacillus_phage	1.7e-11	42.7
WP_002287793.1\|2237730_2239890_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	3.8e-265	63.2
WP_002287792.1\|2239939_2240905_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A096XT60	Enterococcus_phage	3.4e-128	70.4
WP_002287791.1\|2240993_2242133_-	AI-2E family transporter	NA	NA	NA	NA
WP_002287788.1\|2242441_2243155_-	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.5e-20	43.7
WP_002287787.1\|2243408_2244110_-	glucosamine-6-phosphate deaminase	NA	NA	NA	NA
WP_002290558.1\|2244343_2245876_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	3.3e-45	28.0
WP_002295743.1\|2246265_2247174_-\|transposase	IS982-like element ISEfm1 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045013

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045012

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection