CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045033	Lactobacillus kefiranofaciens subsp. kefiranofaciens strain LKK75 chromosome, complete genome	3 crisprs	cas14j,cas2,cas3,DEDDh,DinG,c2c9_V-U4,cas14k,csa3	0	8	8	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045033_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045033_1

1043056-1043328

TypeV-U4

I-B,III-A,III-B

Consensus_repeat	Method
AGGATCACCTCCACATACGTGGAGAACAC	CRISPRCasFinder
AGGATCACCTCCACATACGTGGAGAACAC	PILER-CR

4 spacers

c2c9_V-U4

The CRISPR arrays of NZ_CP045033_1

>merge|NZ_CP045033|1|1043056-1043328|CRISPRCasFinder,PILER-CR
ATAGAAACCTCCACATACGTGGAGAACACGAATAAAATCAGTATAGCGCGTAACTTCATTGAGGATCACCTCCACATACGTGGAGAACACCTAAATGACTGTACTGTGTCTGATCAACTTCAAGGATCACCTCCACATACGTGGAGAACACCTAACTAATGCTGTGCTTTTTCTAAGCTATTCAGGATCACCTCCACATACGTGGAGAACACTTTCAAGAACTGAGCCGTATTCCCATGAGGTCAGGATCACCTCCACCTACGTGGAGAATAC

>NZ_CP045033|1|1|1043056-1043328|CRISPRCasFinder
ATAGAAACCTCCACATACGTGGAGAACAC	GAATAAAATCAGTATAGCGCGTAACTTCATTG
AGGATCACCTCCACATACGTGGAGAACAC	CTAAATGACTGTACTGTGTCTGATCAACTTCA
AGGATCACCTCCACATACGTGGAGAACAC	CTAACTAATGCTGTGCTTTTTCTAAGCTATTC
AGGATCACCTCCACATACGTGGAGAACAC	TTTCAAGAACTGAGCCGTATTCCCATGAGGTC
AGGATCACCTCCACCTACGTGGAGAATAC

>NZ_CP045033|1|1|1043117-1043328|PILER-CR
AGGATCACCTCCACATACGTGGAGAACAC	CTAAATGACTGTACTGTGTCTGATCAACTTCA
AGGATCACCTCCACATACGTGGAGAACAC	CTAACTAATGCTGTGCTTTTTCTAAGCTATTC
AGGATCACCTCCACATACGTGGAGAACAC	TTTCAAGAACTGAGCCGTATTCCCATGAGGTC
AGGATCACCTCCACCTACGTGGAGAATAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045033.1\|WP_025084335.1\|1026532_1027465_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271189
NZ_CP045033.1\|WP_013854086.1\|1036919_1037750_+\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP045033.1\|WP_013854090.1\|1040314_1040929_-\|IS607-family-transposase	unknown	unknown	gnl\|CDD\|239738
NZ_CP045033.1\|WP_013854088.1\|1038478_1038847_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP045033.1\|WP_013854098.1\|1047320_1047758_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_143000323.1\|1052526_1052730_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854094.1\|1044797_1045397_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854095.1\|1045406_1045946_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|365934
NZ_CP045033.1\|WP_013854092.1\|1041554_1041923_-\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|119346
NZ_CP045033.1\|WP_143000321.1\|1046829_1047276_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374409
NZ_CP045033.1\|WP_081462946.1\|1050977_1051721_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP045033.1\|WP_013854096.1\|1045968_1046322_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854089.1\|1039034_1040318_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	c2c9_V-U4	-	gnl\|CDD\|223747
NZ_CP045033.1\|WP_013854082.1\|1032291_1033185_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|188121
NZ_CP045033.1\|WP_013854087.1\|1037797_1038043_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854093.1\|1044378_1044768_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_025084198.1\|1046252_1046690_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367400
NZ_CP045033.1\|WP_013854103.1\|1051829_1052513_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227872
NZ_CP045033.1\|WP_013854080.1\|1030411_1031197_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854083.1\|1033329_1034367_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP045033.1\|WP_025084335.1\|1026532_1027465_+\|site-specific-integrase	gnl\|CDD\|271189	cd01189, INT_ICEBs1_C_like, C-terminal catalytic domain of integrases from bacterial phages and conjugate transposons. This family of tyrosine based site-specific integrases is has origins in bacterial phages and conjugate transposons. One member is the integrase from Bacillus subtilis conjugative transposon ICEBs1. ICEBs1 can be excised and transfered to various recipients in response to DNA damage or high concentrations of potential mating partners. The family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.7873e-45
NZ_CP045033.1\|WP_013854086.1\|1036919_1037750_+\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	3.27081e-26
NZ_CP045033.1\|WP_025084198.1\|1046252_1046690_-\|hypothetical-protein	gnl\|CDD\|367400	pfam03217, SLAP, SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.	5.49332e-08
NZ_CP045033.1\|WP_013854088.1\|1038478_1038847_+\|hypothetical-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	4.92403e-25
NZ_CP045033.1\|WP_013854095.1\|1045406_1045946_-\|hypothetical-protein	gnl\|CDD\|365934	pfam00188, CAP, Cysteine-rich secretory protein family. This is a large family of cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) that are found in a wide range of organisms, including prokaryotes and non-vertebrate eukaryotes, The nine subfamilies of the mammalian CAP 'super'family include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins. Members are most often secreted and have an extracellular endocrine or paracrine function and are involved in processes including the regulation of extracellular matrix and branching morphogenesis, potentially as either proteases or protease inhibitors; in ion channel regulation in fertility; as tumor suppressor or pro-oncogenic genes in tissues including the prostate; and in cell-cell adhesion during fertilisation. The overall protein structural conservation within the CAP 'super'family results in fundamentally similar functions for the CAP domain in all members, yet the diversity outside of this core region dramatically alters the target specificity and, thus, the biological consequences. The Ca++-chelating function would fit with the various signalling processes (e.g. the CRISP proteins) that members of this family are involved in, and also the sequence and structural evidence of a conserved pocket containing two histidines and a glutamate. It also may explain how the cysteine-rich venom protein helothermine blocks the Ca++ transporting ryanodine receptors.	0.000339657
NZ_CP045033.1\|WP_013854092.1\|1041554_1041923_-\|ASCH-domain-containing-protein	gnl\|CDD\|119346	cd06554, ASCH_ASC-1_like, ASC-1 homology domain, ASC-1-like subfamily. The ASCH domain, a small beta-barrel domain found in all three kingdoms of life, resembles the RNA-binding PUA domain and may also interact with RNA. ASCH has been proposed to function as an RNA-binding domain during coactivation, RNA-processing and the regulation of prokaryotic translation. The domain has been named after the ASC-1 protein, the activating signal cointegrator 1 or thyroid hormone receptor interactor protein 4 (TRIP4). ASC-1 is conserved in many eukaryotes and has been suggested to participate in a protein complex that interacts with RNA. It has been shown that ASC-1 mediates the interaction between various transciption factors and the basal transcriptional machinery.	8.71199e-10
NZ_CP045033.1\|WP_143000321.1\|1046829_1047276_+\|hypothetical-protein	gnl\|CDD\|374409	pfam16172, DOCK_N, DOCK N-terminus. This family is found near to the N-terminus of dedicator of cytokinesis (DOCK) proteins, between the variant SH3 domain (pfam07653) and the C2 domain (pfam14429).	0.00829032
NZ_CP045033.1\|WP_013854089.1\|1039034_1040318_-\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.96967e-24
NZ_CP045033.1\|WP_013854082.1\|1032291_1033185_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|188121	TIGR01250, Proline_iminopeptidase, proline-specific peptidase, Bacillus coagulans-type subfamily. This model describes a subfamily of the alpha/beta fold family of hydrolases. Characterized members include prolinases (Pro-Xaa dipeptidase, EC 3.4.13.8), prolyl aminopeptidases (EC 3.4.11.5), and a leucyl aminopeptidase.	5.04697e-104
NZ_CP045033.1\|WP_081462946.1\|1050977_1051721_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	4.97102e-07
NZ_CP045033.1\|WP_013854090.1\|1040314_1040929_-\|IS607-family-transposase	gnl\|CDD\|239738	cd03769, SR_IS607_transposase_like, Serine Recombinase (SR) family, IS607-like transposase subfamily, catalytic domain; members contain a DNA binding domain with homology to MerR/SoxR located N-terminal to the catalytic domain. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. This subfamily is composed of proteins that catalyze the transposition of insertion sequence (IS) elements such as IS607 from Helicobacter and IS1535 from Mycobacterium, and similar proteins from other bacteria and several archaeal species. IS elements are DNA segments that move to new sites in prokaryotic and eukaryotic genomes causing insertion mutations and gene rearrangements.	1.04761e-49
NZ_CP045033.1\|WP_013854103.1\|1051829_1052513_+\|hypothetical-protein	gnl\|CDD\|227872	COG5585, COG5585, NAD+--asparagine ADP-ribosyltransferase [Signal transduction mechanisms].	0.000236183

>NZ_CP045033.1|WP_013854092.1|1041554_1041923_-|ASCH-domain-containing-protein
MKALSVRGDYVMSMISGRKKVEYRSWKTNYRGPILMCSTTKKVAGAAPGYALCVMNLDHIIWSDFDQCYYWYINLENVIEPIHVKGQLKLFNVDDKLIKPISHKEFDRKVKSLIYYPKKKKT
>NZ_CP045033.1|WP_013854090.1|1040314_1040929_-|IS607-family-transposase
MAMLKPREMADRLGITVRTLQEWDRKGIFPAHRTPTNKRYYTEQDYLRYVNGQSSSEEDKRKIVGYARVSTANQKGDLKDQEDFIRQYANAKGIILDEMITDIGSGLNYKRKKWNRLLDEVMQGKIKTIYITYQDRFIRFGYDWFEKLCNQNGTEIVVLNNQETSPNDELVQDVLSILHVFSCRLYGLRKYKHKISEDKELSQK
>NZ_CP045033.1|WP_013854089.1|1039034_1040318_-|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MIVKTRIYQLYPNQTMKQVLDDWCDYRRYCWNQALALWQDLYMAHTILDKVVATVFIPKQDKKTKKWKAIHRDQHLNPSPNWRLVRDRMIEQKNDWQYAYSARTLQLAVQDLGKAWESFFNQAQPDWGKPKFRSKRNPRQGFKTDRAKIKDGRLWLEMPRETPYKDDWTGIKLSEKPLPGKIGVVSIVRINDKYYACVPYKLETPVSKAKTGKEAGIDVNVGHFNYQDGQCLILPDSLKHLYLKIKFYQKRLAKKRTVNGRIKGTQSNKYLKTKAKLQACYQRATNIQRDLMHKFTTKMADEYDQIVIESLDVKAMLMSHVASKGMQRSMFGLFRQLLAYKCAWYGKELILADQHYPSTQRCAVCGTVKKGADKITLKGNQKHGTKHNEYICYNPACPNYGKTVDRDVNAMKNLTLLISHPELNKAL
>NZ_CP045033.1|WP_013854088.1|1038478_1038847_+|hypothetical-protein
MRKRRYKNTLILSLFAIFILIAGYFSFFYTPKSQGPRVIKVGIVGANKADIAIWKNVAKKVKQKYHVTVKTVSFDGYDQPDKALKSGDVDLNAFQHYAFLNAWNKSNHGGISPIGQTYIAAI
>NZ_CP045033.1|WP_013854087.1|1037797_1038043_-|hypothetical-protein
MKQYIKDTVISTVISMIITMIVSAIGKQIKNRKDKIVHPKRREVSSSVRIYEDEIPVKEQSSEISDLKADAINHGYWPVKY
>NZ_CP045033.1|WP_013854086.1|1036919_1037750_+|AraC-family-transcriptional-regulator
MKYYRWGFNNQDYNAQFYVSSGGFEKPHPCHSYGPMGRSGYMIHCVTGGHGIFKSNGKVYHLKKGDIFYIQPHKTTYMEADAVDPWTFYWVRFIGNLVPQYMKRINLSYQNPIIRQEDLPTVFQDVVDIVEYSQQTGPRDFYYQSKMFSILHALQLHFPKESTKNKVLQTTDIYDRALRYIANNYEEQISVHDLVGYLNIDRSYLFRIFKKHSQTNPQEFITNYRLAKASELLKSKNNTVEYVALSCGFLSYQSFFRFFKKKYGISPTQYKKKYLK
>NZ_CP045033.1|WP_013854083.1|1033329_1034367_-|hypothetical-protein
MNLKKGSKFALILLAGLALAGCSNNQNSKTVTHKASKISAGLVEHKNKPTKLGHLKANDLSPQKTVAVITAYAGKKYSDDWGTSLKKAQTNGLRVNLENQSDFSYMKNGSGVAYLVSDGNGYTLKQVNGENIYYLYDKEEELTSVTMGQMINYLNKSDSDELVNDLAKNAKIVNQRTESSDSTNDKTSHKTNIPADGGLFNIPAQYQGTWYTYPADDNKLDVTKITQHQIMYGNDVTELHKINDNTDDDYIEKYAKSKSYLKATKNWGRVSFWNRRGIKYMNVMGWMQGAGDGVFYGIHTENEQPVLVVAYGAGLWTNCVAWKTPQLAQQYKHKKFKDLVYQDDE
>NZ_CP045033.1|WP_013854082.1|1032291_1033185_-|alpha/beta-fold-hydrolase
MSGETKIVTLQDNYHVWTRREGEGPIKILLLHGGPGMTHEYLEPFSDYIKNHPEIEIIYYDQLGSYFSDQPNDPTLWNIPRFIDEIEEVRKAWHLEQFYLYGQSFGGLFALEYAASQYGKHAKAVIDSNMVDSYQDYAKYINKYRETMDSDDVAYMKKIEATGDYEDSHYNELLQKLYNRCICRIHPWPDAVQRTFDHLNEQVYVTLQGPTEFNITGLCRNWTIRDRLKKITVPTLVLGAKYDSMNPEEIKAVAKRLPNGESHICPNGSHFSIFDDQKDYFNAITKFIEKVEDRELD
>NZ_CP045033.1|WP_013854080.1|1030411_1031197_-|hypothetical-protein
MKLTTQISKFAQQAKFLPKVKIIGSKDFVVKSLSRDAFITKDEETISPSEVGTIVDYLTRYVVLADEHAFDVANIKAREDFQSHVASINQVKKLFAEENKLAKMVVNLSDIEDLPDDAIILATDICAWEVAYRSGKYIAPKEYPDKLTINHIRTMINRVEQFFEEYGWPTKDAFTAYTKNGCLVGDGDYLLSSTLVDLKVSTSQKMQMYWVRQLLLYYALGFYNHVNDEQIDRLMIFNARNNGVYYVDISSIDKSVIGFVY
>NZ_CP045033.1|WP_025084335.1|1026532_1027465_+|site-specific-integrase
MSQKYSKKLFYKYYLEWIHLYKDNAVRPVTLNKYYLVQRKLKELAPDLHMNELNRRNYQGILNKYAQDHEKTTTLDFHHHLKASLFDAVDDGLLKTDPTRRAIIKGCDPSDKKLKFLNLYELQTLLRSLNLGQDLNWDWFFLLIAKTGLRFAEALALTPEDFDFEKQSLNINKSWNYKEKIGNFQPTKNPSSNRLVMVDWQLMQQFQNLINQKKAKKPIFFEEDQRVYNSTLNQKLGKYCKELDIPQISIHGLRHTHASLLLYEGVSIASVAKRLGHSNTTTTQETYIHIIKELENKDNDKILHHLSQLR
>NZ_CP045033.1|WP_013854093.1|1044378_1044768_-|hypothetical-protein
MKKVVVFLLSLVMLTTGSIVFINDGSNEVQASSLKAYNVPKRYRGHWKNKNCWLTISKRHISGNYFTKHGTTYRWTAKAQRHVSNHIVLCSRYRKGITIGLAGGERSYLVRKGKNLKLYIDTWVETLHR
>NZ_CP045033.1|WP_013854094.1|1044797_1045397_-|hypothetical-protein
MKKKKIFSIIITLLLVVACGLGTRSRQVDAKTITLKAYTAKRYLNVTPKRAEGLGSGGSWIEKQVDKTIRVNHGKYFTYVPMVYTITKNMRAVYDTESLTSDQGEKMTFKRGYLYVARMPLHISHLKPNQKYRFRTDTLGDNTPYVQYHWITKRANRKGVISFGGPSVDIYLNCNVNKSFLKKALHDKRRILNRKIQIL
>NZ_CP045033.1|WP_013854095.1|1045406_1045946_-|hypothetical-protein
MGAKKDATSASNIKAALTNMEKANRARKQYDVPALKVSPVLVAISMIDADYQKSGLTHPQYYKQGLENLAAGAEPVNMWLGEKSNWKWNVKKNPSLAAYEFVPNWGGVYNDVAMGTNGYKTSGHYLNLLNRTHTVMGMAHMTGNSDYGSVDAFNASSDDPNGALSLSQYKNLVNEWLSK
>NZ_CP045033.1|WP_013854096.1|1045968_1046322_-|hypothetical-protein
MDWWYIYVYQKKTDKHGTGWYKVSKKSWIKASDTNRPYGKAGNDSNNAASSSAKKVANNKATQPKKAVKHASTNNATKNAASLMDFLANNQTLTAAQRAEAQKAMTLNRTIGLSICT
>NZ_CP045033.1|WP_025084198.1|1046252_1046690_-|hypothetical-protein
MKKSLLISLTASSLFALGLTASGVNSESVQAATKTAYLKNKAYIYTYRGHRTRKSIAKSKHVKITSTKRIKGHKYYRLSKNRYIRAANATTPYLFKVTIREDYDDDNVGEVHVSPSQQSKVTGWIGGTYMFIKRRLINMELVGIR
>NZ_CP045033.1|WP_143000321.1|1046829_1047276_+|hypothetical-protein
MKKKQQRHQKHRKYLAMKVELVNGQPKWFRISPKFFQIIITEQRLRKIHPRKMLTNCLINIPLTTYSRHNQAVIGVGRVIKMEYRAHTDTRLCVRGQFTPPEKLKKEFFLTYHYLRHDYGKLSKINIMFDLYFWRRKVKQNHLTNSFF
>NZ_CP045033.1|WP_013854098.1|1047320_1047758_-|hypothetical-protein
MLKDQQKFDQLGEKLFMDGVLQDFEKKHGPIKGRMMVTEGKIPPEMLMKLQPELMKNPKWIVVDGSFDFSNYTIGMVVGLNPVRPISNGWLTPQLNHPGVAPTKNWQEFFMEKVMQNIDENGKIDLPLYSLISDKSDLTLNGKEK
>NZ_CP045033.1|WP_081462946.1|1050977_1051721_-|CPBP-family-intramembrane-metalloprotease
MVYLIFAVLSIGLLILAEVLVKTGILSKNYGWTLILIRYIIAIVALILYSQKVVHNKFNFEFDLKWPSIIGWVVTLIFIVFNFWYIGDNDFTLSNNGLSSLLYCLGPAIFEELWLRGLIFNRLRIVNKLDHPLFKATFISAALFAVLHLILPDYSNWLDLLTQIITAFGLGVLFAGIYCITNNLALTMLIHFSENFNSYFITYLPWFDDFDLNDFIVNLIQTFIYLIIGIFLLWLFWRKKNSVKRND
>NZ_CP045033.1|WP_013854103.1|1051829_1052513_+|hypothetical-protein
MDYLSKKKEYIFLNNRQALVRVHVKQVSKQPYSIWVEGKSKNYRDCVALLNRTLVKFDPQLVPPIVVVSNKKLGNGAISSYAFEDNVIFFNNFYHSTEQIDEITHQNLFIATDLKEIIRHELGHKLHWDAIKRFYRSHKKQYNNLQEAKNDFDSNLESYITHQLNNNYSYLIENVSTYANLAFEYAKANYKNNSVNEVIAEVYAIHGSKDPILNDLIMEELNYGRKH
>NZ_CP045033.1|WP_143000323.1|1052526_1052730_+|hypothetical-protein
MDILRMPSPEEEIIGKIGKWIASAKPDKDKIATIIFKKNTPTEILKLYEKNYDLIPFPAHKEYKIEK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045033_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045033_2

1715166-1715391

TypeV

Consensus_repeat	Method
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	CRISPRCasFinder

2 spacers

cas14j

The CRISPR arrays of NZ_CP045033_2

>merge|NZ_CP045033|2|1715166-1715391|CRISPRCasFinder
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGGCAGCTCTACACAAAATTTAGGGTAGCTCTCCCATGAAACTCGATTTGCTCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGGGTTTTAACGAGTGAATTCAAGCGTTTTCACCAGAGTTATCCACAGGCTAGTGGGAGCTTTTTTTGTTTTTCATTTTACCTCAAACTACACAAAATTTAGG

>NZ_CP045033|2|2|1715166-1715391|CRISPRCasFinder
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	CAGCTCTACACAAAATTTAGGGTAGCTCTCCCATGAAACTCGATTTGC
TCTACACAGAATTTAGGGTCAAACTACACAAAATTTAGG	GTTTTAACGAGTGAATTCAAGCGTTTTCACCAGAGTTATCCACAGGCTAGTGGGAGCTTTT
TTTGTTTTTCATTTTACCTCAAACTACACAAAATTTAGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045033.1\|WP_013851207.1\|1713536_1714814_-\|ISL3-family-transposase	unknown	unknown	gnl\|CDD\|225995
NZ_CP045033.1\|WP_013851174.1\|1720410_1721058_+\|GntR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224715
NZ_CP045033.1\|WP_013851173.1\|1718585_1720367_+\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|180854
NZ_CP045033.1\|WP_013851364.1\|1710970_1712308_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	cas14j	-	gnl\|CDD\|223747
NZ_CP045033.1\|WP_013851171.1\|1715705_1717106_+\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP045033.1\|WP_013851361.1\|1709375_1709591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013851175.1\|1721059_1721698_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187577
NZ_CP045033.1\|WP_013851177.1\|1722095_1722716_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_056956909.1\|1725071_1726694_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP045033.1\|WP_013851179.1\|1723766_1725053_-\|peptidase-T	unknown	unknown	gnl\|CDD\|237371
NZ_CP045033.1\|WP_013851367.1\|1713309_1713495_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013851360.1\|1707423_1709202_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013851365.1\|1712436_1712676_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_025084163.1\|1706872_1707289_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_025084258.1\|1717380_1718223_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|367711
NZ_CP045033.1\|WP_013851176.1\|1721894_1722095_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013851366.1\|1712856_1713135_+\|HU-family-DNA-binding-protein	unknown	unknown	gnl\|CDD\|259853
NZ_CP045033.1\|WP_013851363.1\|1710406_1710871_-\|IS200/IS605-family-transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP045033.1\|WP_056956907.1\|1727021_1730486_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274377
NZ_CP045033.1\|WP_013851362.1\|1709920_1710334_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP045033.1\|WP_013851207.1\|1713536_1714814_-\|ISL3-family-transposase	gnl\|CDD\|225995	COG3464, COG3464, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.88253e-48
NZ_CP045033.1\|WP_013851363.1\|1710406_1710871_-\|IS200/IS605-family-transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	7.79135e-49
NZ_CP045033.1\|WP_013851171.1\|1715705_1717106_+\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	1.31144e-16
NZ_CP045033.1\|WP_013851173.1\|1718585_1720367_+\|FAD-dependent-oxidoreductase	gnl\|CDD\|180854	PRK07121, PRK07121, FAD-binding protein.	2.08966e-66
NZ_CP045033.1\|WP_013851364.1\|1710970_1712308_+\|IS200/IS605-family-element-transposase-accessory-protein-TnpB	gnl\|CDD\|223747	COG0675, COG0675, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	6.92861e-26
NZ_CP045033.1\|WP_013851175.1\|1721059_1721698_+\|SDR-family-oxidoreductase	gnl\|CDD\|187577	cd05267, SDR_a6, atypical (a) SDRs, subgroup 6. These atypical SDR family members of unknown function have only a partial match to a prototypical glycine-rich NAD(P)-binding motif consensus, GXXG, which conserves part of the motif of extended SDR. Furthermore, they lack the characteristic active site residues of the SDRs. This subgroup is related to phenylcoumaran benzylic ether reductase, an NADPH-dependent aromatic alcohol reductase. One member is identified as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	8.17133e-84
NZ_CP045033.1\|WP_056956909.1\|1725071_1726694_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP045033.1\|WP_013851179.1\|1723766_1725053_-\|peptidase-T	gnl\|CDD\|237371	PRK13381, PRK13381, peptidase T; Provisional.	0
NZ_CP045033.1\|WP_013851366.1\|1712856_1713135_+\|HU-family-DNA-binding-protein	gnl\|CDD\|259853	cd13831, HU, histone-like DNA-binding protein HU. This subfamily includes HU and HU-like domains. HU is a conserved nucleoid-associated protein (NAP) which binds non-specifically to duplex DNA with a particular preference for targeting nicked and bent DNA. It is highly basic and contributes to chromosomal compaction and maintenance of negative supercoiling, thus often referred to as histone-like protein. HU can induce DNA bends, condense DNA in a fiber and also interact with single stranded DNA. It contains two homologous subunits, alpha and beta, typically forming homodimers (alpha-alpha and beta-beta), except in E. coli and other enterobacteria, which form heterodimers (alpha-beta). In E. coli, HU binds uniformly to the chromosome, with a preference for damaged or distorted DNA structures and can introduce negative supercoils into closed circular DNA in the presence of topoisomerase I. Anabaena HU (AHU) shows preference for A/T-rich region in the center of its DNA binding site.	1.71182e-42
NZ_CP045033.1\|WP_025084258.1\|1717380_1718223_-\|phosphotransferase	gnl\|CDD\|367711	pfam03881, Fructosamin_kin, Fructosamine kinase. This family includes eukaryotic fructosamine-3-kinase enzymes. The family also includes bacterial members that have not been characterized but probably have a similar or identical function.	6.00992e-76
NZ_CP045033.1\|WP_056956907.1\|1727021_1730486_+\|hypothetical-protein	gnl\|CDD\|274377	TIGR02987, m6_adenine_and_m5_cytosine_DNA_methyltransferase, type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family. Members of this family are the m6-adenine DNA methyltransferase protein, or domain of a fusion protein that also carries m5 cytosine methyltransferase activity, of type II restriction systems of the Alw26I/Eco31I/Esp3I family. A methyltransferase of this family is alway accompanied by a type II restriction endonuclease from the Alw26I/Eco31I/Esp3I family (TIGR02986) and by an adenine-specific modification methyltransferase. Members of this family are unusual in that regions of similarity to homologs outside this family are circularly permuted. [DNA metabolism, Restriction/modification].	0.000146007
NZ_CP045033.1\|WP_013851174.1\|1720410_1721058_+\|GntR-family-transcriptional-regulator	gnl\|CDD\|224715	COG1802, GntR, Transcriptional regulators [Transcription].	7.21478e-34

>NZ_CP045033.1|WP_013851207.1|1713536_1714814_-|ISL3-family-transposase
MSSFNNCIKFDLDIKEKNIVFKDYFYKMVQMKKHKIYEAELIQPACPYCGSLALLHNGHLITNIRYLTANASHPVTIRLAKQRVRCRDCSRWSIAPSELASKYCSISNASKLKILSALTEDRSMTSIARENNVSVNTVQRVLGSCSHRFLDSYEYLPAHLAFDEFKGVDRQLHFICLDGDSHQIVQILRTRYKKNLLKYFGRFSPQARANVRTVTMDLNFYYQDIVRACFPNAQIVIDRFHMIQMLTRSFNSLRVKVMKTFDKRSRQYQLLQSPWKLYLKKYDELEKIHPRYNWHYKACLTQAQVVMEGISANTALENSYNLMQSFIQAIETNNTQELKSLITSKDSIGTLMHKTLLTFKYNLKAVLNGAALPYSNGCLEGFNRKIKQIERTAFGYSNFINLLTRIRLEENQYTEKEPNSLLMTA
>NZ_CP045033.1|WP_013851367.1|1713309_1713495_+|hypothetical-protein
MNNNQRKIKSRKLNKWEAFKTRLAALFGSKPKLTFKYTKKGKLKIIWFNAHCWLMSLLVLL
>NZ_CP045033.1|WP_013851366.1|1712856_1713135_+|HU-family-DNA-binding-protein
MASKSDLIKAVAKKADLTHKDAGLAIDAVLDTIRETLADDKKVQLIGFGTFEVRQRAARKGRNPQTGKTIKIPATKVPAFKPGKVLKDAVKK
>NZ_CP045033.1|WP_013851365.1|1712436_1712676_-|hypothetical-protein
MVDQRLTRTQYQSEVIKKKAKEVVIPEIKPISQQELTHEVKEYEKNMKDIALWPFIGLINWTVNYPRINSEAWWLVSLR
>NZ_CP045033.1|WP_013851364.1|1710970_1712308_+|IS200/IS605-family-element-transposase-accessory-protein-TnpB
MKRMSSLAYHFGIRLRFYPSSKQKKLIKLNYDAQRFVYNSYVGRNRSSYHAKCYFLVKQSKAMPFAFSILNRYETKLAETVVANNELLAKPKNIRDAYSFLRIKEIDSLALANAIQNYHKAWNNYRKIGYGIPTFHKKRSDWAYQTNCQYIKQDEAYLNNGTAKFIDAKHVKLPKLGVVRIAGLRKLIKERLLKHIPTRIGTVTLKKTADDQFYLSMQLGSDLAFVKELAKTQNQIGIDLNLDNFLTDSNGAMVANPCFYRKAKKKLAHTQRILSRRQRRAKKDGRKLRTAKNYQEQRLAVAKLHDKIRRQREDFLQVLSTALIKSHDLVVAEELRSKNLLKNHALSQAISDAGWRKFLNMLAYKAKLYGKDFQTIDPKYTTQRCHQCGTIMGHNGYQKLKLADREWTCPMCHAYHIRDWNAAVNILEKGLGHWQNPVIKKKKNA
>NZ_CP045033.1|WP_013851363.1|1710406_1710871_-|IS200/IS605-family-transposase
MNKKRDKIKDAGYEKHYVYNAHYHLIWCTKYRNQIFTNPDLAQEMRELLKQTAKDNQIKIEKMEVMPEHIHLLISFRPSKSGSSVVKALKGRSGFLFFKNHPEIKQNKMWGGHLWSPSYYFGSVGNMSKEVVEKYINDQIYNAVKDGEPYPSPH
>NZ_CP045033.1|WP_013851362.1|1709920_1710334_-|hypothetical-protein
MSNIIELGNTRLNLDGEPVESNTLHTVQSEIINNYAKKYAIYLAQKDLPNRPVKVLERMLWELTHNKLSYETQAKDCCIKEWQNAMFEIQLDAQPLVIVHNQITKKYSKICKINEIFYNTQLHMHDIKLVFDFGNIQ
>NZ_CP045033.1|WP_013851361.1|1709375_1709591_+|hypothetical-protein
MNQREEYRKYKKRIANAKYYQKTVGTNQGLKNERNKRKSKAKNFILKEANYDELKMLERAIKMRLSTMHSN
>NZ_CP045033.1|WP_013851360.1|1707423_1709202_+|hypothetical-protein
MIKNKKLKSMIHRFRSKSNESKTKTIFYNHDADTSQMSATYEDLKKYGVNHELNRIRRISIQQKLNKYQHPSSNHRLLKGYRDTGEWLNWIGIVADISMPTTSSLDGKILIDKFCYENSLHQVKLLDYHVWLKTNEIRYLLNADKQTIGVGDTIRGISKVTKYSSKGLSNKYGLGATLLKGAGIYVSIPTKRTLAQSTANQLVTDYDRQDDWVVKLSNAGVPKQTLRDYHREKDINVFIAKNRGHVSARFQPSRYSHYFERLEAVPPKILQHEKEQHSLPKQYYGIVDNFKVYQKKDSCHSVIHFSYIVDDIKRIITGSKWFEYDGEILKLGSLRPKDVIGFKDNRDLIKSSGTLEPLTNVELLTQHQNDPMPDNQSLVAGWVIKNFGKQKNVLNQNDLVNKYERWLKTETGEDIRTPFNIGFSIDEIAEKTTVTAHQIQKFLDQHSVQPIFSEGNKDYYAKQDMDLTVKHFKQVHNKAKAVLQVVRKTKANYLVDKNKKQEEVKKMTNKDNSVINTDTSKAKTTKASNNDHVIRIITSRGRFTTLQFKTLQEAYIVLQQALQSGYLNYFIKAKDEAGSDCLISVKNIISMS
>NZ_CP045033.1|WP_025084163.1|1706872_1707289_+|hypothetical-protein
MITGRKGSHSNTATNDIIFDKDKRAMITSLDKRHEALMRDNSILKSVTNLVQGQINQDSVTTVNKHSSNVTSTATKNYTYTQVKPKVEEQDNTSSLNLKHKIKDNPSMSLDKKDAAVPQLPNIGQGQRTISYHSFHFS
>NZ_CP045033.1|WP_013851171.1|1715705_1717106_+|replication-initiation-protein
MDEKKKEQEKIRELLNFPDRKKNLVKYNNDLNDSKQYYGVSSLTKYELDIFFFLVAQLQGQDGAVVDIKIKDLKRYLHMPRTMSYRTFQKVVVQTFAHLENIKTGFLKNDEDNREYLQLRPIFDYTNIYTDSLDVEVKVNKEYRYLFNGLIRSADPSMQIRYTRFDLQQMIKIKRQNSKNMYRLLMQNMYRGEREFTEEEIYEQLGLFTVRKGKRVKKYENGKLYNRVLKPALIDLSPFFRNLRLKKQYGPNHTVEKYHFFWAKESARNSRLIYNPEDADIRAVVNIKTNVHLTLKEKNEAIDRYFGQKIGTSHLEKQSGNKEYLKSFFEDTPFNQSGLDIETKKLTDLELKNMISTYGYLESLDLLKDHDKTFLKLLKTEKLKREGKLEEEKPVKGTFLQSFLNVPKPLESMTDTELNHYQDLLLAKIADPDHDISASERLDLSNIRKMLLGLNDLKNNMPKSDK
>NZ_CP045033.1|WP_025084258.1|1717380_1718223_-|phosphotransferase
MRLNQKWLSQLPVDKIISCRTVHGGDMNEAYQIQTDKQIYFMKVQPNKPASFFDHEKRGLREIAKANVNTLSVIASGQIAGDAYLLLNRLLPSSGSQADLGKLVAKLHQHHSEQFGFGDTYETRILKKDNHWNKSWTDFYINQRLLPEVEYAKKVGRWNDYREQHFPKMVAAFEKYYQRHPVVPSLCHGDLWFGNVMFSNNMPYLIDPDAVYADREFDLAMTTVFGGFTDEFYAAYNSVYPLKPGLNQRLNWHRFYYLCMHLDLFGETYGTAVDDILSNF
>NZ_CP045033.1|WP_013851173.1|1718585_1720367_+|FAD-dependent-oxidoreductase
MKDGKYIAKAKGFHGPITVEALIENNQIQKIVAKDIAHNTVGELAVKRTLDKMNSAKSVDVDAVTGATFSSSAALKAAKKAVAVAEDELTETEALDAEIEPKSQVKVSVYAKPLSRRIYQDDVDFEDEYDVIIAGSGISGLSAAVEAARNGAKTVVFEKAGMIGGTSNYSQGIIQAAGTKWQKKYTTYQNDSPAKHLAEYLQTGEGHVNRNLLADFIQDAANSIDWLSELGLKWKNVYGHKVIPYEDKQNFAPRIHVYENGGVNGAGVIMMTKIWKAAKEAGVKIIYDTPVVGLITENKTNNHVVGVAVDHLGKKMNFRAKKGVVLATASIDHNEELAKQIDPWQYRDIQKHTLLNSKYDTGDGIVLGMIQGAGLAGVSGAMDADFKFAAGFADIIKTFPMFYVNGLGNRYVNEDTTYGYLTRANYQQETNLDKPTWMIFGKNSIGQGAMPYHSEEDMKKDMAGGYLHKADTIEELAKKMDVSSENLANTLASWNRYAAKGVDPTFGRKEGVAVLQGPFYAYQNRDMNIGSIAGLKVNVDLQVLDNLDNPIQGLYAIGQNAGGWIGGYYPGSGTALGGSLNQGRKVGKELAEK
>NZ_CP045033.1|WP_013851174.1|1720410_1721058_+|GntR-family-transcriptional-regulator
MTNEDRAYQFIKNQITSGMYRPGHVLSENQMCIKLDMSRTPVREAFKKLENDGLIERDGQETRVTQIKKEELRENYDLRSMLEGYALEKSFSNLDKSKSEKFRMGFTNALDSKNWEDYLKLDEQFHHFLTKNNDQSTLQKSLDLLQSQTNQMRYAIRDDQRCMISSVDEILQIIDAIAENDRYEAVCRLNKHVKSVYDWEVEYLTIQQEEKTEAN
>NZ_CP045033.1|WP_013851175.1|1721059_1721698_+|SDR-family-oxidoreductase
MVKVIVLGAHGQVAQLAEQMLFTDGDVQTTLFLRNAKRLAKDKDKATIIEGDTTNEAELEKAIAGQDIVYANLGGTSTIVKQAEAVIEAMKKTGVKRLIWISTLGIYDEVAGKFGEWNKSVLGNYITEYAKAAKKVEESGLDYTIIRPSWMTNKDKVDYQKTKKGQPITNTEVSRKSVASYIYKLIKKPDEDVQESIGLEKPGTQGNKPSWY
>NZ_CP045033.1|WP_013851176.1|1721894_1722095_+|hypothetical-protein
MKKRKYLSVIAAALLTISPVVATTLASNTTVVKAASTEEGKTITFTKVPTLRFKVGTEEGLQTIAD
>NZ_CP045033.1|WP_013851177.1|1722095_1722716_+|hypothetical-protein
MKGVKVSDGYIDATGNVLDFSDQGFYKNDANGNPIMDWPLDWNDFRRGDEGTALIYVPIKGLKPLTHYRVLCQKPWHGKKGNGNFQNGALYWRTMKTDLDGELNSEFGSPTSDESSIPVIKAHFVVGSKKVAKKSSTVKVSKKGYVDVRKNKKVRTYTSTGKFSKHYVYGHHTYKLNRKKHIKGHGTCYKIYGKNQWIPAKYLDLR
>NZ_CP045033.1|WP_013851179.1|1723766_1725053_-|peptidase-T
MTFYDLNFIQKTFIHYAKENTRSDPNNSDQIPSSPNQIKMAKELTKQLKEIGLDAYFNDKSCFAIGHLTSNVSDKVTPIGFFSHMDTADFNAVNIQPHVHKNYDGGRVALDKEAGIFLDPKEFPALKSCQGETLITSDGHTLLGVDDKAGIVGILGMLKYLVAHPKVEHGDIYVGFGPDEEIGYGGKRFDPKDFPNVELAYTLENGRPGDFEYETFNATLAKIHIHGTVVHPGEAYGLMVNATTLMNKFLDQMPADEVPEKSKGHDGYYMVVNSSSCVDHADIDIIIRDFDWDKYLAKEQFIKDLVAKLNKKYGADRFKLTLRREYENIYNVIKDHPYVVNLALDAYKKAGIKPNVKTFRGGTDGNFITQKGIPTPNLFNGGGNYHGRYEYVTVEQIDKLSKVLTTICKEHLYQTRHGRDNTPLKKYW
>NZ_CP045033.1|WP_056956909.1|1725071_1726694_-|peptide-ABC-transporter-substrate-binding-protein
MRKRNLAIVAIVGTCAMMMTACANRSISSTKQVLNWSENAELSTQDPSLTTDSTSFQAEVNTQEGLYRLDKKQKPKLALAKSEKTTNGGKTYTFDLRKNAKWSNGEPITADDFVYSLRRTLTPSTKSSMAFYLYQIKNAQEINSGKRKPITLGVKALGKHRLQIQLIRPVSYFKRLLAFPLFFPQNQRYEEKVGKKYGTAAKYNVFSGPFKMVGWTGNNRKFSLVKNKNYWDAKNVKLNRVNETISESATTSYNLYQSGQLDETYLSGQEVAANKNSKQFYQRPVSALQRLDFNMKKLRVFNNIHMRKAISLAINRQDLASVLKDGSKPAQGFVPSGMGKNPKTGEQFYREAYVKSGVESNLAQAKKELQTAYQQTGTKSLNVTLSTSDTDSGKQIGEFLQSNLERLPGVKISISTLPYTTLIKRQQSGNFDITVQTWKAILSDPINFLDVFESTSSYDNSGWKNTQYNKLLTQSEDKYGNQPVKRWANLVAAEKILMKQQATVPLVQLANPQLLKSKVKDVTFNPVGIPYDFKNVYLAN
>NZ_CP045033.1|WP_056956907.1|1727021_1730486_+|hypothetical-protein
MSNIKDMIESLQGDPTSIDILAGFLGYRVGENPINPDSDWKMYFTDKADTNDHAVMAVFPEPELDNETKTPQIRKLYQKVIELKDTFGASFAAEVAAFIGENRVVFFPVNNGNRDTRLDLNPETIKKDLYLRDLSYLKNDNIKVTTDDFGFGTNIDVSQDKAFRQELTEQFLYVVEFYRKKLSELITGSKLKNQLLDLLSDKAKFYAENNDLNNLVQSDSYLSVLSTVVDTIILRQLMRRFLEGYYGPNSFEVDGIALGVGSGTLDEAIKETVNVAVNLGEEKDFKKMNRQENTIQQLDLFSDAFSQDELDHTSQVEPVTKSKKEQLEEITKKATKQFELAYDGDLFAGSIAQATNNVENQLTKQFPEFMAKLWVDTASGNFSFRYQDMPPESLEKQYEDSMSKNVQIKIDSKTKKPVVFYGDDKSEQKSKGAYYTDQRFVDYMINKTVEVEFDKRYKAIQEAIKTKDNQKIKAALEHLLDLKIADFTCGGGSFLRGAFLKLADQYKMLQSLCIPDELKADYPMITAEDDGYLWEKYILENMIYGVDIDYKAIMITSLTLTLSSLQHRPKDTKLSQLIGRTLIHQNALINAVPYYSRKEVFASYQQDIAKLRKLKKTNFTQFNKLRVKLQNKVIPDSGDVAEDASFLHVESIELNLPEVYFNEDGSLKEHGGMDIVVGNPPWDIWKANSDDFFSEYDNGFRGLPNKRVKTSKMKELFASLPGLKDKWDTEQQRFKDGSKYFRSDDTYKYQRWTVNGRKTSSDLNLYKISVERFAQLASTYARFSILVPDNFATDNGPTGIRHLVLDHYHLEEFLSFENRRGIFPAIDSRYKFAVLTFDYDQTRSNSFKAFFYRHSLDDLSNAEIKLNYPVEFIKQTEPERYAFVEARTPKLFDLFKKIRTKFPDLNHTKLLKFSRDFDANKESGKFTTKDSNENLISVYEGKTFKQFTIEPQKIVHYVTPEKLEDKDNEDYKFLRLAFRGIANSTNKRSLIATLLPRNSSGTYSVWIQRNFTKTDITHQLFYLSFYNSYTLDFIIRQIVTININLPFSMQLPIPKYEDIADADKLVQISKALLQENKGYYTDLDELVPGNDYAGKSHEELIAELNARVMLDFDLTRDEVITLMHTFESAKWKSFVEEETQRIVDVYDKLSAARK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045033_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045033_3

2259278-2259489

Orphan

I-B,III-A,III-B

Consensus_repeat	Method
AGGATCACCTCCACATACGTGGAGAACAC	PILER-CR
AGGATCACCTCCACATACGTGGAGAACAC	CRISPRCasFinder
AGGATCACCTCCACATACGTGGAGAACAC	CRT

3 spacers

The CRISPR arrays of NZ_CP045033_3

>merge|NZ_CP045033|3|2259278-2259489|PILER-CR,CRISPRCasFinder,CRT
AGGATCACCTCCACATACGTGGAGAACACGGGTGGGCAGTGGTAGGAAAAATTAAATAGCTAGGATCACCTCCACATACGTGGAGAACACCGAATGGGATCTAAAAGGCCCAAGCCTTGAAGAGGATCACCTCCACATACGTGGAGAACACTGATATTGACACTACCAATTACAAGTATGTCGGGGATCACCTCCACATACGTGGAGAACAC

>NZ_CP045033|3|2|2259278-2259489|PILER-CR
AGGATCACCTCCACATACGTGGAGAACAC	GGGTGGGCAGTGGTAGGAAAAATTAAATAGCT
AGGATCACCTCCACATACGTGGAGAACAC	CGAATGGGATCTAAAAGGCCCAAGCCTTGAAG
AGGATCACCTCCACATACGTGGAGAACAC	TGATATTGACACTACCAATTACAAGTATGTCG
GGGATCACCTCCACATACGTGGAGAACAC

>NZ_CP045033|3|3|2259278-2259489|CRISPRCasFinder
AGGATCACCTCCACATACGTGGAGAACAC	GGGTGGGCAGTGGTAGGAAAAATTAAATAGCT
AGGATCACCTCCACATACGTGGAGAACAC	CGAATGGGATCTAAAAGGCCCAAGCCTTGAAG
AGGATCACCTCCACATACGTGGAGAACAC	TGATATTGACACTACCAATTACAAGTATGTCG
GGGATCACCTCCACATACGTGGAGAACAC

>NZ_CP045033|3|1|2259278-2259489|CRT
AGGATCACCTCCACATACGTGGAGAACAC	GGGTGGGCAGTGGTAGGAAAAATTAAATAGCT
AGGATCACCTCCACATACGTGGAGAACAC	CGAATGGGATCTAAAAGGCCCAAGCCTTGAAG
AGGATCACCTCCACATACGTGGAGAACAC	TGATATTGACACTACCAATTACAAGTATGTCG
GGGATCACCTCCACATACGTGGAGAACAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045033.1\|WP_013854980.1\|2257435_2258353_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP045033.1\|WP_013854966.1\|2274482_2275526_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854988.1\|2248248_2249025_-\|Fic-family-protein	unknown	unknown	gnl\|CDD\|376885
NZ_CP045033.1\|WP_013854991.1\|2243604_2244321_-\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	unknown	unknown	gnl\|CDD\|181800
NZ_CP045033.1\|WP_013854977.1\|2260145_2260421_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854964.1\|2276051_2276591_-\|NAD(P)H-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223508
NZ_CP045033.1\|WP_095342310.1\|2244517_2245636_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	unknown	unknown	gnl\|CDD\|235674
NZ_CP045033.1\|WP_003627031.1\|2245646_2246135_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	unknown	unknown	gnl\|CDD\|376377
NZ_CP045033.1\|WP_013854967.1\|2272080_2273745_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|213192
NZ_CP045033.1\|WP_013854986.1\|2250577_2251783_-\|amidohydrolase-family-protein	unknown	unknown	gnl\|CDD\|238624
NZ_CP045033.1\|WP_013854965.1\|2275563_2275992_+\|EutP/PduV-family-microcompartment-system-protein	unknown	unknown	gnl\|CDD\|371185
NZ_CP045033.1\|WP_049776011.1\|2266948_2267653_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367400
NZ_CP045033.1\|WP_013854983.1\|2255632_2255866_-\|prevent-host-death-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854987.1\|2249078_2250344_-\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|224292
NZ_CP045033.1\|WP_013854972.1\|2264419_2265106_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854982.1\|2256129_2256675_+\|cysteine-hydrolase	unknown	unknown	gnl\|CDD\|238245
NZ_CP045033.1\|WP_143000353.1\|2263213_2263438_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045033.1\|WP_013854968.1\|2271196_2272093_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	unknown	unknown	gnl\|CDD\|223692
NZ_CP045033.1\|WP_003636323.1\|2273752_2274463_+\|ECF-transporter-S-component	unknown	unknown	gnl\|CDD\|227064
NZ_CP045033.1\|WP_013854989.1\|2246145_2247807_-\|formate--tetrahydrofolate-ligase	unknown	unknown	gnl\|CDD\|237403

Protein	Function_ID	Function_description	E-value
NZ_CP045033.1\|WP_013854980.1\|2257435_2258353_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	6.88963e-24
NZ_CP045033.1\|WP_013854988.1\|2248248_2249025_-\|Fic-family-protein	gnl\|CDD\|376885	pfam02661, Fic, Fic/DOC family. This family consists of the Fic (filamentation induced by cAMP) protein and doc (death on curing). The Fic protein is involved in cell division and is suggested to be involved in the synthesis of PAB or folate, indicating that the Fic protein and cAMP are involved in a regulatory mechanism of cell division via folate metabolism. This family contains a central conserved motif HPFXXGNG in most members. The exact molecular function of these proteins is uncertain. P1 lysogens of Escherichia coli carry the prophage as a stable low copy number plasmid. The frequency with which viable cells cured of prophage are produced is about 10(-5) per cell per generation. A significant part of this remarkable stability can be attributed to a plasmid-encoded mechanism that causes death of cells that have lost P1. In other words, the lysogenic cells appear to be addicted to the presence of the prophage. The plasmid withdrawal response depends on a gene named doc (death on curing) that is represented by this family. Doc induces a reversible growth arrest of E. coli cells by targetting the protein synthesis machinery. Doc hosts the C-terminal domain of its antitoxin partner Phd (prevents host death) through fold complementation, a domain that is intrinsically disordered in solution but that folds into an alpha-helix on binding to Doc.This domain forms complexes with Phd antitoxins containing pfam02604.	2.78627e-07
NZ_CP045033.1\|WP_013854991.1\|2243604_2244321_-\|phosphoribosylaminoimidazolesuccinocarboxamide-synthase	gnl\|CDD\|181800	PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed.	1.00951e-133
NZ_CP045033.1\|WP_013854964.1\|2276051_2276591_-\|NAD(P)H-dependent-oxidoreductase	gnl\|CDD\|223508	COG0431, COG0431, Predicted flavoprotein [General function prediction only].	1.92689e-31
NZ_CP045033.1\|WP_095342310.1\|2244517_2245636_-\|5-(carboxyamino)imidazole-ribonucleotide-synthase	gnl\|CDD\|235674	PRK06019, PRK06019, phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed.	0
NZ_CP045033.1\|WP_013854968.1\|2271196_2272093_+\|energy-coupling-factor-transporter-transmembrane-protein-EcfT	gnl\|CDD\|223692	COG0619, CbiQ, ABC-type cobalt transport system, permease component CbiQ and related transporters [Inorganic ion transport and metabolism].	4.94671e-09
NZ_CP045033.1\|WP_013854967.1\|2272080_2273745_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|213192	cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system. Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota. The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed. This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways. Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO. Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.	8.72088e-72
NZ_CP045033.1\|WP_013854986.1\|2250577_2251783_-\|amidohydrolase-family-protein	gnl\|CDD\|238624	cd01299, Met_dep_hydrolase_A, Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a conserved metal binding site, involving four histidines and one aspartic acid residue. In the common reaction mechanism, the metal ion (or ions) deprotonate a water molecule for a nucleophilic attack on the substrate. The function of this subgroup is unknown.	1.79351e-97
NZ_CP045033.1\|WP_013854965.1\|2275563_2275992_+\|EutP/PduV-family-microcompartment-system-protein	gnl\|CDD\|371185	pfam10662, PduV-EutP, Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways. PduV may be involved in the association of the bacterial microcompartments (BMCs) to filaments.	5.94302e-62
NZ_CP045033.1\|WP_049776011.1\|2266948_2267653_-\|hypothetical-protein	gnl\|CDD\|367400	pfam03217, SLAP, SLAP domain. This short domain is found in a variety of bacterial cell surface proteins. The domain is about 60 residues in length (although previously defined as 2 copies of this domain). It usually occurs in tandem pairs. It may be distantly related to the SH3 domain.	9.72061e-09
NZ_CP045033.1\|WP_003627031.1\|2245646_2246135_-\|5-(carboxyamino)imidazole-ribonucleotide-mutase	gnl\|CDD\|376377	pfam00731, AIRC, AIR carboxylase. Members of this family catalyze the decarboxylation of 1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR). This family catalyze the sixth step of de novo purine biosynthesis. Some members of this family contain two copies of this domain.	2.94575e-89
NZ_CP045033.1\|WP_013854987.1\|2249078_2250344_-\|ATP-binding-protein	gnl\|CDD\|224292	COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only].	2.34071e-56
NZ_CP045033.1\|WP_013854982.1\|2256129_2256675_+\|cysteine-hydrolase	gnl\|CDD\|238245	cd00431, cysteine_hydrolases, Cysteine hydrolases; This family contains amidohydrolases, like CSHase (N-carbamoylsarcosine amidohydrolase), involved in creatine metabolism and nicotinamidase, converting nicotinamide to nicotinic acid and ammonia in the pyridine nucleotide cycle. It also contains isochorismatase, an enzyme that catalyzes the conversion of isochorismate to 2,3-dihydroxybenzoate and pyruvate, via the hydrolysis of the vinyl ether bond, and other related enzymes with unknown function.	9.42354e-47
NZ_CP045033.1\|WP_003636323.1\|2273752_2274463_+\|ECF-transporter-S-component	gnl\|CDD\|227064	COG4720, COG4720, Predicted membrane protein [Function unknown].	2.1864e-06
NZ_CP045033.1\|WP_013854989.1\|2246145_2247807_-\|formate--tetrahydrofolate-ligase	gnl\|CDD\|237403	PRK13505, PRK13505, formate--tetrahydrofolate ligase; Provisional.	0

>NZ_CP045033.1|WP_013854980.1|2257435_2258353_-|LysR-family-transcriptional-regulator
MMENKLIYKILTAVSTNNTISNVANGLYLSQPYVSQIISKTEKKYETKLVNRNEKPISLTAAGIKLLQDLDDEIKLHEKTKRDLSFFASKNGRVICVAITPIWISNLTAKVIHDLQAMFPEVQFQIERFFTAENAPALLQSNKIDIFWGAFLHQDQITSQYLYRSKAYVIIPFNHPLYDQSQKYLAYTPELFAKLNKSNYVALTDNSLYQTIVDHVFEDDGLKVKKIIRTNDFIGAGLLAIEGMGITITLGDILLYLGNKHNYNLMELPESLINLDVGISINATSPDLVKKVAEKLQLIIQKSVG
>NZ_CP045033.1|WP_013854982.1|2256129_2256675_+|cysteine-hydrolase
MTKALLIIDYTNDFVADDGSLTCGKPAQAIEDYLLSLANDFFDNGDYVIFPTDGHTGDKFSPEYKLFPPHNIVGTPGQELYGKLKTWFQEHKDSNRVYQFNKNRYSSFQNTNLDNYLRERKIDDLWLTGVCTDICVLHTAIAAYNLNYKITIPKKGVATFTKYGNEWAFDHFRNSLGAKLI
>NZ_CP045033.1|WP_013854983.1|2255632_2255866_-|prevent-host-death-protein
MAQIKPVSELKNYQTVLDKVKKGKPTFLNQDGQLKYALVDINEYDEFITALDLLKRLKNAAALEHYDFDAIKKDLFE
>NZ_CP045033.1|WP_013854986.1|2250577_2251783_-|amidohydrolase-family-protein
MTKTVFVNCNLFVGNSEELLENAWFVVDNETGKLTAKGTGKVTITAEQTVDLNGQYVMSGLINAHTHVGLVNAAKDHYPETETLVTYKALKDLKSGLKGGVTYIISCGVPFDVDVKLKNMRDAYPFEGPGMRPAGMPISILGGHADQPLGENHELNAAHLVNSPDDVRKAVREQFKKGAENVKLMATGGIMSQGDQIDDTELSLEEMKMAVEEAHSKHMTVCAHAEGRLGIHYAVVAGVDSVEHGFYVSDEDIELMKKQGTFLSPTLIAGHQLAVYGKGKMTDFSYQKMCEHVDAFYAHVGKAIKSGVKLALGTDAGTFMNPLKNTAKELTELVRAGASNYQALHAAGLGSAELLKIDNEYGSLEEGKYADFLVLKANPLENVSAVEQDDKQVYQHGVRKF
>NZ_CP045033.1|WP_013854987.1|2249078_2250344_-|ATP-binding-protein
MNPDLLAAIIIEGQKNIRNISIIPRDYHFEDSLNYVLVGLRRSGKSTLLFKRAQDLVNKQNVDWSQIVYLNFEDERLDGFQLSDCNNILIAANQLTTKKHYFLFDEIQNIEGWEKFARRLADQGESVYLTGSNSKVLGHDIVLRLGGRYMAKYIAPFNFSEYLTAKNISHDKLALLDTVNNGQIRAVANEYLRYGGLPESILLSDKRNYLTNIYQNVFLADIIVRNKIRNEKTISLLIRKIADTVMHIVSYANLYKNVKSVINTVSRNAIIDYIDYAKEAYLIFSTKNYFAKFNERESSPKYYFTDNGILNLFYIDKLPALLENIVAIKLHNKYQKKLFYLKSKKTGVDIDFYVPASKTAIQVAWEVNDTSKEREIGNLLKLADNFTEVENLVIVTHGEEETIEKEGKTIQLVPLYKFLLE
>NZ_CP045033.1|WP_013854988.1|2248248_2249025_-|Fic-family-protein
MDDNLSLANFIVSFGSMNGYSSTVLQTKLALDFHNLSQLKNQHHDGELLKDALDGITVAQKMGFSTKSIIEINKTFVHNQNEDPNIPGHLRKASSNPDDAVIVVTDPNDTTDGAYYAPENVCPQDLDDIVNEFKSSEQSVKDAWRVFAELSKLQPFQDGNKRTALIAANTALNTWGSKDYLILPFDNIEHAAFMVNLMRFYRATTKEQENIALDRIIDTLPTSKEIQYYLSNSIEQKDEGINKLKNKRVKSFFKKNLD
>NZ_CP045033.1|WP_013854989.1|2246145_2247807_-|formate--tetrahydrofolate-ligase
MPTDIEIADAAKMQPITEIAAKLALKKDDFEQYGKYKAKINFPVKEISGKKHKLILVTGINPTPAGEGKSTVLVGLGDAMNQLGHQTTIAMREPSMGPVFGIKGGATGGGYSQIIPMEDINLHFTGDLHALTSANNTLAALIDNYIMRDNKLGLDPRRIIWRRVEDVNDRALRTVVTGLGGLSQGVPRETGFDITAASEMMAILCLSESLHDLKRRIGRIVVGYSYEKKPVTVNELGFTGAITLLLKDAIKPNLVQSLGHTPAIIHGGPFANIAHGCNSVLATQIAMARSDYTVTESGFGADLGAEKFLDIKCRVLKKIPDAAVIVATARALKYNGGVDKKDLTKENISALKKGMANLARHVHNIQKYGIPVVVAINHFDSDTEAEIQTIKDACQEMDIKGIRVDAWAKGGNGTQDLAKEVIALTKKTYDFIPLYDENDSIEEKITTIATKIYGAKRVVFSKKARKQMKQFAKFGWEKLPVCIAKTQYSFTDDQTKLGAPTDFDFHIRDLVPKLGAGFIVALSGTIMTMPGLAKHPAAENMDIDDNGQISGLF
>NZ_CP045033.1|WP_003627031.1|2245646_2246135_-|5-(carboxyamino)imidazole-ribonucleotide-mutase
MTVKIAVIMGSKSDWPTMKHACDLLDQFNVGYEKHVISAHRMPTEMYDFAQKAEERGIRVIIAGAGMAAHLPGMTAANTVLPVIGVPGQTKALGGMDSLLSIVQMPTGIPVATTAIGNAGASNAALLALEILGTNDEKLRGRLKNYRQKLHDLAKESSGELE
>NZ_CP045033.1|WP_095342310.1|2244517_2245636_-|5-(carboxyamino)imidazole-ribonucleotide-synthase
MGQGKTIGIIGGGQLGQMMAISAKYSGMKVITLDPTPNCPCGQVADDQIVANYSDTSAIEELAERSDVLTYEFENVDLKALEDVKDKVAIPQGTKLLYITKHRIREKNFLRSAGCQTAPYIPVKNKSDLQAAVKTIGYNCVLKTCEGGYDGHGQEVLHSDADLTNDHIKQILSTGDCILEGWVPFKVEASVMVARNAMGEVSVFPVSENYNKDEILHMSIVPARISPDVYQKAQKIAVQIAEAIDLRGILGVEMFVLNNGEIYINELAPRPHNSGHYSIEACNFSQFDLHDRAICNWPLPKIKLMSKVVMVNVLGQHVAGIHKIIAEKRGWHFHDYGKAEIRHNRKMGHVTILTDNIAKTISDINATHIWDR
>NZ_CP045033.1|WP_013854991.1|2243604_2244321_-|phosphoribosylaminoimidazolesuccinocarboxamide-synthase
MDKLLYTGKVKQMWSTNDPEVLRVVYTDQATAGNGKKKDNFKDKAELNNQISTLIFQYLEKNGVPTHFIKKISDKEELVKKCEMFPLEVVTRNIAAGHFSSRYGLDEGMRFAIPVEELFFKSDELDDPILNSSDAVALNVATKSEQEQMWSLSRQVNQLLINLFDEAGMDLVDFKLEFGKLHNGQIVLADEFSPDNCRLWDKKTKSHMDKDVYRRDIGDLTAVYKKVLARIEEVLEED
>NZ_CP045033.1|WP_013854977.1|2260145_2260421_-|hypothetical-protein
MLYPYAEFPGELSITYSQVIKDSEMKNGEKIFVHFEKPTDFGFKEARYILPGFKEVYNYDFTPSETKKNLDILKRNAPLIIECAKEKKTSA
>NZ_CP045033.1|WP_143000353.1|2263213_2263438_-|hypothetical-protein
MRVYLNKTTTQAVAAGAVGGVGALIANYVSGGLATFAVGAISSSVSALVGSSIKGGVWVDYNFLARTVTSCGWQ
>NZ_CP045033.1|WP_013854972.1|2264419_2265106_+|hypothetical-protein
MKVKNAHEEYRDLLTRKQLVSQGLIPTDKGIELWTNQYCEHSAIYYDPAKAIKLESVYFWKNSFSDDYGLNVVEVGVVDQLGNELFSKVVKPCRGYLSEGSNADLWLKIEKDHSFSMADIICADNRVAVDRQLASVIKKQKYVKNLISYNVGFNVPNVLLANQAYKQIDMMELFANIIKEPYEDYYGEKSYKWQKLSKCLEYYDVKLNSYRAVDYARALQKCYEKMPK
>NZ_CP045033.1|WP_049776011.1|2266948_2267653_-|hypothetical-protein
MDIKVFELCIHKLKATNIDGVTRKITHNAYIYRTSTGRTSYNGRWKLYKGQTVTTYGGSYKFKNGKHYFRVGGPQKQYIKSYNLGPVVKVNTVQGRTSNNDNTNITANSKPTSSTLTSTEETTITVDANYSTPIITFDKNGKVVKVRTATPGEKFTVDRLEKGTRADKVASYIGQFGGDQSIYRIKGTNNWLYSMGVKAASKITAHDYDLEETSIIKFTQTTDLYNRVTAKHLL
>NZ_CP045033.1|WP_013854968.1|2271196_2272093_+|energy-coupling-factor-transporter-transmembrane-protein-EcfT
MTHTPIKMTFFSQLHPVALTLYFTELIVCLLLFNHVAVAVAEFIALTITATYYLGGRKTARQLKYAVSFLLMIPFFNTLLNQKFPPILWHFKWGILTFKFSYPAFLYGIAMAIVLIAMQFVFSVLNAVLIPSKLIYVFSPIAPRLAVLVTISFTLVTSFTDRLKRILRLQKTRNVDVVNGSLKTRTQKTLHIFEILLQDALSSAMETANLMDARGFGAAKRTHYRSYHWQFSDLLFITIATVMLVATIGVRILSMGTSRSVANFTTIFTPGDTWPIVVTALLFLLPLISEGVYRSCKN
>NZ_CP045033.1|WP_013854967.1|2272080_2273745_+|ATP-binding-cassette-domain-containing-protein
MQKLATVTHLTFTYPDQSTPVLDDVNFTIDPGDFIVIAGNTGSGKTTLLNHLKKELMPKGARTGDVQIAETPVADMPKLVSAQTVGYVAQDPQTQSVMATVIEELAFPLENIGCPSNEIERRITELANFLGFDQNLDRQIHQLSGGQLQLVNLASVLILRPKLILLDEPTSQLDPLTAQHFLTVLGRINQELGITIMLTEHRLSTVAAMANRMILLQDHHLTFDGDPHSGLAKMATDAHLTYFVPSIPKLFLDQQIRTSQLPISVADAQSAIRTHHLQFQSVTTGGKVAQLPPAEKPILTVNNISFSFDGQHNVLHHLNLAINPGTWLAIIGKNGSGKSTLLTLICGLMTPQHGKIRFVHQLVWKMAINQRMAKLAFLSQTPRLQFTADTVREELEVQAAELRLPDAKAQVDHMINQFHLNRIEKQNPFDISGGQQQLVGLAIALMATPDLLVLDEPTKGLDPYTKIQVGNLLKQYQQAGMTIVIASHDMEFCAKFADKCTFMFDGHLNTLLATQSFFADNFFFTTPINRIARDQVKDALLPVDLKLANHPERG
>NZ_CP045033.1|WP_003636323.1|2273752_2274463_+|ECF-transporter-S-component
MKQSSLLNRYRLLIALLLMFIFLLFIVLLKGKHYLLFSFMCLICSLLPAYWRFEHDPISTQTLMFVAVLIALAVATRVPLGAIPGVQGASFVVILSGVSLGPELGFITGSTTALVSNMFMGQGPWTPWQMVAWGLMGLTAGLFMKARLSHSLIFMIVFACVWGYLFGWIMDLWYALAYVSPLTIKSFILAFAASFFPFDTFHAASNAFLIALFYKPWEKLFHRLVTKYNILPDKNQ
>NZ_CP045033.1|WP_013854966.1|2274482_2275526_+|hypothetical-protein
MKLTSKLLMISASTLLGFGSIAPAFTANAASVETASRAYQNSKIKANYRYAKNLMIKNKTGLSGKTTALFSKKANPTIGAASGYADLLVGLKGWGYKFTTTQKKRIAANLVINSKSTAADYANAIQGLKAVGLNPTKFKPAGAKKAVNLVSGLYRQSMSKQTPNVKSQVLLALTMSSTFKRPSNAKFSKTSLAKSLVKDQQSNNGWAYNNTAASVDSDTTSMAIAALAHSKSSLSAVKTALVKGQSYLKSNITASGAYGYVFNGKTVANSTAEAIIALSSKQATVKYANGYFTTKQAASPLRAMLGYVNKTGSIKGATSQLIGVGQVNLATAAYRQALKGHSVYTVK
>NZ_CP045033.1|WP_013854965.1|2275563_2275992_+|EutP/PduV-family-microcompartment-system-protein
MKKAMFIGAIGCGKTSFIQKLNELQMTYNKTQTIEFYNNVIDTPGEYVEHRAMYSNLMTTAIEADVIVLMQSATDPRIVLPTGFSTMFTKETIGVVTKTDIATNQQIEMVTERLRDAGAEKMFEISAKTGANVQQLIDYLRN
>NZ_CP045033.1|WP_013854964.1|2276051_2276591_-|NAD(P)H-dependent-oxidoreductase
MINIGVLVGSLSERSYSQKIANYLMNEYQSVRFVQVNFEILPLYNPDFEKEPPLEWQVFRSVIDQMDALLFVTQEYNLSIPGGLKNAIDVLSVPSPEPHIAYKPALVITDSSGERGGANANIHIQQLLRYIGMTVLNEFITISNVHQRFDPQNRLLNEQVAAQLNGSIRKLVESIDKQH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045033_2	2.1\|1715205\|48\|NZ_CP045033\|CRISPRCasFinder	1715205-1715252	48	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	250-297	0	1.0
NZ_CP045033_2	2.2\|1715292\|61\|NZ_CP045033\|CRISPRCasFinder	1715292-1715352	61	NC_015598	Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence	337-397	1	0.984
NZ_CP045033_3	3.3\|2259429\|32\|NZ_CP045033\|PILER-CR,CRISPRCasFinder,CRT	2259429-2259460	32	MG770379	Klebsiella virus vB_KpnM_KpS110, complete genome	145244-145275	7	0.781
NZ_CP045033_1	1.1\|1043085\|32\|NZ_CP045033\|CRISPRCasFinder	1043085-1043116	32	KT264814	Gokushovirus WZ-2015a isolate 66Brd04, complete genome	861-892	8	0.75
NZ_CP045033_1	1.1\|1043085\|32\|NZ_CP045033\|CRISPRCasFinder	1043085-1043116	32	MH617057	Microviridae sp. isolate ctjj715, complete genome	906-937	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	DQ517338	Staphylococcus phage 80alpha, complete sequence	38336-38367	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	AY954952	Bacteriophage 53, complete genome	22084-22115	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	AF513856	Staphylococcus aureus bacteriophage phi 53 phiETA ORF57-like protein, phiETA ORF58-like protein, phiETA ORF59-like protein, phiPVL ORF17-like protein, and peptidoglycan hydrolase genes, complete cds	4404-4435	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	NC_007049	Staphylococcus phage 53, complete genome	22084-22115	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	DQ530360	Staphylococcus aureus phage phiNM2, complete genome	38558-38589	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	MH321492	Staphylococcusphage Lorac, complete genome	21980-22011	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	NC_008583	Staphylococcus aureus phage phiNM1, complete genome	38564-38595	8	0.75
NZ_CP045033_1	1.3\|1043207\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043207-1043238	32	NC_009526	Staphylococcus phage 80alpha, complete genome	38336-38367	8	0.75
NZ_CP045033_3	3.1\|2259307\|32\|NZ_CP045033\|PILER-CR,CRISPRCasFinder,CRT	2259307-2259338	32	KU686197	Synechococcus phage S-CAM3 isolate 0808SB25, complete genome	75310-75341	8	0.75
NZ_CP045033_3	3.1\|2259307\|32\|NZ_CP045033\|PILER-CR,CRISPRCasFinder,CRT	2259307-2259338	32	KU686199	Synechococcus phage S-CAM3 isolate 1010CC42, complete genome	75296-75327	8	0.75
NZ_CP045033_3	3.1\|2259307\|32\|NZ_CP045033\|PILER-CR,CRISPRCasFinder,CRT	2259307-2259338	32	KU686198	Synechococcus phage S-CAM3 isolate 0910TB04, complete genome	75302-75333	8	0.75
NZ_CP045033_1	1.2\|1043146\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043146-1043177	32	NZ_AP019725	Bacteroides uniformis strain NBRC 113350 plasmid pBUN1, complete sequence	11323-11354	9	0.719
NZ_CP045033_3	3.3\|2259429\|32\|NZ_CP045033\|PILER-CR,CRISPRCasFinder,CRT	2259429-2259460	32	NC_020157	Anabaena cylindrica PCC 7122 plasmid pANACY.02, complete sequence	159625-159656	9	0.719
NZ_CP045033_1	1.4\|1043268\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043268-1043299	32	NZ_AF135182	Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence	104993-105024	10	0.688
NZ_CP045033_1	1.4\|1043268\|32\|NZ_CP045033\|CRISPRCasFinder,PILER-CR	1043268-1043299	32	NC_002523	Serratia entomophila plasmid pADAP, complete sequence	104555-104586	10	0.688

1. spacer 2.1|1715205|48|NZ_CP045033|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 0, identity: 1.0

cagctctacacaaaatttagggtagctctcccatgaaactcgatttgc	CRISPR spacer
cagctctacacaaaatttagggtagctctcccatgaaactcgatttgc	Protospacer
************************************************

2. spacer 2.2|1715292|61|NZ_CP045033|CRISPRCasFinder matches to NC_015598 (Lactobacillus kefiranofaciens ZW3 plasmid pWW1, complete sequence) position: , mismatch: 1, identity: 0.984

gttttaacgagtgaattcaagcgttttcaccagagttatccacaggctagtgggagcttt	CRISPR spacer
gttttaacgagtgaattcaagcgttttcaccagagttatccacaggctagtgggagcttt	Protospacer
************************************************************

3. spacer 3.3|2259429|32|NZ_CP045033|PILER-CR,CRISPRCasFinder,CRT matches to MG770379 (Klebsiella virus vB_KpnM_KpS110, complete genome) position: , mismatch: 7, identity: 0.781

tgatattgacactaccaattacaagtatgtcg	CRISPR spacer
tgatattgacaccaccaatttcacaggtggcg	Protospacer
************.******* ** . .** **

4. spacer 1.1|1043085|32|NZ_CP045033|CRISPRCasFinder matches to KT264814 (Gokushovirus WZ-2015a isolate 66Brd04, complete genome) position: , mismatch: 8, identity: 0.75

gaataaaatcagtatagcgcgtaacttcattg	CRISPR spacer
gaataatttcagtatagcgcgtaccaccacga	Protospacer
******  *************** * .**. .

5. spacer 1.1|1043085|32|NZ_CP045033|CRISPRCasFinder matches to MH617057 (Microviridae sp. isolate ctjj715, complete genome) position: , mismatch: 8, identity: 0.75

gaataaaatcagtatagcgcgtaacttcattg	CRISPR spacer
gaattaattcagtatagcgcgtaccaccacgc	Protospacer
**** ** *************** * .**.

6. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to DQ517338 (Staphylococcus phage 80alpha, complete sequence) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

7. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to AY954952 (Bacteriophage 53, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

8. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to AF513856 (Staphylococcus aureus bacteriophage phi 53 phiETA ORF57-like protein, phiETA ORF58-like protein, phiETA ORF59-like protein, phiPVL ORF17-like protein, and peptidoglycan hydrolase genes, complete cds) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

9. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NC_007049 (Staphylococcus phage 53, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

10. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to DQ530360 (Staphylococcus aureus phage phiNM2, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

11. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to MH321492 (Staphylococcusphage Lorac, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

12. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NC_008583 (Staphylococcus aureus phage phiNM1, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

13. spacer 1.3|1043207|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NC_009526 (Staphylococcus phage 80alpha, complete genome) position: , mismatch: 8, identity: 0.75

ctaactaatgctgtgctttttctaagctattc	CRISPR spacer
ttcattaatgctgtgctttttacaagcttctg	Protospacer
.* *.**************** .***** .*

14. spacer 3.1|2259307|32|NZ_CP045033|PILER-CR,CRISPRCasFinder,CRT matches to KU686197 (Synechococcus phage S-CAM3 isolate 0808SB25, complete genome) position: , mismatch: 8, identity: 0.75

gggtgggcagtggtaggaaaaattaaatagct	CRISPR spacer
gataccgcagttgtaggtaaaattaaatagtt	Protospacer
*.    ***** ***** ************.*

15. spacer 3.1|2259307|32|NZ_CP045033|PILER-CR,CRISPRCasFinder,CRT matches to KU686199 (Synechococcus phage S-CAM3 isolate 1010CC42, complete genome) position: , mismatch: 8, identity: 0.75

gggtgggcagtggtaggaaaaattaaatagct	CRISPR spacer
gataccgcagttgtaggtaaaattaaatagtt	Protospacer
*.    ***** ***** ************.*

16. spacer 3.1|2259307|32|NZ_CP045033|PILER-CR,CRISPRCasFinder,CRT matches to KU686198 (Synechococcus phage S-CAM3 isolate 0910TB04, complete genome) position: , mismatch: 8, identity: 0.75

gggtgggcagtggtaggaaaaattaaatagct	CRISPR spacer
gataccgcagttgtaggtaaaattaaatagtt	Protospacer
*.    ***** ***** ************.*

17. spacer 1.2|1043146|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NZ_AP019725 (Bacteroides uniformis strain NBRC 113350 plasmid pBUN1, complete sequence) position: , mismatch: 9, identity: 0.719

ctaaatgactgtactgtgtctgatcaacttca	CRISPR spacer
ataaatgtctgtactctgtctgataaccggtc	Protospacer
 ****** ******* ******** * *  .

18. spacer 3.3|2259429|32|NZ_CP045033|PILER-CR,CRISPRCasFinder,CRT matches to NC_020157 (Anabaena cylindrica PCC 7122 plasmid pANACY.02, complete sequence) position: , mismatch: 9, identity: 0.719

tgatattgacactaccaattacaagtatgtcg	CRISPR spacer
accgattgacactagcaattacaattacatca	Protospacer
    ********** ********* **..**.

19. spacer 1.4|1043268|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NZ_AF135182 (Serratia entomophila strain A1MO2 plasmid pADAP, complete sequence) position: , mismatch: 10, identity: 0.688

tttcaagaactgagccgtattcccatgaggtc	CRISPR spacer
cagaaagaactgaaccgtattcccgtgctgca	Protospacer
.   *********.**********.**  *.

20. spacer 1.4|1043268|32|NZ_CP045033|CRISPRCasFinder,PILER-CR matches to NC_002523 (Serratia entomophila plasmid pADAP, complete sequence) position: , mismatch: 10, identity: 0.688

tttcaagaactgagccgtattcccatgaggtc	CRISPR spacer
cagaaagaactgaaccgtattcccgtgctgca	Protospacer
.   *********.**********.**  *.

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

99752 : 132452

Lactobacillus_virus(28.57%)

protease,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013855101.1\|99752_101015_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	2.2e-63	38.0
WP_013855102.1\|101194_101389_+	hypothetical protein	NA	NA	NA	NA
WP_013855103.1\|101385_101757_+	hypothetical protein	NA	NA	NA	NA
WP_013855104.1\|101977_102589_+	type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein	NA	NA	NA	NA
WP_013855105.1\|102585_103473_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_013855106.1\|103482_104367_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_013855107.1\|104372_105026_-	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_013855108.1\|105029_106379_-	ABC transporter ATP-binding protein	A0A1V0SI78	Klosneuvirus	4.7e-11	21.7
WP_013855109.1\|106538_107480_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013855110.1\|107508_108405_-\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA
WP_013855111.1\|108416_108977_-	LemA family protein	NA	NA	NA	NA
WP_013855112.1\|109079_110186_-	cation transporter	NA	NA	NA	NA
WP_013855113.1\|110372_110774_+	iron-sulfur cluster biosynthesis family protein	NA	NA	NA	NA
WP_013855114.1\|110852_112643_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_003548644.1\|112713_112854_+	hypothetical protein	NA	NA	NA	NA
WP_013855115.1\|113008_113653_+	HD domain-containing protein	NA	NA	NA	NA
WP_143000324.1\|113653_114574_+	HNH endonuclease	NA	NA	NA	NA
WP_013855117.1\|114733_115489_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.0e-26	36.7
WP_013855118.1\|115488_117102_-	ABC transporter substrate-binding protein/permease	NA	NA	NA	NA
WP_013855120.1\|118136_118496_+	DUF488 family protein	NA	NA	NA	NA
WP_013855121.1\|118548_119334_-	TerC family protein	A0A068EP98	Bacillus_phage	2.2e-40	44.5
WP_013855122.1\|119320_119839_-	methylated-DNA--[protein]-cysteine S-methyltransferase	NA	NA	NA	NA
WP_034536377.1\|119882_120596_-	NAD-dependent protein deacylase	NA	NA	NA	NA
WP_013855124.1\|120669_121149_+	hypothetical protein	NA	NA	NA	NA
WP_056956894.1\|121143_122601_-	cardiolipin synthase	NA	NA	NA	NA
WP_056940934.1\|122622_123549_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013855126.1\|123645_124425_+	ribonuclease	C1KFJ1	Lactobacillus_virus	1.3e-29	34.0
WP_013855127.1\|124468_125425_-	DUF1002 domain-containing protein	NA	NA	NA	NA
WP_013855128.1\|125580_126396_+	glycosyltransferase	NA	NA	NA	NA
WP_056956892.1\|126408_127065_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_013855130.1\|127543_128401_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_025084202.1\|128706_129213_+\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_013855132.1\|129464_130103_+	NAD(P)H-binding protein	NA	NA	NA	NA
WP_013855133.1\|130104_130524_+	hypothetical protein	NA	NA	NA	NA
WP_013851363.1\|130559_131024_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	9.1e-31	47.7
WP_013855134.1\|131123_132452_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	1.2e-59	37.5

DBSCAN-SWA_2

173306 : 225925

unidentified_phage(20.0%)

holin,bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004561985.1\|173306_174296_+\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	9.9e-59	40.5
WP_013855174.1\|174256_174829_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_013855175.1\|174923_175067_-	hypothetical protein	NA	NA	NA	NA
WP_013439000.1\|175078_175330_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_003596522.1\|175915_176101_-	DUF2273 domain-containing protein	NA	NA	NA	NA
WP_143000358.1\|176787_177546_-	FRG domain-containing protein	NA	NA	NA	NA
WP_013855177.1\|177514_177745_-	hypothetical protein	NA	NA	NA	NA
WP_143000359.1\|177872_177944_+\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_013855179.1\|178875_179250_+	glycosyltransferase	NA	NA	NA	NA
WP_013855178.1\|179622_180450_+	hypothetical protein	NA	NA	NA	NA
WP_013855181.1\|184828_185872_+	acyltransferase family protein	NA	NA	NA	NA
WP_013855182.1\|185868_187098_+	glycosyltransferase	NA	NA	NA	NA
WP_025084304.1\|187101_187392_+	hypothetical protein	NA	NA	NA	NA
WP_034536635.1\|187375_188308_+	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_025084303.1\|190775_191462_+	dipeptidase E	NA	NA	NA	NA
WP_013855188.1\|191659_192247_+	recombinase family protein	A0A1V0E035	Clostridioides_phage	1.1e-20	34.9
WP_002831196.1\|192754_193003_+	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_013855189.1\|193218_194148_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.9e-19	30.8
WP_013855190.1\|194953_195214_+	hypothetical protein	NA	NA	NA	NA
WP_013855191.1\|195788_196016_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_025084340.1\|197384_198701_-	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	6.6e-34	29.8
WP_013855194.1\|202117_203125_+	class 1b ribonucleoside-diphosphate reductase subunit beta	A0A160DHK0	Gordonia_phage	9.3e-97	54.0
WP_005726599.1\|203108_203531_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A217ER62	Bacillus_phage	4.3e-11	33.3
WP_013855195.1\|203523_205692_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A0A0D3MSW9	Lactococcus_phage	5.5e-171	47.3
WP_013855196.1\|205756_206026_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_013855199.1\|206583_207531_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_013855200.1\|207626_208928_+	pyrimidine-nucleoside phosphorylase	A0A0H3UZD4	Geobacillus_virus	1.5e-115	52.0
WP_003625233.1\|209437_209884_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_013855202.1\|209913_210381_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_013855203.1\|210377_211361_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_013855204.1\|211419_211662_+	acyl carrier protein	NA	NA	NA	NA
WP_013855205.1\|211671_212589_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_013855206.1\|212588_213320_+	3-oxoacyl-ACP reductase FabG	F2NZ40	Diadromus_pulchellus_ascovirus	5.5e-14	31.2
WP_013855207.1\|213341_214571_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_013855208.1\|214574_215045_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_013855209.1\|215049_215466_+	beta-hydroxyacyl-ACP dehydratase	NA	NA	NA	NA
WP_013855210.1\|215479_216859_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_013855211.1\|216839_217682_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_013855212.1\|217674_218445_+	acetyl-CoA carboxylase carboxyl transferase subunit alpha	NA	NA	NA	NA
WP_054640358.1\|218696_219455_+	enoyl-ACP reductase FabI	NA	NA	NA	NA
WP_003630368.1\|219502_220492_+	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_034536528.1\|221273_221858_-	hypothetical protein	NA	NA	NA	NA
WP_013855218.1\|222755_223595_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_013855219.1\|223591_224779_-	MFS transporter	NA	NA	NA	NA
WP_013855189.1\|224995_225925_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.9e-19	30.8

DBSCAN-SWA_3

648833 : 727950

Tupanvirus(18.18%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025084207.1\|648833_649883_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.2e-33	36.9
WP_013853764.1\|649886_652301_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_013853765.1\|652375_652852_+	transcription elongation factor GreA	NA	NA	NA	NA
WP_013853766.1\|652906_653818_+	L-lactate dehydrogenase	NA	NA	NA	NA
WP_143000326.1\|653969_654188_+	addiction module toxin, HicA family	NA	NA	NA	NA
WP_013853768.1\|654220_654445_+	hypothetical protein	NA	NA	NA	NA
WP_013853769.1\|654679_655603_-	N-acetylglucosamine kinase	NA	NA	NA	NA
WP_013853770.1\|655701_658296_-	YfhO family protein	NA	NA	NA	NA
WP_013853771.1\|658384_660493_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_006351577.1\|660568_660718_+	50S ribosomal protein L33	NA	NA	NA	NA
WP_013853772.1\|660771_661338_+	5-formyltetrahydrofolate cyclo-ligase	NA	NA	NA	NA
WP_013853773.1\|661371_662052_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_013853774.1\|662051_662288_+	YqgQ family protein	NA	NA	NA	NA
WP_013853775.1\|662346_662748_+	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_025084208.1\|662817_663738_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_013853777.1\|663730_664981_+	aminotransferase class V-fold PLP-dependent enzyme	NA	NA	NA	NA
WP_013853778.1\|665127_666465_+	type I glutamate--ammonia ligase	NA	NA	NA	NA
WP_013853779.1\|666582_667470_+	hypothetical protein	NA	NA	NA	NA
WP_013853780.1\|667590_668604_+	hypothetical protein	NA	NA	NA	NA
WP_013853782.1\|670126_671332_-	acetate kinase	NA	NA	NA	NA
WP_152128053.1\|671578_672757_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	7.7e-26	29.5
WP_013853783.1\|672836_673106_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_013853784.1\|673105_673348_+	hypothetical protein	NA	NA	NA	NA
WP_074484264.1\|673487_674759_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	2.7e-64	38.3
WP_013853786.1\|675670_676663_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	8.2e-53	38.7
WP_013853787.1\|676760_677723_-	hypothetical protein	NA	NA	NA	NA
WP_013853788.1\|677706_679593_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	8.1e-94	33.5
WP_013853789.1\|679784_680813_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_013853790.1\|681002_682916_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013853791.1\|682922_684929_+	beta-galactosidase	NA	NA	NA	NA
WP_013853792.1\|685026_686190_+	galactokinase	NA	NA	NA	NA
WP_013853793.1\|686200_687664_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_013853794.1\|687667_688654_+	galactose mutarotase	NA	NA	NA	NA
WP_013853795.1\|688889_689498_+	hypothetical protein	NA	NA	NA	NA
WP_013853796.1\|689630_690470_-	AraC family transcriptional regulator	NA	NA	NA	NA
WP_013853797.1\|692616_694818_+	alpha-galactosidase	NA	NA	NA	NA
WP_049776036.1\|696477_697038_+	GTP pyrophosphokinase	NA	NA	NA	NA
WP_013853799.1\|697046_697712_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.7e-23	29.2
WP_013853800.1\|697720_698998_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_013853801.1\|699047_700220_+	MFS transporter	NA	NA	NA	NA
WP_013853803.1\|700658_701366_+	oxidoreductase	NA	NA	NA	NA
WP_013853804.1\|701451_702192_+	hypothetical protein	NA	NA	NA	NA
WP_013853805.1\|702436_702802_+	pyridoxamine 5'-phosphate oxidase family protein	NA	NA	NA	NA
WP_025084333.1\|704591_706151_+	type I restriction-modification system subunit M	J7I0U9	Acinetobacter_phage	5.2e-38	31.5
WP_013853810.1\|706525_708106_-	hypothetical protein	NA	NA	NA	NA
WP_003626431.1\|708254_708692_+	hypothetical protein	NA	NA	NA	NA
WP_013853811.1\|709299_710490_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	1.6e-116	55.4
WP_025084325.1\|715272_715518_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_013853815.1\|715782_716160_+	hypothetical protein	NA	NA	NA	NA
WP_025084343.1\|716761_717028_-	hypothetical protein	NA	NA	NA	NA
WP_013853818.1\|717029_717509_-	hypothetical protein	NA	NA	NA	NA
WP_143445839.1\|717799_717904_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_013853819.1\|718298_719813_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	3.5e-23	24.2
WP_013853821.1\|720784_723073_+	hypothetical protein	NA	NA	NA	NA
WP_013853822.1\|723088_724666_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	2.0e-24	33.3
WP_013853823.1\|724919_725969_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.0e-49	36.6
WP_152128055.1\|726771_727950_+\|transposase	IS256 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

1554725 : 1616257

Streptococcus_phage(20.0%)

integrase,transposase

attL 1551884:1551901|attR 1601528:1601545

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1551884:1551901	attL	NA	NA	NA	NA
WP_013854551.1\|1554725_1555910_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q5ULQ4	Lactobacillus_virus	2.5e-117	56.7
WP_013854552.1\|1557527_1558379_-	Rgg/GadR/MutR family transcriptional regulator	NA	NA	NA	NA
WP_013854553.1\|1558487_1559177_-	SlpX protein	NA	NA	NA	NA
WP_013854554.1\|1559341_1559890_-	hypothetical protein	NA	NA	NA	NA
WP_013854555.1\|1560016_1560487_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013854556.1\|1560747_1562025_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	6.8e-44	30.5
WP_013854557.1\|1562546_1562936_-	MazF family transcriptional regulator	NA	NA	NA	NA
WP_013854558.1\|1562925_1563183_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_013854559.1\|1563545_1564442_-	MFS transporter	NA	NA	NA	NA
WP_023061312.1\|1564396_1564738_-	hypothetical protein	NA	NA	NA	NA
WP_025084327.1\|1564740_1565175_-	hypothetical protein	NA	NA	NA	NA
WP_013854560.1\|1565178_1566288_-	beta-ketoacyl synthase	NA	NA	NA	NA
WP_013854561.1\|1566302_1566464_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_013854562.1\|1568385_1569510_-	hypothetical protein	NA	NA	NA	NA
WP_013854563.1\|1569570_1575072_-	helicase SNF2	A0A248SL14	Klebsiella_phage	4.5e-201	30.7
WP_013854565.1\|1575524_1576376_+\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_013854566.1\|1576485_1577730_-	hypothetical protein	NA	NA	NA	NA
WP_013854567.1\|1578049_1578754_-	hypothetical protein	NA	NA	NA	NA
WP_025084306.1\|1578847_1579462_-	hypothetical protein	A0A0E3XCL7	Enterococcus_phage	7.3e-20	66.7
WP_025084305.1\|1579493_1579769_-	hypothetical protein	NA	NA	NA	NA
WP_013854569.1\|1579786_1580431_-	hypothetical protein	NA	NA	NA	NA
WP_013854571.1\|1581539_1582166_-\|integrase	tyrosine-type recombinase/integrase	A3F636	Streptococcus_phage	1.0e-16	32.8
WP_005726889.1\|1582521_1582899_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_013854572.1\|1582931_1583144_-	hypothetical protein	NA	NA	NA	NA
WP_013854573.1\|1583414_1583909_+	hypothetical protein	NA	NA	NA	NA
WP_013851233.1\|1584194_1585742_-	hypothetical protein	NA	NA	NA	NA
WP_013851234.1\|1585900_1586413_-	hypothetical protein	NA	NA	NA	NA
WP_013851235.1\|1586704_1587082_-	hypothetical protein	NA	NA	NA	NA
WP_025084329.1\|1587112_1587766_-	hypothetical protein	V9VEZ1	Lactococcus_phage	2.5e-26	33.3
WP_025084328.1\|1587776_1588367_-	hypothetical protein	NA	NA	NA	NA
WP_013851238.1\|1588629_1588905_-	hypothetical protein	NA	NA	NA	NA
WP_013851239.1\|1588904_1589390_-	DUF3990 domain-containing protein	NA	NA	NA	NA
WP_152128068.1\|1589475_1590639_-	DNA polymerase III subunit beta	NA	NA	NA	NA
WP_013851241.1\|1591034_1591154_+	hypothetical protein	NA	NA	NA	NA
WP_025084299.1\|1593294_1598310_-	S8 family serine peptidase	NA	NA	NA	NA
WP_013851246.1\|1598675_1598864_+	hypothetical protein	NA	NA	NA	NA
WP_013851247.1\|1598908_1599193_+	hypothetical protein	NA	NA	NA	NA
WP_013851248.1\|1601603_1601864_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
1601528:1601545	attR	NA	NA	NA	NA
WP_013851249.1\|1601866_1602232_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_013851250.1\|1602263_1602815_-	hypothetical protein	NA	NA	NA	NA
WP_013851251.1\|1602864_1603593_-	hypothetical protein	NA	NA	NA	NA
WP_143000347.1\|1603955_1604306_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_013851253.1\|1604226_1606296_-	YSIRK-type signal peptide-containing protein	NA	NA	NA	NA
WP_013851254.1\|1606430_1606652_-	hypothetical protein	NA	NA	NA	NA
WP_025084284.1\|1606667_1607273_-	hypothetical protein	NA	NA	NA	NA
WP_013851256.1\|1607282_1608020_-	hypothetical protein	NA	NA	NA	NA
WP_013851257.1\|1608080_1608413_-	hypothetical protein	NA	NA	NA	NA
WP_013851258.1\|1608455_1608824_-	hypothetical protein	NA	NA	NA	NA
WP_013851260.1\|1609303_1611808_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_013851261.1\|1612068_1612761_+	LysM peptidoglycan-binding domain-containing protein	A0A0E3XCL7	Enterococcus_phage	4.7e-15	69.1
WP_013851262.1\|1612922_1614002_+	tyrosine recombinase XerS	A0A2R2ZHE2	Clostridioides_phage	3.7e-06	28.5
WP_013851263.1\|1614293_1615619_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013851264.1\|1615648_1616257_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6

DBSCAN-SWA_5

1710406 : 1825552

Streptococcus_phage(32.0%)

integrase,protease,transposase

attL 1771223:1771238|attR 1779360:1779375

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013851363.1\|1710406_1710871_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	9.1e-31	47.7
WP_013851364.1\|1710970_1712308_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QMQ9	Streptococcus_phage	1.0e-58	41.8
WP_013851365.1\|1712436_1712676_-	hypothetical protein	NA	NA	NA	NA
WP_013851366.1\|1712856_1713135_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.3e-21	64.0
WP_013851367.1\|1713309_1713495_+	hypothetical protein	NA	NA	NA	NA
WP_013851207.1\|1713536_1714814_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.4e-43	30.7
WP_013851171.1\|1715705_1717106_+	replication initiation protein	NA	NA	NA	NA
WP_025084258.1\|1717380_1718223_-	phosphotransferase	NA	NA	NA	NA
WP_013851173.1\|1718585_1720367_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013851174.1\|1720410_1721058_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_013851175.1\|1721059_1721698_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_013851176.1\|1721894_1722095_+	hypothetical protein	NA	NA	NA	NA
WP_013851177.1\|1722095_1722716_+	hypothetical protein	NA	NA	NA	NA
WP_013851179.1\|1723766_1725053_-	peptidase T	NA	NA	NA	NA
WP_056956909.1\|1725071_1726694_-	peptide ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_056956907.1\|1727021_1730486_+	hypothetical protein	A0A1B1IUC6	uncultured_Mediterranean_phage	9.9e-29	27.1
WP_081462965.1\|1730498_1732526_+	hypothetical protein	NA	NA	NA	NA
WP_081462966.1\|1732544_1733927_+	SWF/SNF helicase family protein	A0A2K5B253	Erysipelothrix_phage	5.5e-15	37.4
WP_013851182.1\|1734221_1735499_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.3e-47	31.9
WP_013851185.1\|1737193_1737580_-	hypothetical protein	NA	NA	NA	NA
WP_074484288.1\|1737605_1738226_-	hypothetical protein	NA	NA	NA	NA
WP_013851187.1\|1738213_1738921_-	reverse transcriptase-like protein	A0A2H4JH24	uncultured_Caudovirales_phage	2.1e-18	34.6
WP_152128076.1\|1740688_1740883_+	hypothetical protein	NA	NA	NA	NA
WP_152128077.1\|1740879_1740963_+	hypothetical protein	NA	NA	NA	NA
WP_013851192.1\|1741083_1742262_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	1.0e-25	29.5
WP_013851193.1\|1742323_1742605_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_025084314.1\|1742611_1742899_-	damage-inducible protein J	NA	NA	NA	NA
WP_025084313.1\|1743158_1744208_+	cell division protein Fic	NA	NA	NA	NA
WP_013851196.1\|1744401_1744647_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_013851197.1\|1744649_1744979_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_025084312.1\|1745136_1745727_+	transcriptional regulator	NA	NA	NA	NA
WP_013851202.1\|1746615_1746867_+	hypothetical protein	NA	NA	NA	NA
WP_025084310.1\|1746860_1747199_+	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_025084309.1\|1747697_1748732_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.7e-32	33.0
WP_013851207.1\|1750260_1751538_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	4.4e-43	30.7
WP_013851208.1\|1751773_1752211_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_013851209.1\|1752230_1752854_+	hypothetical protein	NA	NA	NA	NA
WP_013851210.1\|1752937_1753300_+	hypothetical protein	NA	NA	NA	NA
WP_143000348.1\|1753304_1753730_+	hypothetical protein	NA	NA	NA	NA
WP_013851212.1\|1753871_1754234_+	hypothetical protein	NA	NA	NA	NA
WP_013851213.1\|1754284_1754992_-	NlpC/P60 family protein	D2KRB9	Lactobacillus_phage	1.5e-13	38.1
WP_013851214.1\|1755112_1755877_-	hypothetical protein	NA	NA	NA	NA
WP_013851215.1\|1756063_1756627_+	hypothetical protein	NA	NA	NA	NA
WP_025084287.1\|1756616_1757498_+	preprotein translocase subunit SecG	NA	NA	NA	NA
WP_013851217.1\|1757504_1757666_+	preprotein translocase subunit SecE	NA	NA	NA	NA
WP_013851218.1\|1757680_1760083_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_025084288.1\|1760095_1761388_+	preprotein translocase subunit SecY	NA	NA	NA	NA
WP_025084289.1\|1761380_1761761_+	hypothetical protein	NA	NA	NA	NA
WP_013851221.1\|1761848_1762247_+	hypothetical protein	NA	NA	NA	NA
WP_025084290.1\|1763021_1763474_+	hypothetical protein	NA	NA	NA	NA
WP_013851223.1\|1765048_1766119_+	hypothetical protein	NA	NA	NA	NA
WP_013851224.1\|1766675_1767797_-	hypothetical protein	NA	NA	NA	NA
1771223:1771238	attL	NA	NA	NA	NA
WP_081462967.1\|1773485_1773929_-	hypothetical protein	NA	NA	NA	NA
WP_013851229.1\|1774436_1775672_-	hypothetical protein	NA	NA	NA	NA
WP_081462968.1\|1775805_1776363_-	zinc-ribbon domain-containing protein	NA	NA	NA	NA
WP_013851231.1\|1776236_1777829_-	hypothetical protein	M4H0M3	Listeria_phage	9.5e-19	33.0
WP_013851232.1\|1777932_1778559_-\|integrase	tyrosine-type recombinase/integrase	A3F636	Streptococcus_phage	5.0e-16	32.3
WP_013851233.1\|1778872_1780420_-	hypothetical protein	NA	NA	NA	NA
1779360:1779375	attR	NA	NA	NA	NA
WP_013851234.1\|1780578_1781091_-	hypothetical protein	NA	NA	NA	NA
WP_013851235.1\|1781382_1781760_-	hypothetical protein	NA	NA	NA	NA
WP_025084329.1\|1781790_1782444_-	hypothetical protein	V9VEZ1	Lactococcus_phage	2.5e-26	33.3
WP_025084328.1\|1782454_1783045_-	hypothetical protein	NA	NA	NA	NA
WP_049775987.1\|1783381_1783690_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013854575.1\|1783689_1784058_-	hypothetical protein	NA	NA	NA	NA
WP_152128069.1\|1784169_1785333_-	DNA polymerase III subunit beta	NA	NA	NA	NA
WP_005730021.1\|1785647_1785998_-	hypothetical protein	NA	NA	NA	NA
WP_013854577.1\|1786199_1787249_-\|transposase	IS30 family transposase	H7BUM7	unidentified_phage	1.1e-47	32.9
WP_013854578.1\|1787348_1788026_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_013854565.1\|1788333_1789185_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_013854580.1\|1792528_1793251_-	hypothetical protein	NA	NA	NA	NA
WP_152128070.1\|1794321_1795125_-	hypothetical protein	NA	NA	NA	NA
WP_152128071.1\|1795088_1796603_-	hypothetical protein	NA	NA	NA	NA
WP_013854583.1\|1796980_1798576_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	2.2e-23	31.3
WP_013854584.1\|1798565_1800143_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.1e-16	23.7
WP_013854585.1\|1800495_1801725_-\|transposase	IS110-like element ISLhe4 family transposase	A0A1X9I619	Streptococcus_phage	1.8e-65	38.4
WP_013854586.1\|1803382_1804114_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.3e-15	31.3
WP_013854587.1\|1804683_1805961_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	2.6e-43	30.5
WP_013854588.1\|1806061_1807834_-	oleate hydratase	NA	NA	NA	NA
WP_013854589.1\|1807943_1808456_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025084126.1\|1808463_1809930_-	MFS transporter	NA	NA	NA	NA
WP_003633097.1\|1810436_1810937_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013854591.1\|1811541_1811919_-	hypothetical protein	NA	NA	NA	NA
WP_013854592.1\|1815086_1818062_-	type III restriction-modification system endonuclease	Q71TG1	Escherichia_phage	1.9e-92	30.1
WP_034536270.1\|1820206_1820605_-	DUF2326 domain-containing protein	NA	NA	NA	NA
WP_074484248.1\|1821403_1821700_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_003674720.1\|1822251_1822698_-	hypothetical protein	NA	NA	NA	NA
WP_013854598.1\|1822906_1823107_+	cold-shock protein	Q9AZD3	Lactococcus_phage	4.8e-21	73.0
WP_013854599.1\|1823201_1824533_-\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	9.3e-52	31.9
WP_013854600.1\|1824628_1825552_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.6e-29	31.7

DBSCAN-SWA_6

1973348 : 2010993

Planktothrix_phage(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013854718.1\|1973348_1974029_+\|protease	matrixin family metalloprotease	NA	NA	NA	NA
WP_013854719.1\|1974092_1974743_+	histidine phosphatase family protein	A0A1X9IGJ2	Lactococcus_phage	2.3e-08	37.6
WP_013854720.1\|1974782_1976585_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_013854721.1\|1976595_1977345_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.2e-34	39.9
WP_013854722.1\|1977494_1978760_-	hypothetical protein	NA	NA	NA	NA
WP_013854723.1\|1978848_1979529_+	hypothetical protein	NA	NA	NA	NA
WP_013854725.1\|1982626_1983019_-	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_013854727.1\|1983393_1984389_-	asparaginase	NA	NA	NA	NA
WP_013854729.1\|1988316_1988808_+	hypothetical protein	NA	NA	NA	NA
WP_013854730.1\|1988847_1989411_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_081780105.1\|1989786_1990014_-	hypothetical protein	NA	NA	NA	NA
WP_025084132.1\|1990023_1991313_-	hypothetical protein	NA	NA	NA	NA
WP_074484251.1\|1992276_1992768_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_013851264.1\|1992940_1993549_+\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6
WP_013851263.1\|1993578_1994904_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013854735.1\|1996319_1997660_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_013854736.1\|1997766_1998984_-	extracellular solute-binding protein	NA	NA	NA	NA
WP_152128072.1\|1999232_2000411_+\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	7.7e-26	29.5
WP_074484277.1\|2000498_2000780_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013854739.1\|2000905_2001766_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_013854740.1\|2001777_2002518_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.9e-31	34.4
WP_013854741.1\|2002527_2003202_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_003615004.1\|2003182_2003842_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_013854742.1\|2004216_2004624_+	MerR family transcriptional regulator	NA	NA	NA	NA
WP_034536662.1\|2004616_2005003_+	DUF2255 family protein	NA	NA	NA	NA
WP_013854744.1\|2005013_2005622_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_013854745.1\|2005596_2006202_+	sugar O-acetyltransferase	NA	NA	NA	NA
WP_013853732.1\|2008706_2009357_-\|transposase	IS607-like element ISLhe9 family transposase	A0A7Q0	Microcystis_virus	6.8e-40	45.2
WP_013854747.1\|2009509_2009740_+	amidohydrolase family protein	NA	NA	NA	NA
WP_152128072.1\|2009814_2010993_-\|transposase	IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	7.7e-26	29.5

DBSCAN-SWA_7

2028525 : 2075341

Bacillus_virus(25.0%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013851263.1\|2028525_2029851_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013851264.1\|2029880_2030489_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6
WP_013854768.1\|2031885_2032668_-	NlpC/P60 family protein	A0A0A8WF62	Clostridium_phage	7.4e-17	41.4
WP_013854769.1\|2034383_2034938_-	NlpC/P60 family protein	M9MUG9	Rhodococcus_phage	1.8e-17	45.0
WP_013854770.1\|2035123_2035669_-	AAA family ATPase	A0A2R2ZGN1	Clostridioides_phage	1.2e-08	31.4
WP_013854771.1\|2035764_2036076_+	DUF2187 domain-containing protein	NA	NA	NA	NA
WP_041817308.1\|2036207_2037719_+	membrane protein	NA	NA	NA	NA
WP_013854773.1\|2037773_2038394_-	hypothetical protein	NA	NA	NA	NA
WP_013854775.1\|2038950_2039886_+	ribonucleotide-diphosphate reductase subunit beta	A0A0N7CCA3	Skermania_phage	6.7e-49	34.9
WP_013854776.1\|2039930_2040485_-	hypothetical protein	NA	NA	NA	NA
WP_013854777.1\|2040762_2041248_-	threonine/serine exporter	NA	NA	NA	NA
WP_013854778.1\|2041250_2042021_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_013854779.1\|2042031_2043573_-	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	8.8e-46	28.9
WP_025084257.1\|2043579_2043951_-	hypothetical protein	NA	NA	NA	NA
WP_013854781.1\|2044096_2044675_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_013854782.1\|2044649_2045339_-	DUF554 domain-containing protein	NA	NA	NA	NA
WP_013854783.1\|2045408_2046638_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_013854784.1\|2046799_2048596_+	oligoendopeptidase F	NA	NA	NA	NA
WP_025084256.1\|2048661_2048895_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA
WP_013854786.1\|2048869_2049067_-	helix-turn-helix transcriptional regulator	A0A1V0E021	Clostridioides_phage	1.6e-08	53.2
WP_013854787.1\|2049063_2049540_-	hypothetical protein	NA	NA	NA	NA
WP_013854789.1\|2050236_2051337_+	vitamin B12 independent methionine synthase	A0A218MNE0	uncultured_virus	4.5e-76	42.9
WP_013854790.1\|2051399_2051876_+	S-ribosylhomocysteine lyase	NA	NA	NA	NA
WP_013854791.1\|2052005_2052293_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_025084255.1\|2052261_2052540_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_013851263.1\|2052824_2054150_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	G3MB42	Bacillus_virus	8.1e-56	36.0
WP_013851264.1\|2054179_2054788_-\|transposase	IS607 family transposase	A0A1V0SJI5	Klosneuvirus	1.2e-33	42.6
WP_013854795.1\|2057598_2058393_-	metal ABC transporter permease	NA	NA	NA	NA
WP_025084307.1\|2058392_2059040_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.9e-18	31.4
WP_013854797.1\|2059079_2059979_-	metal ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_013854798.1\|2060219_2060495_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013854799.1\|2060692_2062690_-	PTS fructose transporter subunit IIC	NA	NA	NA	NA
WP_013854800.1\|2062709_2063624_-	1-phosphofructokinase	NA	NA	NA	NA
WP_041817313.1\|2066534_2067143_-	hypothetical protein	NA	NA	NA	NA
WP_034536560.1\|2067442_2067664_-	hypothetical protein	NA	NA	NA	NA
WP_013854806.1\|2067677_2068091_-	hypothetical protein	NA	NA	NA	NA
WP_013854807.1\|2068106_2068310_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_013854808.1\|2068327_2068888_-	hypothetical protein	NA	NA	NA	NA
WP_013854809.1\|2069027_2070425_-	ATP-binding protein	NA	NA	NA	NA
WP_081462952.1\|2070666_2071188_-	DUF4143 domain-containing protein	NA	NA	NA	NA
WP_013854811.1\|2071184_2071433_-	hypothetical protein	NA	NA	NA	NA
WP_013854812.1\|2071392_2071815_-	AAA family ATPase	NA	NA	NA	NA
WP_013854813.1\|2071998_2074302_-	glycoside hydrolase family 31 protein	NA	NA	NA	NA
WP_013854814.1\|2074426_2074618_-	hypothetical protein	NA	NA	NA	NA
WP_013854815.1\|2074703_2074940_-	hypothetical protein	NA	NA	NA	NA
WP_013854816.1\|2075017_2075341_-\|bacteriocin	bacteriocin immunity protein	NA	NA	NA	NA

DBSCAN-SWA_8

2235838 : 2246135

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_013854996.1\|2235838_2237974_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.1e-74	46.0
WP_013854995.1\|2237970_2239020_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F0L1	Synechococcus_phage	1.6e-62	43.6
WP_095342308.1\|2239045_2240497_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.8e-61	34.9
WP_013854993.1\|2240454_2242686_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	1.6e-141	38.7
WP_013854992.1\|2242682_2243354_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_003627027.1\|2243353_2243605_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_013854991.1\|2243604_2244321_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	1.1e-38	37.0
WP_095342310.1\|2244517_2245636_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_003627031.1\|2245646_2246135_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	4.8e-22	45.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045033

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection