CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP045303	Azotobacter salinestris strain KACC 13899 plasmid unnamed1, complete sequence	0 crisprs	PrimPol,cas14j,Cas14u_CAS-V,DEDDh,WYL,RT,c2c9_V-U4	4
NZ_CP045302	Azotobacter salinestris strain KACC 13899 chromosome, complete genome	1 crisprs	csa3,DEDDh,cas14j,RT,cas3,WYL,c2c9_V-U4,cse2gr11,cas7,cas5,cas6e,DinG	302
NZ_CP045301	Azotobacter salinestris strain KACC 13899 plasmid unnamed2, complete sequence	0 crisprs	csa3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1170 : 57990

Pseudomonas_phage(10.0%)

integrase,transposase

attL 19485:19500|attR 55758:55773

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387531.1\|1170_2589_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.3e-61	32.8
WP_152390039.1\|2682_3498_+	hypothetical protein	NA	NA	NA	NA
WP_167520120.1\|3769_3931_-	hypothetical protein	NA	NA	NA	NA
WP_152390040.1\|4353_4689_+	hypothetical protein	NA	NA	NA	NA
WP_152390275.1\|5004_5244_+	hypothetical protein	NA	NA	NA	NA
WP_152390041.1\|5293_5590_+	HU family DNA-binding protein	A3E2K9	Sodalis_phage	8.7e-19	58.4
WP_152390042.1\|8462_8690_+	CopG family transcriptional regulator	NA	NA	NA	NA
WP_152390043.1\|8673_8940_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	A0A1S5SCV8	Streptococcus_phage	8.9e-15	44.2
WP_152390044.1\|9756_10047_+	nucleotidyltransferase	NA	NA	NA	NA
WP_152390045.1\|10639_11236_-	putative adenosine monophosphate-protein transferase Fic	NA	NA	NA	NA
WP_089170224.1\|11238_11406_-	DUF2559 family protein	NA	NA	NA	NA
WP_152390046.1\|11603_12560_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_152390047.1\|13423_13846_-	DoxX family membrane protein	NA	NA	NA	NA
WP_152390048.1\|14504_14753_+	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_152390049.1\|14739_15159_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_152390050.1\|15585_16131_+	hypothetical protein	NA	NA	NA	NA
WP_152390051.1\|16123_18493_+	DEAD/DEAH box helicase family protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	2.6e-33	29.8
WP_152390052.1\|18783_19761_-\|integrase	tyrosine-type recombinase/integrase	A0A2P1A0S4	Gordonia_phage	7.3e-14	29.3
19485:19500	attL	NA	NA	NA	NA
WP_152390053.1\|19753_20011_-	hypothetical protein	NA	NA	NA	NA
WP_152385935.1\|20143_21151_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_152390054.1\|21624_22038_+	hypothetical protein	NA	NA	NA	NA
WP_152390055.1\|22950_23259_-	hypothetical protein	NA	NA	NA	NA
WP_152390056.1\|23477_24236_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	5.7e-22	45.0
WP_152390057.1\|24306_24729_+	DoxX family membrane protein	NA	NA	NA	NA
WP_152390058.1\|24777_25506_+	quercetin 2,3-dioxygenase	NA	NA	NA	NA
WP_152390059.1\|25832_26667_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	9.0e-37	39.9
WP_152390060.1\|26712_28017_-	HAMP domain-containing protein	A0A1B0VMK3	Pseudomonas_phage	1.1e-07	26.2
WP_152390061.1\|28013_28748_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	1.2e-29	34.9
WP_167520121.1\|28953_29100_+	hypothetical protein	NA	NA	NA	NA
WP_152390276.1\|29172_29427_+	EF-hand domain-containing protein	NA	NA	NA	NA
WP_152390062.1\|29439_30288_+	sterol desaturase family protein	A0A1V0CNR7	Kaumoebavirus	4.9e-06	27.7
WP_152390063.1\|31455_31725_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_152390064.1\|31711_31972_-	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_152390065.1\|31986_32259_-	hypothetical protein	NA	NA	NA	NA
WP_131300956.1\|32273_32621_-	type II toxin-antitoxin system ChpB family toxin	NA	NA	NA	NA
WP_131300954.1\|32617_32872_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_167520132.1\|32945_33329_-\|integrase	integrase	NA	NA	NA	NA
WP_152390066.1\|33488_34550_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	1.8e-29	34.7
WP_152390067.1\|34964_35402_-	RES domain-containing protein	NA	NA	NA	NA
WP_152390068.1\|35398_35848_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_152390069.1\|36064_36553_+	hypothetical protein	NA	NA	NA	NA
WP_152390070.1\|36758_38372_-	ATP-binding cassette domain-containing protein	A0A2I4R674	Erysipelothrix_phage	1.2e-29	29.6
WP_136888326.1\|39000_39360_-	transcriptional regulator	A0A222YXG1	Escherichia_phage	2.0e-30	59.8
WP_136888327.1\|39359_39662_-	type II toxin-antitoxin system HigB family toxin	A0A0P0ZE17	Stx2-converting_phage	4.1e-08	31.9
WP_152386499.1\|41362_42400_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_167520118.1\|42701_42974_+	hypothetical protein	NA	NA	NA	NA
WP_152390278.1\|43170_43887_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152388410.1\|44437_45808_-\|transposase	transposase	NA	NA	NA	NA
WP_136888408.1\|47770_48034_+\|transposase	transposase	Q9G0F2	Phage_Gifsy-1	2.7e-08	53.3
WP_136888407.1\|48053_49994_-	aconitate hydratase	NA	NA	NA	NA
WP_152390071.1\|50238_51330_+	hypothetical protein	NA	NA	NA	NA
WP_152390072.1\|51442_52486_+	AAA family ATPase	A0A0K0LA94	Pseudomonas_phage	3.5e-30	36.1
WP_152390073.1\|52439_53972_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.4e-122	48.1
WP_152386917.1\|54053_54389_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_152390074.1\|54385_54709_-\|transposase	transposase	NA	NA	NA	NA
WP_152390075.1\|54781_55693_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152390076.1\|55801_56548_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	8.7e-07	26.8
55758:55773	attR	NA	NA	NA	NA
WP_152390077.1\|56638_56860_-	hypothetical protein	NA	NA	NA	NA
WP_152385914.1\|56949_57990_-\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	8.9e-10	29.1

DBSCAN-SWA_2

74094 : 100144

Morganella_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152390091.1\|74094_74955_+\|transposase	IS5 family transposase	A0A0M5M147	Mycobacterium_phage	3.6e-20	32.2
WP_152390092.1\|74942_76199_-\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_152390093.1\|76285_76717_-\|transposase	IS200/IS605 family transposase	W0UUZ0	Sulfolobus_monocaudavirus	1.7e-18	35.0
WP_152390094.1\|76823_77156_-	DUF2790 domain-containing protein	NA	NA	NA	NA
WP_152390095.1\|78312_78735_-	PIN domain-containing protein	NA	NA	NA	NA
WP_152390096.1\|78734_78986_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_152390097.1\|79670_79970_+	hypothetical protein	NA	NA	NA	NA
WP_152390098.1\|79917_80352_-\|transposase	transposase	NA	NA	NA	NA
WP_152390099.1\|80728_80992_+	hypothetical protein	NA	NA	NA	NA
WP_152390100.1\|81070_81676_+	3'-5' exonuclease	A2I2Z6	Vibrio_virus	4.3e-49	53.5
WP_152390101.1\|82224_82515_-	hypothetical protein	A3E2K9	Sodalis_phage	3.8e-11	66.7
WP_152390102.1\|83005_83407_-	helix-turn-helix domain-containing protein	A0A0P0ZCT8	Stx2-converting_phage	5.5e-08	34.5
WP_152390103.1\|83409_83700_-	type II toxin-antitoxin system HigB family toxin	NA	NA	NA	NA
WP_152390104.1\|84085_85036_+	replication terminus site-binding protein	NA	NA	NA	NA
WP_152390280.1\|86062_86995_-	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_152390105.1\|87171_88296_-	AAA family ATPase	Q1MVJ3	Enterobacteria_phage	5.0e-06	24.9
WP_152390106.1\|89366_90260_+	RepB family plasmid replication initiator protein	A0A218MNI2	uncultured_virus	4.3e-29	34.6
WP_152390107.1\|90283_90460_-	DUF4113 domain-containing protein	NA	NA	NA	NA
WP_152386036.1\|90426_91280_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152390108.1\|91327_92464_-	DNA polymerase V subunit UmuC	A0A1W6JNT0	Morganella_phage	8.4e-86	47.5
WP_152390109.1\|92469_92910_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	2.2e-18	43.1
WP_152390281.1\|93047_93305_+	hypothetical protein	NA	NA	NA	NA
WP_152390110.1\|93422_93629_+	hypothetical protein	NA	NA	NA	NA
WP_152390111.1\|93849_94710_+	hypothetical protein	NA	NA	NA	NA
WP_152390112.1\|94954_95209_-	hypothetical protein	NA	NA	NA	NA
WP_152390113.1\|95245_95725_+	hypothetical protein	NA	NA	NA	NA
WP_152390114.1\|95898_96168_+	hypothetical protein	NA	NA	NA	NA
WP_152390115.1\|96184_96487_+	hypothetical protein	NA	NA	NA	NA
WP_167520124.1\|96450_96915_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_167520125.1\|96850_97105_+\|transposase	transposase	NA	NA	NA	NA
WP_152385832.1\|97753_98734_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.2e-93	55.6
WP_152390119.1\|98968_100144_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A077SLN2	Escherichia_phage	1.6e-119	59.3

DBSCAN-SWA_3

116102 : 176137

Escherichia_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152390283.1\|116102_117119_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_167520127.1\|117289_117592_-\|transposase	transposase	NA	NA	NA	NA
WP_152386036.1\|117841_118695_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152386602.1\|118965_120003_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6
WP_152390136.1\|119999_120551_-	hypothetical protein	NA	NA	NA	NA
WP_152390137.1\|120689_121550_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_152390138.1\|122684_123161_+	single-stranded DNA-binding protein	A0A0U4K5C0	Pseudomonas_phage	1.5e-49	78.8
WP_152390139.1\|123312_124464_+	DNA recombination protein RecT	F1C5B8	Cronobacter_phage	1.2e-39	43.1
WP_090732744.1\|124600_124780_+	hypothetical protein	NA	NA	NA	NA
WP_152390140.1\|124988_125462_+	hypothetical protein	NA	NA	NA	NA
WP_152390141.1\|125448_126489_+	DNA recombination protein	H9C0I7	Bdellovibrio_phage	1.7e-08	26.1
WP_040107296.1\|126592_126853_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_157731523.1\|126849_127191_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_152390143.1\|127353_127653_+	hypothetical protein	NA	NA	NA	NA
WP_152390144.1\|127889_130493_+	relaxase	NA	NA	NA	NA
WP_152390145.1\|130485_132324_+	conjugative transfer system coupling protein TraD	NA	NA	NA	NA
WP_152390146.1\|132338_132629_+	hypothetical protein	NA	NA	NA	NA
WP_090733048.1\|132707_133358_+	DUF4400 domain-containing protein	NA	NA	NA	NA
WP_152390147.1\|133455_134247_+	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_090733043.1\|134239_134530_+	type IV conjugative transfer system protein TraL	NA	NA	NA	NA
WP_152390148.1\|134529_135162_+	pilus assembly protein	NA	NA	NA	NA
WP_152390149.1\|135330_136353_+	conjugal transfer protein	NA	NA	NA	NA
WP_152390150.1\|136362_137694_+	pilus assembly protein	NA	NA	NA	NA
WP_152390151.1\|137705_138197_+	type IV conjugative transfer system lipoprotein TraV	NA	NA	NA	NA
WP_152390152.1\|138707_140747_-\|protease	protease Lon-related BREX system protein BrxL	NA	NA	NA	NA
WP_152390153.1\|140761_143389_-	BREX-1 system phosphatase PglZ type A	NA	NA	NA	NA
WP_152390154.1\|143453_144188_-	hypothetical protein	NA	NA	NA	NA
WP_152390155.1\|144184_145354_-	AAA family ATPase	NA	NA	NA	NA
WP_152390156.1\|145346_149024_-	BREX-1 system adenine-specific DNA-methyltransferase PglX	NA	NA	NA	NA
WP_152390157.1\|149020_150484_-	AAA family ATPase	A0A088F7M4	Mycobacterium_phage	2.5e-26	30.4
WP_152390158.1\|150495_154170_-	BREX system P-loop protein BrxC	NA	NA	NA	NA
WP_152390159.1\|154188_154764_-	DUF1788 domain-containing protein	NA	NA	NA	NA
WP_152390160.1\|154786_155404_-	DUF1819 family protein	NA	NA	NA	NA
WP_152390161.1\|155400_156270_-	WYL domain-containing protein	NA	NA	NA	NA
WP_152390162.1\|156593_157091_-	RES domain-containing protein	NA	NA	NA	NA
WP_040107397.1\|157090_157561_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_152390163.1\|157804_158152_+	hypothetical protein	NA	NA	NA	NA
WP_152390164.1\|158261_158981_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_152390165.1\|158993_161459_+	type IV secretion system protein TraC	NA	NA	NA	NA
WP_152390166.1\|161458_162037_+	pilus assembly protein	NA	NA	NA	NA
WP_167520128.1\|162048_163323_+	conjugal transfer protein	NA	NA	NA	NA
WP_152390168.1\|163303_164347_+	traU family protein	NA	NA	NA	NA
WP_152390169.1\|164361_165027_+	NERD domain-containing protein	NA	NA	NA	NA
WP_152390170.1\|165093_165786_-	DUF1845 domain-containing protein	NA	NA	NA	NA
WP_152390171.1\|166187_166949_+	hypothetical protein	NA	NA	NA	NA
WP_152390172.1\|166998_168114_+	DNA primase	A0A2L1IV48	Escherichia_phage	7.6e-15	27.1
WP_152390284.1\|168272_169280_+	conjugal transfer protein TraF	NA	NA	NA	NA
WP_152390285.1\|169372_170689_+	pilus assembly protein	NA	NA	NA	NA
WP_152390173.1\|170704_173608_+	conjugal transfer protein TraG	NA	NA	NA	NA
WP_152385832.1\|173865_174846_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.2e-93	55.6
WP_152385958.1\|175156_176137_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6

DBSCAN-SWA_4

205994 : 303508

Paenibacillus_phage(12.0%)

integrase,tRNA,transposase

attL 198799:198816|attR 276138:276155

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
198799:198816	attL	NA	NA	NA	NA
WP_152390056.1\|205994_206753_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	5.7e-22	45.0
WP_040107386.1\|206881_207124_-	hypothetical protein	NA	NA	NA	NA
WP_152385814.1\|207252_208199_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	6.9e-09	22.6
WP_152390198.1\|209498_209939_+	hypothetical protein	NA	NA	NA	NA
WP_152390199.1\|210080_210332_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_152390200.1\|210331_210754_+	PIN domain-containing protein	NA	NA	NA	NA
WP_167520119.1\|210836_211049_+	hypothetical protein	NA	NA	NA	NA
WP_152390201.1\|211265_212276_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152390202.1\|212556_213195_+\|transposase	IS6 family transposase	A0A0N9SKD3	Staphylococcus_phage	7.1e-26	35.7
WP_152390203.1\|214349_216059_+	hypothetical protein	NA	NA	NA	NA
WP_152390204.1\|216444_217308_+	hypothetical protein	D6PH77	uncultured_phage	1.3e-38	36.0
WP_152390205.1\|217469_217865_-	hypothetical protein	Q6J1P0	Burkholderia_virus	2.2e-17	53.6
WP_152390206.1\|218071_218539_+	hypothetical protein	NA	NA	NA	NA
WP_152390207.1\|218666_218939_+	DNA-binding protein HU	A3E2K9	Sodalis_phage	4.0e-18	56.2
WP_152390208.1\|219274_220501_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_152390209.1\|220630_221503_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152390210.1\|221853_222588_-	kfra protein	NA	NA	NA	NA
WP_152390211.1\|224436_225141_+	AAA family ATPase	A0A0A8IL09	Aurantimonas_phage	1.2e-39	41.6
WP_152390212.1\|225140_225503_+	stability/partitioning determinant	NA	NA	NA	NA
WP_152390213.1\|225647_226091_-	hypothetical protein	NA	NA	NA	NA
WP_152390214.1\|226154_226508_-	hypothetical protein	NA	NA	NA	NA
WP_152390215.1\|226664_227888_-\|integrase	tyrosine-type recombinase/integrase	A0A077KET4	Ralstonia_phage	4.6e-90	44.8
WP_152390216.1\|228164_228368_-	hypothetical protein	NA	NA	NA	NA
WP_152390217.1\|228428_228626_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152390218.1\|228792_229074_-	hypothetical protein	NA	NA	NA	NA
WP_152390219.1\|229682_230888_-	3-oxoadipyl-CoA thiolase	NA	NA	NA	NA
WP_152390220.1\|230906_231566_-	phospholipase	NA	NA	NA	NA
WP_152390221.1\|231631_232228_+	hypothetical protein	NA	NA	NA	NA
WP_152390289.1\|232363_233419_-	phosphotransferase	NA	NA	NA	NA
WP_152390222.1\|233926_235339_-	hypothetical protein	NA	NA	NA	NA
WP_152390223.1\|235785_236553_-	DUF485 domain-containing protein	NA	NA	NA	NA
WP_152390224.1\|236607_238266_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	1.6e-37	27.7
WP_152390225.1\|238473_239253_-	glucose 1-dehydrogenase	A0A0N9R355	Chrysochromulina_ericina_virus	1.9e-12	23.7
WP_152390226.1\|239252_240425_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_152390227.1\|240691_241087_-	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_152390289.1\|241083_242139_-	phosphotransferase	NA	NA	NA	NA
WP_152390228.1\|243861_244122_-\|transposase	transposase	A0A0N9SJT9	Paenibacillus_phage	4.0e-20	54.1
WP_152385914.1\|244176_245217_+\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	8.9e-10	29.1
WP_152390229.1\|245170_245722_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_152386009.1\|245842_246940_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152390230.1\|247467_248292_+	alpha/beta fold hydrolase	A0A249XU20	Mycobacterium_phage	3.0e-08	26.5
WP_152390290.1\|248364_248943_+	isochorismatase family protein	A0A1V0SL12	Klosneuvirus	1.1e-06	22.6
WP_152390231.1\|249022_249643_+	isochorismatase family protein	NA	NA	NA	NA
WP_152390232.1\|249728_250784_+	aldo/keto reductase	NA	NA	NA	NA
WP_152390233.1\|250841_251942_+	N-ethylmaleimide reductase	NA	NA	NA	NA
WP_152390234.1\|252402_253617_-	hypothetical protein	NA	NA	NA	NA
WP_152390235.1\|253653_253947_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_152390236.1\|253960_254755_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_152390237.1\|254842_255556_-	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_091014019.1\|255654_256590_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_089170148.1\|256625_256724_-	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_152390238.1\|256759_257083_-\|transposase	transposase	NA	NA	NA	NA
WP_167520133.1\|257462_258494_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_152390291.1\|259541_259730_+	addiction module toxin, HicA family	A0A0U4KLG1	Pseudomonas_phage	6.5e-20	77.4
WP_040107336.1\|259761_260166_+	type II toxin-antitoxin system HicB family antitoxin	A0A0U4ISP5	Pseudomonas_phage	3.1e-51	72.4
WP_152390240.1\|261933_262542_+	cupin	NA	NA	NA	NA
WP_152390241.1\|262631_263906_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_152390242.1\|264070_265417_-	c-type cytochrome	NA	NA	NA	NA
WP_040107339.1\|265428_267204_-	GMC family oxidoreductase	NA	NA	NA	NA
WP_040107340.1\|267206_267917_-	gluconate 2-dehydrogenase subunit 3 family protein	NA	NA	NA	NA
WP_089169988.1\|270035_270335_+	HigA family addiction module antidote protein	NA	NA	NA	NA
WP_152390243.1\|270400_273097_-	hypothetical protein	NA	NA	NA	NA
WP_152390244.1\|273340_274432_-	hypothetical protein	NA	NA	NA	NA
WP_152390245.1\|274714_274945_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_152390246.1\|274944_275379_+\|tRNA	tRNA(fMet)-specific endonuclease VapC	NA	NA	NA	NA
WP_152390247.1\|275391_276338_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	3.2e-06	22.2
276138:276155	attR	NA	NA	NA	NA
WP_152390249.1\|277475_277877_-	biopolymer transporter ExbD	NA	NA	NA	NA
WP_152390250.1\|277878_278589_-	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_152390251.1\|278639_279485_-	TonB family protein	NA	NA	NA	NA
WP_167520129.1\|279573_280503_-	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152390253.1\|280505_281549_-	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_152390254.1\|281574_282903_-	NtaA/DmoA family FMN-dependent monooxygenase	NA	NA	NA	NA
WP_152390255.1\|282977_285371_-	TonB-dependent receptor	NA	NA	NA	NA
WP_152390256.1\|285452_286496_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152390258.1\|287363_287648_+	hypothetical protein	A0A0U4J920	Pseudomonas_phage	3.2e-18	56.1
WP_152385958.1\|287780_288761_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152388121.1\|288959_289997_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.4e-41	30.3
WP_152390259.1\|290030_291065_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152390260.1\|291051_291864_+	toxin HipA	NA	NA	NA	NA
WP_152386438.1\|293862_294621_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.4e-22	45.0
WP_152390261.1\|294816_295272_+	excisionase family DNA-binding protein	K4ICM4	Acidithiobacillus_phage	3.5e-35	51.4
WP_152390293.1\|295312_295774_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	1.9e-49	62.9
WP_152390051.1\|296607_298977_-	DEAD/DEAH box helicase family protein	A0A2K9R7J3	Dishui_lake_phycodnavirus	2.6e-33	29.8
WP_152390050.1\|298969_299515_-	hypothetical protein	NA	NA	NA	NA
WP_167520130.1\|300512_301868_+	DUF4143 domain-containing protein	NA	NA	NA	NA
WP_152390263.1\|302446_303508_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	2.3e-29	35.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045302

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045302_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045302_1

4673420-4673554

Orphan

Consensus_repeat	Method
TGGATGGCCGAAGCCATCCACCATGGTGGACAAGCCTGCGGCGTTGTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045302_1

>merge|NZ_CP045302|1|4673420-4673554|CRISPRCasFinder
TGGATGGCCGAAGCCATCCACCATGGTGGACAAGCCTGCGGCGTTGTCCACCCTACGAAACTGCGGGGATGGATGTAGCAGTAGGGTGGATGGCCGAAGCCATCCACCATGGCGGACAAGCCTGCGGCGTTGTCC

>NZ_CP045302|1|1|4673420-4673554|CRISPRCasFinder
TGGATGGCCGAAGCCATCCACCATGGTGGACAAGCCTGCGGCGTTGTCC	ACCCTACGAAACTGCGGGGATGGATGTAGCAGTAGGG
TGGATGGCCGAAGCCATCCACCATGGCGGACAAGCCTGCGGCGTTGTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045302.1\|WP_152389502.1\|4674730_4675351_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|182533
NZ_CP045302.1\|WP_152389503.1\|4675404_4676352_-\|TauD/TfdA-family-dioxygenase	unknown	unknown	gnl\|CDD\|181947
NZ_CP045302.1\|WP_152389504.1\|4676414_4677776_-\|NtaA/DmoA-family-FMN-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|274819
NZ_CP045302.1\|WP_152390019.1\|4672372_4673395_+\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225114
NZ_CP045302.1\|WP_152389505.1\|4678189_4679269_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270273
NZ_CP045302.1\|WP_152389500.1\|4672000_4672231_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045302.1\|WP_152389509.1\|4684292_4685366_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270273
NZ_CP045302.1\|WP_152389497.1\|4668269_4669718_-\|xanthine-dehydrogenase-small-subunit	unknown	unknown	gnl\|CDD\|274365
NZ_CP045302.1\|WP_152390020.1\|4679505_4680153_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045302.1\|WP_152389494.1\|4662005_4663520_+\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341286
NZ_CP045302.1\|WP_152389499.1\|4671040_4671955_-\|TauD/TfdA-family-dioxygenase	unknown	unknown	gnl\|CDD\|225086
NZ_CP045302.1\|WP_152389506.1\|4680215_4681484_-\|outer-membrane-porin,-OprD-family	unknown	unknown	gnl\|CDD\|335381
NZ_CP045302.1\|WP_152389495.1\|4664947_4665790_-\|xanthine-dehydrogenase-accessory-protein-XdhC	unknown	unknown	gnl\|CDD\|274366
NZ_CP045302.1\|WP_152389496.1\|4665883_4668277_-\|xanthine-dehydrogenase-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|274367
NZ_CP045302.1\|WP_152389507.1\|4681696_4683049_-\|permease-DsdX	unknown	unknown	gnl\|CDD\|308194
NZ_CP045302.1\|WP_152390018.1\|4663514_4664813_-\|guanine-deaminase	unknown	unknown	gnl\|CDD\|236419
NZ_CP045302.1\|WP_152389501.1\|4673576_4674617_-\|NADP(H)-dependent-aldo-keto-reductase	unknown	unknown	gnl\|CDD\|381320
NZ_CP045302.1\|WP_152389508.1\|4683132_4683657_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|225804
NZ_CP045302.1\|WP_152389498.1\|4669851_4670799_-\|adenosine-deaminase	unknown	unknown	gnl\|CDD\|236480
NZ_CP045302.1\|WP_152389493.1\|4660824_4662003_+\|thiolase-domain-containing-protein	unknown	unknown	gnl\|CDD\|181013

Protein	Function_ID	Function_description	E-value
NZ_CP045302.1\|WP_152389502.1\|4674730_4675351_-\|glutathione-S-transferase	gnl\|CDD\|182533	PRK10542, PRK10542, glutathionine S-transferase; Provisional.	7.73555e-48
NZ_CP045302.1\|WP_152389503.1\|4675404_4676352_-\|TauD/TfdA-family-dioxygenase	gnl\|CDD\|181947	PRK09553, tauD, taurine dioxygenase; Reviewed.	1.33072e-83
NZ_CP045302.1\|WP_152389504.1\|4676414_4677776_-\|NtaA/DmoA-family-FMN-dependent-monooxygenase	gnl\|CDD\|274819	TIGR03860, FMN_nitrolo, FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family. This model represents a distinctive clade, in which all characterized members are FMN-binding, within the larger family of luciferase-like monooxygenases (LLM), among which there are both FMN- and F420-binding enzymes. A well-characterized member is nitrilotriacetate monooxygenase from Aminobacter aminovorans (Chelatobacter heintzii), where nitrilotriacetate is a chelating agent used in detergents. [Unknown function, Enzymes of unknown specificity].	0
NZ_CP045302.1\|WP_152390019.1\|4672372_4673395_+\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|225114	COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms].	6.58377e-129
NZ_CP045302.1\|WP_152389505.1\|4678189_4679269_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270273	cd13555, PBP2_sulfate_ester_like, Sulfate ester binding protein-like, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	4.33927e-103
NZ_CP045302.1\|WP_152389507.1\|4681696_4683049_-\|permease-DsdX	gnl\|CDD\|308194	pfam02447, GntP_permease, GntP family permease. This is a family of integral membrane permeases that are involved in gluconate uptake. E. coli contains several members of this family including GntU, a low affinity transporter, and GntT, a high affinity transporter.	6.11423e-180
NZ_CP045302.1\|WP_152389509.1\|4684292_4685366_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270273	cd13555, PBP2_sulfate_ester_like, Sulfate ester binding protein-like, the type 2 periplasmic binding protein fold. This subfamily includes the periplasmic component of putative ABC-type sulfonate transport system similar to SsuA. These domains are found in eubacterial SsuA proteins that serve as initial receptors in the ABC transport of bicarbonate, nitrate, taurine, or a wide range of aliphatic sulfonates, while other closest homologs are involved in thiamine (vitamin B1) biosynthetic pathway and desulfurization (DszB). After binding the ligand, SsuA interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The SsuA proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	8.20464e-105
NZ_CP045302.1\|WP_152389497.1\|4668269_4669718_-\|xanthine-dehydrogenase-small-subunit	gnl\|CDD\|274365	TIGR02963, Includes:_Xanthine_dehydrogenase, xanthine dehydrogenase, small subunit. Members of this protein family are the small subunit (or, in eukaryotes, the N-terminal domain) of xanthine dehydrogenase, an enzyme of purine catabolism via urate. The small subunit contains both an FAD and a 2Fe-2S cofactor. Aldehyde oxidase (retinal oxidase) appears to have arisen as a neofunctionalization among xanthine dehydrogenases in eukaryotes and [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_CP045302.1\|WP_152389494.1\|4662005_4663520_+\|AMP-binding-protein	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	1.54291e-154
NZ_CP045302.1\|WP_152389499.1\|4671040_4671955_-\|TauD/TfdA-family-dioxygenase	gnl\|CDD\|225086	COG2175, TauD, Probable taurine catabolism dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism].	1.01246e-87
NZ_CP045302.1\|WP_152389506.1\|4680215_4681484_-\|outer-membrane-porin,-OprD-family	gnl\|CDD\|335381	pfam03573, OprD, outer membrane porin, OprD family. This family includes outer membrane proteins related to OprD. OprD has been described as a serine type peptidase. However the proposed catalytic residues are not conserved suggesting that many of these proteins are not peptidases.	0
NZ_CP045302.1\|WP_152389495.1\|4664947_4665790_-\|xanthine-dehydrogenase-accessory-protein-XdhC	gnl\|CDD\|274366	TIGR02964, conserved_hypothetical_protein, xanthine dehydrogenase accessory protein XdhC. Members of this protein family are the accessory protein XdhC for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB, in bacteria. This protein is not part of the mature xanthine dehydrogenase. Xanthine dehydrogenase is an enzyme for purine catabolism, from other purines to xanthine to urate to further breakdown products. [Protein fate, Protein folding and stabilization, Purines, pyrimidines, nucleosides, and nucleotides, Other].	7.06093e-123
NZ_CP045302.1\|WP_152389496.1\|4665883_4668277_-\|xanthine-dehydrogenase-molybdopterin-binding-subunit	gnl\|CDD\|274367	TIGR02965, xanthine_dehydrogenase, xanthine dehydrogenase, molybdopterin binding subunit. Members of the protein family are the molybdopterin-containing large subunit (or, in, eukaryotes, the molybdopterin-binding domain) of xanthine dehydrogenase, and enzyme that reduces the purine pool by catabolizing xanthine to urate. This model is based primarily on bacterial sequences; it does not manage to include all eukaryotic xanthine dehydrogenases and thereby discriminate them from the closely related enzyme aldehyde dehydrogenase. [Purines, pyrimidines, nucleosides, and nucleotides, Other].	0
NZ_CP045302.1\|WP_152390018.1\|4663514_4664813_-\|guanine-deaminase	gnl\|CDD\|236419	PRK09228, PRK09228, guanine deaminase; Provisional.	0
NZ_CP045302.1\|WP_152389501.1\|4673576_4674617_-\|NADP(H)-dependent-aldo-keto-reductase	gnl\|CDD\|381320	cd19094, AKR_Tas-like, Escherichia coli Tas protein and similar proteins. Escherichia coli Tas protein is the prototype of this family. It is an NADP(H)-dependent aldo-keto reductase that catalyzes the reversible reduction of ketones to the respective alcohols using NADP(H) as a hydride donor.	0
NZ_CP045302.1\|WP_152389508.1\|4683132_4683657_-\|AAA-family-ATPase	gnl\|CDD\|225804	COG3265, GntK, Gluconate kinase [Carbohydrate transport and metabolism].	9.92578e-74
NZ_CP045302.1\|WP_152389498.1\|4669851_4670799_-\|adenosine-deaminase	gnl\|CDD\|236480	PRK09358, PRK09358, adenosine deaminase; Provisional.	3.87704e-164
NZ_CP045302.1\|WP_152389493.1\|4660824_4662003_+\|thiolase-domain-containing-protein	gnl\|CDD\|181013	PRK07516, PRK07516, thiolase domain-containing protein.	0

>NZ_CP045302.1|WP_152390019.1|4672372_4673395_+|sigma-54-interacting-transcriptional-regulator
MEIRAKALLFADARSQQLLAQAELVADSPVPVLIQGETGTGKELLARHLHQRSGRKGPFVAVNGAAINESLAESEFFGHEAGAFTGAVGRREGWFEAANGGTLFLDEIGDLPLALQVKLLRVLQEREVVRVGGRKPIPIDVRLITATHVDLQSAIAAGRFREDLFYRLNIVTLAIPPLRDRPGDILPLARHFLGQFAREHAREEPALTPAAVECLLGHSWPGNIRELENVLLSAALMAGGQPIGARHLQLRPRSTPPAAPAEEAPVDPLWQGIRKQLGELLDRGDDGLLARWESLLLETTLQRHRYNQVHSADRLGISRHALRTLLKRYDLLPETRAPRV
>NZ_CP045302.1|WP_152389500.1|4672000_4672231_+|hypothetical-protein
MVESARRVASGRSFGGRWPRRSRPRQEQKACQCSKSCYFAAFDRFMAAGLLDFAQLAQKAGAYPAAGTCIPADGFM
>NZ_CP045302.1|WP_152389499.1|4671040_4671955_-|TauD/TfdA-family-dioxygenase
MSLDIRPVTGRIGAIVSGVRLTDLDDAQFAELQQAVLEHKVLFLRNQHLTDAEQEAFGRRFGELVVHPTVHTAENTAGILDVDSERSRANSWHSDITFVVDYPKITILRGEVIPEAGGDTVFANAVSAYQDLPEPLQRLADSLWVRHTNDYDYAAPKQIEVAANKRFREQFTSTVYESEHPLVRVHPETGEKALVLGHFAQKIVGLNSRDSRALLDLFQAHTVRLENIVRWRWSEGDVALWDNRATQHIAVDDYGSARRIVRRTTVLGEIPVSVGGESSRAIKPSPESRIPRSEADKAALKKAG
>NZ_CP045302.1|WP_152389498.1|4669851_4670799_-|adenosine-deaminase
MYAWLNALPKAELHLHLEGSLEPELLFALAERNKIALPWPDVESLRKAYAFHNLQEFLDLYYQGANVLRTEQDFYDLTWAYLQRCKEQNVVHTEPFFDPQTHTDRGISFETVLSGIGQALEDGRRQLGISSGLILSFLRHLSEEEAHKTLDQALPFRHAFIAVGLDSSEVGHPPRKFRQVFERARAEGFATVAHAGEEGPPEYIWEALDLLKVKRIDHGVRAAEDPRLLERLIDEQIPLTVCPLSNVKLRVFKDMAEHNILRLLEMGVKVTVNSDDPAYFGGYVTENFVALQESLGMTCEQAERLAQNSLDARLV
>NZ_CP045302.1|WP_152389497.1|4668269_4669718_-|xanthine-dehydrogenase-small-subunit
MIQFLLNRELRSERALDPNLTVLRYLREHLHRTGTKEGCASGDCGACTVVVGELVDEGGRERLRYRSLNACLTFVAALHGKQLLTVEDLRHQGQLHSVQQAVVDQHASQCGFCTPGVVMSLFALQKNAGGPDRDEACTALAGNLCRCTGYRPILAAAEQACSAAPPDQFDAAEAEIVAALKAIARDGTELADGDRRCLLPASVAELAALYAAHPEARLFAGGTDLALEVTQQHRALPLTIHLGRIEELKRVTVGNEAIEIGAATPLTDCYAALAAEYPDFGALLARFASLQIRNQGTLGGNIGNASPIGDAPPLLIALGARLLLRKGEASRSLALEDFFLDYRVTALEPGEFIEKILVPRARPGQAFRAYKLSKRLDDDISAVCAAFNLQIEDGRVRGARIAFGGMAATSRRAAACEQALLGQPFDAAAIERACAALAGDFAPLSDFRASREYRLLAAQNLLRKAFLELHTPALPTRVTDHV
>NZ_CP045302.1|WP_152389496.1|4665883_4668277_-|xanthine-dehydrogenase-molybdopterin-binding-subunit
MSNLTPHTQEELAALFRAELVSGVGRSVRHESAAKHVTGEALYVDDRLEFPNQLHVYARLSERAHARILRIDTAPCYAVPGVAIAITSADVPGKLDIGPVFPGDPLLADGTVQYLGQPVLAVAADSLENARRAALAAVIEYEDLEPVLTVDEALRRQQFVLDSHSHRRGDAAAALASAPHRLAGSLRIGGQEHFYLETQIAAVLPTEDGGMLVHSSTQHPTEVQKLVAEVLGVPMNKVEVDMRRMGGGFGGKETQAAAPACLCAVIARLTGRPTKMRLPRNEDMRITGKRHPFQLEYEVGFDDDGRLHGVHIQLAANCGYSPDLSGAIVDRAMFHADNAYYLGEALIDGHRCKTNLASNTAFRGFGGPQGMLAIEEIMDAIARRLGKDPLAVRKLNYYGKSERNVTHYHQTVEHNLLEEMTAELEASCDYAARREEIRAFNAQSPVLKKGLALTPVKFGISFTSSFLNQAGALVHVYTDGSIHLNHGGTEMGQGLNTKVAQVVAEVFQVDIARIQISPTNTGKVPNTSPTAASSGADLNGKAAKEAAQTIKQRLVEFAARHWQVGEEDVQFRNGQVRIRDRYLSFEELIQAAYVGQVSLSSTGFYRTPKIYYDRAQARGRPFYYYAFGMACAEVLVDTLTGEYRLLRADILHDVGASLNPAIDIGQVEGGFVQGMGWLTSEELVWDDKGRLLTAGPASYKIPTVADVPADLRVKLVENRRNPEDTVFHSKAVGEPPFMLGISVWCAIKDAVASLADYRLQPAIDAPATPERVLWGVEQMKRLQQPQGAVHEHTGEST
>NZ_CP045302.1|WP_152389495.1|4664947_4665790_-|xanthine-dehydrogenase-accessory-protein-XdhC
MSNMSWIDALADLKQRGEPCVLVTIVEEQGSTPRNAGAKMVVERERLHDTIGGGHLEFKALQIAREMLESRSQAARLERFALGASLGQCCGGATVLLFEPLGQPQARIALFGAGHVGRALAPLLAGLPCRLRWIDARAQEFPDPVPAGVEQVVNDEVLVEVERMPAGSYFIVMTHDHQLDLQLAEAILKRNDFAYFGLIGSKSKRARFEHRLHERGLAAEVVQRMRCPMGLPEVKGKLPLEIAISIAGEVIATYNARFGEESQGGERIARLLPASRRSPA
>NZ_CP045302.1|WP_152390018.1|4663514_4664813_-|guanine-deaminase
MHAYRAALLHCLADPRVVGIERSCQYFEDGLLLVEDGKVAQIGDAASLLPTLPAGVEVVEYHDALILPGFVDTHIHYPQLDVIASYGTQLLEWLETYTFPAEARFADPAHARAQARLFLAELLRNGTTTALVFATVHPQSVDAFFEEASRLDLRMIAGKVLMDRNAPDDLRDDAASGYDESKTLIERWHGKGRLHYAVTPRFAPTSTPEQLELAGRLLREYPGLYLHTHLSENRAEIEWVKELFPERKHYLDVYDHHRLLGARSVFAHGIHLCDDECWRLGASGSAVAFCPTSNLFLGSGLFDLARLEGHGVRVGLGTDVGGGTSFSQLQSLNEAYKVLQLQGQQLDPFKALYLATLGGARALYLDEQIGNLQPGKDADFVVLDYKATPLLARRLEQARSLEEKLFALMILGDDRAVRETFAAGRSVHRRGS
>NZ_CP045302.1|WP_152389494.1|4662005_4663520_+|AMP-binding-protein
MNLANWLNDAARRWPERPALYEGERPVANYRTFAASAGALATALRDDYDIAPGEHVALFMKNCCEYLELLYAIWWAGAVAVPINCKLHRSEAAWIADDAQARLIFTDDGSLFAEGELPAQCRELAGRGSTIERLKQAAPLWAGPTRRSPDDLAWLFYTSGTTGRSKGVMLSHGNLTAMSLCYPVDVDPVSADDACVYAAPMSHGAGLYNFIHVRCGARHVIPASRGFDAAELFGLARRLGQLTLFAAPTMVKRMVEEARRQGYDGDGIKSIVYGGAPMYLADLQEAVATFGPRLIQIYGQGESPMTITALSRELIADRARSDWQRLAFSVGYAQSCVEVCVVDGSRHPLPPGQPGEVVVRGPSVMQGYWRNEAATGATLVDGWLYTGDIGYLDQDGLLTLTDRSKDVIISGGSNIYPREVEEVLALHPAISEVSVVGEPDPDWGERVVAFVVLRPGEQASAQALNAWFIERMASFKKPKRYLFSQELPKNSYGKTLKSELRRCL
>NZ_CP045302.1|WP_152389493.1|4660824_4662003_+|thiolase-domain-containing-protein
MITDSVSIVASGHTRFGRLEGRTLEDLIVEATREALEEAAVDAAEIDAVFLGHFNSGMVADGFPASLALQADPALRFKPASRCENACASGSAAIRAGICAIRSGAAELVLVVGAEKMTSNSTSVVTRALAGAGYQNDPQEAALSFPQQFGMAARQYGERYRDPLGAMAAIAVKNHGNAMSNPLAQMHREMSLEHCNTVSESNPLIAPPLRLTDCSLISDGAAAIVLASTKRARQFRRSVAIRAMAQVNDFLPLSRRDFLAFEGPQRAIRSALEHAGVTLADLHFAEVHDCFTIAELMIYEAMGLAPKGEGFRALEDGTVLADGRLPVNLSGGLKAKGHPVGATGVSMHAMAFRQLTGKPMGIALQQPEFGLVFNMGGMAVANYASVLQAERA
>NZ_CP045302.1|WP_152389501.1|4673576_4674617_-|NADP(H)-dependent-aldo-keto-reductase
MLYRPLGRTDLQVSALALGSMTWGEQNSEAEGFEQIRRAQAAGINFIDTAEMYPVPPKAETAGATETIIGNYFKRHGGRGDWILATKAAPPGNGISHIRGGRNHFDRANLTAAVDASLARLQTDYIDLYQLHWPDRQTNFFGQLGYRHDPDAHITPIEETLEVLDGLVKNGKIRHIGLSNETPWGVHRFLHLAETRGWPRVVSIQNPYNLLNRSFEVGLAEIAIREQVGLLAYSPLAFGLLSGKYENGAQPPKARLTLFERFQRYNNPQARRAASAYIALAREHGVDPAQLALAYVTSRPFLTSNIIGATTLEQLDSNIASLELKPSDELLAGIERIHTEQPNPAP
>NZ_CP045302.1|WP_152389502.1|4674730_4675351_-|glutathione-S-transferase
MTVLYIAPGACSLAAHSLIHELDLPIRIESVALRTPDSPIHAVNPLGRVPALRLDDGSVLTENSALLPYLADLRPEAGLFAPAGSRERAQIQSWIGYLTSEVHVGGFRPLNRPERYSADEGAHPGIRVQATEQLHQALAHIERQLNGRQWLVGERYTIADAYLGVFAGWLPRLGERFGDLAQIARIGAAFRARPAVRQALATEGLL
>NZ_CP045302.1|WP_152389503.1|4675404_4676352_-|TauD/TfdA-family-dioxygenase
MPSSARSQQAALPAAEAIVVTPLSLHIGAQIDGVDLSRPLPSAQREAIRAALLRWKVLFFHDQHLDHAQQVAFGRQFGELTVGHPVFGHVEGYPEIYSVGRDRFKARFTDERLVRPWSGWHTDVSAAVNPPAAAILRGVDIPPYGGDTQWTDLVAAYNGLSPTLRAFVHGLRGEHRFTPPEGAEARPGFSEPLAARPLVSEHPLVRVHPETGEKALFVSPAFLKRIVGLSPRESEQLLELLFEHAIRPEYSVRFKWRPGSLAFWDNRVTAHQPPTDIHATDLPRQLYRITLVGDIPVGPDGRPSRAIAGEPVLAA
>NZ_CP045302.1|WP_152389504.1|4676414_4677776_-|NtaA/DmoA-family-FMN-dependent-monooxygenase
MSKRQLALNAFILPTGHHIAAWRRADVPEHANHDFGEYVRVARLAEAAKFDALFVSDSVAVNAGNGGSGLEELALTARGTRLEPFTLLSALAAVTERIGLIATVSTTYNEPYHLARKFASLDWISRGRAGWNLVTSSAPAEALNFSQSELPEHGERYRRAEEFLDVAQGLWDSWEDDAFARDKASGQFFDPAKLHVLNHQGEHYRVRGPLNVARPPQGYPVLVQAGSSEPGREIAARSAEAIFTAHQTLESAQAFYADVKGRLAKYGRAPEELKILPGIFPVVGRSEAEAQAKYRELQELIDPRVGVNLLSALIGSDLSGFDVDGPLPELAATNQNKSRQALLLELAHRENLTIRELYLRIAGARGHWTVVGTPVQIADQIQSWFEQGAADGFNVLAPWLPGGLEEFIELVVPELRRRGLFREEYRGSTLREHLGLARPENRHAAGRDQRAAS
>NZ_CP045302.1|WP_152389505.1|4678189_4679269_+|ABC-transporter-substrate-binding-protein
MKKNHPLASLLPGLLSAALLLAPLPLSAAESVTIRFGVAQVGKGGVPFSSGGVAGLADQRKAIQQELEGSDVRVEWFYFKGAGPAVNEALANRQLDFAVQGDLPAVVAKAGGLDTRLITADNLLTSTYLVVPADSPARSLADLKGKRVALFKGTNLHLAILRALKQQGLGERDFRTLNMDFATMAAALTSKNIDGAWFDARAFDLQASGVGRILYDTRAVDPRLTRQGHVLVRGEFEREHPELVQKVVTALVKTAAWASDPANREAVLALWANSGTPVEALRAEQEGQSFQRRYSPLLDEFFVERYRTTVQESRELGLIRGDVDVARWIEPKYVQAAIEQLDLQKLWPAHDAGNRPVVR
>NZ_CP045302.1|WP_152390020.1|4679505_4680153_+|hypothetical-protein
MGDCTILAADRATFYVGAGISIPSAHLERKIAGNRHGYITAAGFVELIRPVKERFVAEAPGSLEAVMRLIADEQERFRRRNYLKAVVESRVKSCSWTLTLADGEKSVLAAVYDYAGDGLLALAKGHSIFNYPSDVAEHEKRHVESMAAEFSFGCRGEGASLQDIRHNMSQILSIAGYLRGRGRCLTSQIDFAVHAVGWRREVDSGQFLEKGLSLR
>NZ_CP045302.1|WP_152389506.1|4680215_4681484_-|outer-membrane-porin,-OprD-family
MKNSNRPSLLDCPRTLVLPLLLAGFLPTAQAAFVDDAKGTLTLRNFYIHRNFVDDGATRSKAEEWTQSFILDLQSGYTEGPVGFGLDVLGLWSVKLDGGQGTGGTQLLPVGKDGDPADQFGRLAVAGKLRFSKTEAKAGEWSPALPILRSDDGRSLPQTFQGGMLTSKEIRNLTVYGGRFRGNSPRDDSSLNDMSWVGNSSVTSDRFSFAGAEYAFNDNRTLVGAWFGQLEDIYKQRYFQLTHTQPLGKDWALGANIGYFDGEEDGSAQAGELDNTLLSGLFSLKHGAHVFYLGLQRVTGDDKWLRVNGTSGGTAANDSYNGSFDNARERSWQVRYDYDFAALGIPGLTLMTRYIKGTNVHAGAIDDGEEWNRETQLSYVVQSGPLKALSLRWRNSTIRRDWGANNKFDDNRLIVQYPLSLF
>NZ_CP045302.1|WP_152389507.1|4681696_4683049_-|permease-DsdX
MPGLSHTTLLLLDALIAIVGLIVLITRFKLHPFLALIISALFLGLTSGMPVDQVIKAFQDGFGGVLGFVGIILALGTMLGKMMAESGGADQIARTLIQAFGKERVQWSMMFAAFLVGIPLFFEIGFVLLIPLVFIVARRTGVSLIRIGIPLLAGLSAVHGLVPPHPGPLLAIGVFGADIGKTILYGLIVALPTAIIAGPLFASFIARRVPGTPSPELMEQLAHESEAGNLPSFSVTLVTVLLPVFLMLLKTFADVALAEGHIVRAWMDLIGHPISALLLALLLSLYTFGYARGFAPKRVFKLLEESLAPTAAIVMIIGAGGGFKQMLVTSGVGNVIGQMAVNAQVSPILLAWLVAALIRIATGSATVATITGAGIVVPVIEMMPGVNRELLVLATGAGSLILSHVNDAGFWMVKQYFNMSVSETFKTWTAMETLLSVVGLVFILLLSLVV
>NZ_CP045302.1|WP_152389508.1|4683132_4683657_-|AAA-family-ATPase
MLPPIHALVIMGVAGCGKSSVGHALCQFNGAMPIEGDAFHPPENIRKMSAGIPLTDEDRDGWLGILCDELRHAIAAGRRPVLSCSALKRSYRERLRSAVPGLGFVYLELSPAVAARRVAERPGHFMPASMIDSQFATLEPPQGEPLTLVLDAAREDIRQLATAAADWWRRHRPD
>NZ_CP045302.1|WP_152389509.1|4684292_4685366_+|ABC-transporter-substrate-binding-protein
MKRTLLLPLIAALAGTWLGTAPAGAADNPQVIRFGLATVGKGGIPFASSSVTSLAHQRQAIEKELETDGIKVEWTYFKGAGPAVNEALANKQLDFAWQGDLPAVIAKAGGLNTKLIAADGLLASNYLVVPVDSPARTLEDLKGKKVAQFKGTNLQLATARTLKRAGLQDRDFRTINMDFPTAAAALASRDIDGAWLSSTAFELQKNGVGRIIYDTRAVDARLTRQTHVLVDGDFERQHPQIVQKVVDGLVKTAAWVSAPENDNAAFELWAKSGTPVDSLRAEQGELSLKRRYSPRLDEFFVDRYRATVRESRELGLLRGDVDVDGWIEPRYVNAAIDRLGLQTLWPAYDADNRPQAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8503

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385844.1\|125_797_+	DUF2313 domain-containing protein	A0A2P9JZK7	Alteromonadaceae_phage	5.0e-46	48.7
WP_152385845.1\|793_2659_+	hypothetical protein	A0A2H4P7F7	Pseudomonas_phage	8.3e-107	48.6
WP_152385846.1\|2604_3204_+	hypothetical protein	A0A2H4P7F7	Pseudomonas_phage	1.0e-21	40.6
WP_152385847.1\|3203_3638_+	hypothetical protein	NA	NA	NA	NA
WP_152385848.1\|3714_4827_+	hypothetical protein	A0A0F6R4X0	Sinorhizobium_phage	5.8e-23	53.1
WP_152385849.1\|4856_5387_+	hypothetical protein	Q8HAB4	Salmonella_phage	7.5e-05	38.6
WP_152389731.1\|5559_5763_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	1.2e-16	70.0
WP_152385850.1\|5841_6549_+	hypothetical protein	NA	NA	NA	NA
WP_152385851.1\|6621_7110_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	1.6e-46	62.2
WP_152385852.1\|7106_7550_+	hypothetical protein	NA	NA	NA	NA
WP_152385853.1\|7708_8503_+	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	1.2e-99	65.8

DBSCAN-SWA_2

17179 : 18175

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385865.1\|17179_18175_+	flagellar assembly peptidoglycan hydrolase FlgJ	A0A0A7RU71	Clostridium_phage	4.7e-16	37.5

DBSCAN-SWA_3

44629 : 54662

uncultured_Caudovirales_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385891.1\|44629_46270_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.8e-11	51.1
WP_167520102.1\|46360_48106_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.0e-17	30.6
WP_152385892.1\|48171_49881_+	PAS domain S-box protein	A0A1B0V854	Salmonella_phage	7.0e-36	54.0
WP_152385893.1\|49877_50741_+	chemotaxis protein CheR	NA	NA	NA	NA
WP_152385894.1\|50843_51905_+	chemotaxis-specific protein-glutamate methyltransferase CheB	NA	NA	NA	NA
WP_152385895.1\|52432_54160_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.8e-06	78.4
WP_152385896.1\|54272_54662_+	chemotaxis protein CheY	Q56AR1	Bacillus_thuringiensis_phage	2.4e-08	30.8

DBSCAN-SWA_4

65853 : 66141

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385905.1\|65853_66141_+	XRE family transcriptional regulator	A0A2D1GR59	Pseudomonas_phage	2.5e-10	43.5

DBSCAN-SWA_5

81511 : 87446

Bodo_saltans_virus(33.33%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167520104.1\|81511_82534_+\|protease	protease SohB	A0A2H4UUF9	Bodo_saltans_virus	2.5e-20	32.7
WP_152385914.1\|82556_83597_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1
WP_152385915.1\|83687_84185_-	DUF934 domain-containing protein	NA	NA	NA	NA
WP_152385916.1\|84168_85827_-	nitrite/sulfite reductase	NA	NA	NA	NA
WP_152385917.1\|86047_86269_-	DUF2970 domain-containing protein	NA	NA	NA	NA
WP_152385918.1\|86282_87446_-	cyclopropane fatty acyl phospholipid synthase	A0A2K9L4K8	Tupanvirus	6.2e-76	42.7

DBSCAN-SWA_6

102765 : 108057

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385926.1\|102765_104235_+	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	2.7e-76	35.4
WP_167520008.1\|104383_105073_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_152385927.1\|105144_106590_+	pyruvate kinase	NA	NA	NA	NA
WP_167520009.1\|106604_106751_+	hypothetical protein	NA	NA	NA	NA
WP_152385928.1\|106743_108057_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	2.1e-128	59.2

DBSCAN-SWA_7

112109 : 114059

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385931.1\|112109_114059_+	DNA topoisomerase 3	A0A1X9I6W8	Streptococcus_phage	2.9e-30	29.7

DBSCAN-SWA_8

117620 : 261244

Escherichia_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385934.1\|117620_118289_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.7e-28	36.9
WP_152385935.1\|118760_119768_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_152385936.1\|119858_120278_+	hypothetical protein	NA	NA	NA	NA
WP_152385937.1\|120507_121563_+	esterase	NA	NA	NA	NA
WP_152385938.1\|121559_122501_+	acetoacetate decarboxylase	NA	NA	NA	NA
WP_152389739.1\|122510_124115_+	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_152385939.1\|124116_125841_+	GMC family oxidoreductase	NA	NA	NA	NA
WP_152385940.1\|125985_127479_+	hypothetical protein	NA	NA	NA	NA
WP_152385941.1\|127481_129452_+	CHAT domain-containing protein	NA	NA	NA	NA
WP_152385942.1\|129696_131781_-	RNA helicase	A0A248SJQ0	Salicola_phage	6.7e-57	37.3
WP_152385943.1\|132086_134009_-	hypothetical protein	NA	NA	NA	NA
WP_152385944.1\|134174_135548_-	DUF3412 domain-containing protein	NA	NA	NA	NA
WP_152385945.1\|136152_136761_+	cell wall hydrolase	M1F286	Cronobacter_phage	5.6e-12	32.6
WP_152385946.1\|136825_137227_-	hypothetical protein	NA	NA	NA	NA
WP_152385947.1\|137389_138508_-	hypothetical protein	NA	NA	NA	NA
WP_167520011.1\|139301_143213_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.8e-55	27.0
WP_152385949.1\|143288_144530_+	NAD(P)-binding domain-containing protein	NA	NA	NA	NA
WP_152385950.1\|144533_145643_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_152385951.1\|145639_147211_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_152385952.1\|147210_148653_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_152385953.1\|148738_149458_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_152385954.1\|149702_149891_-	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_152385955.1\|150573_151398_+	inositol monophosphatase	NA	NA	NA	NA
WP_152385956.1\|151560_152580_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152389740.1\|152907_153135_-	hypothetical protein	NA	NA	NA	NA
WP_152385957.1\|153232_153475_-	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|153893_154874_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152385959.1\|155239_156817_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_152385960.1\|156819_157338_-	twin-arginine translocation signal domain-containing protein	NA	NA	NA	NA
WP_152385961.1\|157413_159882_-	glucan 1,4-alpha-glucosidase	NA	NA	NA	NA
WP_152385962.1\|161338_162613_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_152385963.1\|162826_164407_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_152385964.1\|164521_166075_-	altronate dehydratase	NA	NA	NA	NA
WP_152385965.1\|166577_166844_+	hypothetical protein	NA	NA	NA	NA
WP_152385966.1\|167670_168768_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152385967.1\|168855_169953_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152385968.1\|170040_171138_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152385969.1\|171317_172267_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	6.3e-10	24.2
WP_152389741.1\|172356_173448_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152385970.1\|173613_174960_+\|transposase	IS701 family transposase	NA	NA	NA	NA
WP_152389742.1\|175021_175968_-\|transposase	IS630 family transposase	A0A1V0SDF8	Indivirus	8.7e-12	20.1
WP_152385971.1\|176353_177286_-	transporter	NA	NA	NA	NA
WP_152385972.1\|177529_179437_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_152385973.1\|179635_180784_-	L-threonine dehydrogenase	NA	NA	NA	NA
WP_152385974.1\|181005_182535_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_152385975.1\|184250_184574_-	hypothetical protein	A0A059VA49	Pseudomonas_phage	2.3e-20	48.3
WP_152385976.1\|184943_185246_-	hypothetical protein	NA	NA	NA	NA
WP_152385977.1\|186707_186989_-	hypothetical protein	NA	NA	NA	NA
WP_152385914.1\|187374_188415_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1
WP_152385978.1\|188429_188774_-	hypothetical protein	NA	NA	NA	NA
WP_152385979.1\|188898_190263_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_152389743.1\|190520_191825_-	GTP-binding protein	NA	NA	NA	NA
WP_152385980.1\|192342_193092_-\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_152389744.1\|193738_195742_+	sigma 54-interacting transcriptional regulator	NA	NA	NA	NA
WP_152385958.1\|197092_198073_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152385981.1\|198687_200625_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_152389745.1\|200640_201027_+	acetone carboxylase subunit gamma	NA	NA	NA	NA
WP_152385982.1\|201104_203240_+	hydantoinase/oxoprolinase family protein	NA	NA	NA	NA
WP_152385983.1\|203291_205568_+	acetone carboxylase subunit alpha	NA	NA	NA	NA
WP_152385984.1\|205564_206431_+	hypothetical protein	NA	NA	NA	NA
WP_152385985.1\|206746_207445_+	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_152385986.1\|207478_208135_+	3-oxoacid CoA-transferase subunit B	NA	NA	NA	NA
WP_152385987.1\|210585_211773_-	beta-ketothiolase BktB	NA	NA	NA	NA
WP_152385988.1\|211870_212923_-	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_152385989.1\|213411_214361_-\|transposase	IS630 family transposase	A0A2H4UVU9	Bodo_saltans_virus	8.7e-12	23.3
WP_152385990.1\|214626_215586_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152385991.1\|215708_216932_+	fumarylacetoacetate hydrolase	NA	NA	NA	NA
WP_152385992.1\|217140_218493_+	MFS transporter	NA	NA	NA	NA
WP_152385993.1\|218762_219635_-	AEC family transporter	NA	NA	NA	NA
WP_152389746.1\|220530_221445_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152385994.1\|222087_222915_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152385995.1\|223042_224185_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	3.0e-168	75.3
WP_167520012.1\|224575_225496_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152385996.1\|225737_227483_-	hypothetical protein	NA	NA	NA	NA
WP_152385997.1\|228240_229755_-	mannitol dehydrogenase family protein	E5EQS6	Micromonas_sp._RCC1109_virus	1.0e-54	33.0
WP_152385998.1\|230413_231307_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152386000.1\|231812_233087_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_152386001.1\|233353_234934_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_152386002.1\|235041_236037_-	FAH family protein	NA	NA	NA	NA
WP_152386003.1\|236070_237372_-	MFS transporter	NA	NA	NA	NA
WP_152386004.1\|237560_239297_+	dihydroxy-acid dehydratase	NA	NA	NA	NA
WP_152386005.1\|239424_240147_+	FCD domain-containing protein	NA	NA	NA	NA
WP_152386006.1\|240476_243026_-	hypothetical protein	NA	NA	NA	NA
WP_167520013.1\|243165_243321_-	hypothetical protein	NA	NA	NA	NA
WP_152386007.1\|244935_245748_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_152386008.1\|245744_246479_-	hypothetical protein	W6LP63	Streptococcus_phage	4.2e-06	67.5
WP_152385958.1\|246644_247625_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386009.1\|248100_249198_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386009.1\|249285_250383_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386010.1\|250470_251568_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386011.1\|251597_252905_-	MFS transporter	NA	NA	NA	NA
WP_152386012.1\|253206_253983_-	TIM barrel protein	NA	NA	NA	NA
WP_152386013.1\|253991_254633_-	aldolase	A0A077SK32	Escherichia_phage	3.9e-48	49.5
WP_152386014.1\|254629_255907_-	hypothetical protein	A0A077SLJ7	Escherichia_phage	2.0e-88	46.8
WP_152386015.1\|255910_256819_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	2.0e-82	56.9
WP_152389748.1\|256823_257549_-	FCD domain-containing protein	NA	NA	NA	NA
WP_152386016.1\|257731_258691_+	NAD-dependent epimerase/dehydratase family protein	A0A0P0YMS6	Yellowstone_lake_phycodnavirus	5.5e-06	29.6
WP_152386017.1\|258757_260020_-	outer membrane porin, OprD family	NA	NA	NA	NA
WP_152386018.1\|260254_261244_-	bifunctional glyoxylate/hydroxypyruvate reductase B	M1GWB3	Acanthocystis_turfacea_Chlorella_virus	2.5e-17	25.8

DBSCAN-SWA_9

270657 : 286012

Tupanvirus(20.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386026.1\|270657_271707_-	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L339	Tupanvirus	2.8e-75	44.8
WP_152386027.1\|273147_274365_+	sugar transporter	NA	NA	NA	NA
WP_152386028.1\|274555_276121_-	alkyl hydroperoxide reductase subunit F	A0A1W6JK46	Lactococcus_phage	8.1e-23	28.5
WP_152386029.1\|276326_277157_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_152386030.1\|277284_278655_-	formimidoylglutamate deiminase	NA	NA	NA	NA
WP_152386031.1\|278669_280199_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	4.8e-68	36.6
WP_152386032.1\|281226_281898_-	RES domain-containing protein	NA	NA	NA	NA
WP_152389751.1\|281901_282243_-	DUF2384 domain-containing protein	NA	NA	NA	NA
WP_152386033.1\|282467_282923_+	hypothetical protein	NA	NA	NA	NA
WP_167520015.1\|282929_284630_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-24	37.7
WP_152386035.1\|284939_285101_+	histidine kinase	NA	NA	NA	NA
WP_152386036.1\|285159_286012_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5

DBSCAN-SWA_10

297508 : 299097

Cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386046.1\|297508_298384_+	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	1.9e-08	24.0
WP_152386047.1\|298380_299097_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-10	24.5

DBSCAN-SWA_11

305184 : 308049

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386052.1\|305184_308049_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	6.7e-265	51.3

DBSCAN-SWA_12

314756 : 322433

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386058.1\|314756_315170_+	arsenate reductase ArsC	A0A2H4J437	uncultured_Caudovirales_phage	1.2e-39	62.6
WP_152386059.1\|315178_315535_+	metalloregulator ArsR/SmtB family transcription factor	A0A2H4J145	uncultured_Caudovirales_phage	1.3e-37	64.0
WP_152386060.1\|315553_316024_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.4e-47	60.9
WP_152386061.1\|316047_316761_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	1.6e-103	77.6
WP_152386062.1\|316780_317275_+	protein phosphatase	NA	NA	NA	NA
WP_152386063.1\|317287_317614_+	YnfA family protein	A0A218MNG8	uncultured_virus	8.6e-28	58.1
WP_152386064.1\|317636_318641_+	ArsJ-associated glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_152386065.1\|318788_320063_+	organoarsenical effux MFS transporter ArsJ	NA	NA	NA	NA
WP_152386066.1\|320006_322433_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.2e-97	38.2

DBSCAN-SWA_13

341572 : 343186

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386081.1\|341572_343186_+	chaperonin GroEL	A0A240F779	uncultured_virus	2.2e-140	51.3

DBSCAN-SWA_14

364250 : 366425

uncultured_Caudovirales_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386096.1\|364250_364721_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.1e-42	54.5
WP_152386097.1\|364764_365262_+	hypothetical protein	NA	NA	NA	NA
WP_152385914.1\|365384_366425_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1

DBSCAN-SWA_15

376448 : 377222

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386106.1\|376448_377222_+	ATP-binding cassette domain-containing protein	A0A1M7XV31	Cedratvirus	5.6e-09	29.5

DBSCAN-SWA_16

383474 : 385097

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386113.1\|383474_385097_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	5.3e-33	26.9

DBSCAN-SWA_17

389423 : 390260

Phage_NCTB(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386117.1\|389423_390260_-	HDOD domain-containing protein	A0A1C3NFB0	Phage_NCTB	1.6e-25	32.7

DBSCAN-SWA_18

396236 : 397898

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386122.1\|396236_397898_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	2.5e-38	25.0

DBSCAN-SWA_19

410144 : 411479

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386130.1\|410144_411479_+	alcohol dehydrogenase catalytic domain-containing protein	A0A0K0KVL7	Prochlorococcus_phage	6.7e-10	28.1

DBSCAN-SWA_20

420926 : 424998

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386138.1\|420926_422822_-	potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	8.2e-70	32.5
WP_152386139.1\|423307_423451_-	DUF2256 domain-containing protein	NA	NA	NA	NA
WP_152386140.1\|423447_424998_-	cryptochrome/photolyase family protein	A0A1V0SE91	Indivirus	1.8e-51	26.3

DBSCAN-SWA_21

436438 : 454409

uncultured_Caudovirales_phage(50.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386149.1\|436438_437110_+\|protease	FtsH protease modulator YccA	A0A2H4JFM9	uncultured_Caudovirales_phage	5.3e-88	78.9
WP_152386150.1\|437201_437594_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	7.7e-47	72.1
WP_152386151.1\|437595_437955_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	4.9e-32	57.5
WP_152386152.1\|437954_438251_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	2.2e-22	57.6
WP_152386153.1\|438247_438583_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	5.7e-43	75.7
WP_152386154.1\|438579_439566_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	5.6e-147	76.8
WP_152386155.1\|439596_440991_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_152386156.1\|441345_442626_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.0e-100	55.3
WP_152386157.1\|442646_443021_-	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	5.7e-07	41.5
WP_152386158.1\|443017_444343_-	AAA family ATPase	G3MBE0	Bacillus_virus	2.1e-80	40.2
WP_152386159.1\|444356_444980_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_167520020.1\|445007_447929_-	cell division protein FtsK	Q853W3	Mycobacterium_phage	5.5e-89	50.3
WP_152386161.1\|448371_449319_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	2.3e-60	43.6
WP_152386162.1\|449382_450063_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_152386163.1\|450143_450851_+	arginyltransferase	NA	NA	NA	NA
WP_002553999.1\|450953_451172_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_152386164.1\|451243_453514_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	1.4e-164	42.6
WP_152386165.1\|453543_453906_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.1e-10	39.5
WP_152386166.1\|454130_454409_+	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	3.8e-16	61.2

DBSCAN-SWA_22

459821 : 461192

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386171.1\|459821_461192_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	3.3e-113	47.8

DBSCAN-SWA_23

486233 : 486848

Geobacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386194.1\|486233_486848_-	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	1.6e-27	54.5

DBSCAN-SWA_24

493096 : 496606

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386197.1\|493096_493810_+	hypothetical protein	A0A2H4J991	uncultured_Caudovirales_phage	7.6e-53	47.0
WP_152386198.1\|493998_494220_+	hypothetical protein	NA	NA	NA	NA
WP_152386199.1\|495016_496606_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	1.4e-62	29.0

DBSCAN-SWA_25

520808 : 521621

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386214.1\|520808_521621_+	exodeoxyribonuclease III	M1PSC0	Streptococcus_phage	2.7e-09	27.3

DBSCAN-SWA_26

526521 : 551544

Escherichia_phage(36.36%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386219.1\|526521_527619_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152385958.1\|527780_528761_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152385958.1\|528978_529959_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386220.1\|530502_531483_-\|transposase	IS5 family transposase	A0A077K814	Ralstonia_phage	1.8e-89	56.1
WP_152386221.1\|532153_534724_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	2.4e-19	28.4
WP_152386222.1\|536069_537473_+	3-deoxy-7-phosphoheptulonate synthase class II	NA	NA	NA	NA
WP_152386223.1\|537632_538406_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.3e-26	36.1
WP_152386224.1\|539306_540404_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386225.1\|540491_541589_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386226.1\|541911_542946_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.3e-58	34.6
WP_167520022.1\|542935_546223_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.9e-58	34.9
WP_152386227.1\|546239_548594_+	response regulator	A0A1V0SGX0	Hokovirus	2.4e-55	28.5
WP_152385958.1\|548703_549684_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_167520023.1\|550054_550321_+	response regulator	W8CYM9	Bacillus_phage	4.9e-05	34.2
WP_152386229.1\|550563_551544_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.0e-92	55.2

DBSCAN-SWA_27

555829 : 557176

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386233.1\|555829_557176_-	histidine kinase	W8CYF6	Bacillus_phage	3.7e-08	27.1

DBSCAN-SWA_28

585224 : 588917

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386255.1\|585224_588917_+	methionine synthase	A0A140XBC7	Dickeya_phage	2.3e-15	66.7

DBSCAN-SWA_29

596285 : 597671

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386266.1\|596285_597671_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.9e-45	30.3

DBSCAN-SWA_30

609287 : 610040

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386278.1\|609287_610040_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.4e-34	38.2

DBSCAN-SWA_31

625682 : 630079

Bradyrhizobium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386284.1\|625682_626414_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.2e-37	39.1
WP_152386285.1\|626437_626896_-	ribonuclease HI	J9Q745	Salmonella_phage	9.3e-36	52.2
WP_152386286.1\|626896_627658_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_152386287.1\|627864_628641_+	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_152386288.1\|628738_630079_+	transglycosylase SLT domain-containing protein	A0A0S2SXN2	Bacillus_phage	6.3e-08	34.6

DBSCAN-SWA_32

636014 : 637628

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386292.1\|636014_637628_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.6e-19	35.7

DBSCAN-SWA_33

642623 : 644057

Erysipelothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386298.1\|642623_644057_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	3.1e-45	27.6

DBSCAN-SWA_34

654365 : 656815

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386307.1\|654365_654923_+	exonuclease	A0A2K9L1J3	Tupanvirus	4.6e-13	27.7
WP_152386308.1\|654983_655265_+	DUF1255 family protein	NA	NA	NA	NA
WP_152386309.1\|655465_655669_+	hypothetical protein	NA	NA	NA	NA
WP_152386310.1\|655672_656815_-	4-phosphoerythronate dehydrogenase PdxB	A0A2R8FDS8	Brazilian_cedratvirus	3.3e-21	31.3

DBSCAN-SWA_35

663180 : 673893

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386314.1\|663180_664287_+	NAD-dependent epimerase/dehydratase family protein	E3T4Y8	Cafeteria_roenbergensis_virus	5.1e-64	41.8
WP_152389768.1\|664339_666208_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.4e-26	26.0
WP_152386315.1\|666212_667181_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_152386316.1\|668277_669600_+	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	1.7e-77	38.0
WP_152386317.1\|669802_670636_+	DUF616 domain-containing protein	NA	NA	NA	NA
WP_152386318.1\|670683_671661_+	glycosyltransferase	A0A1V0SAH6	Catovirus	8.4e-10	31.3
WP_152386319.1\|671657_672794_+	glycosyltransferase	NA	NA	NA	NA
WP_152389769.1\|672780_673893_+	glycosyltransferase	A0A2P0VNG4	Tetraselmis_virus	4.2e-05	24.1

DBSCAN-SWA_36

680836 : 684185

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386326.1\|680836_682012_+	aminotransferase	A0A2K9L470	Tupanvirus	2.8e-92	43.3
WP_152386327.1\|682064_683045_+	glycosyltransferase	NA	NA	NA	NA
WP_152386328.1\|683057_684185_+	FAD-dependent oxidoreductase	A0A1B1ITR3	uncultured_Mediterranean_phage	1.3e-06	38.0

DBSCAN-SWA_37

693758 : 697182

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386336.1\|693758_694769_+	glycosyltransferase	A0A1V0SAH6	Catovirus	2.5e-09	36.0
WP_152386337.1\|695119_696112_+	glycosyltransferase	A0A1V0SAH6	Catovirus	7.7e-11	40.0
WP_152386338.1\|696195_697182_+	glycosyltransferase	A0A1V0SAH6	Catovirus	3.4e-11	41.1

DBSCAN-SWA_38

706449 : 708138

Hepacivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386347.1\|706449_708138_-	AMP-binding protein	Q75ZG1	Hepacivirus	5.6e-46	27.3

DBSCAN-SWA_39

716964 : 725380

Wolbachia_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386355.1\|716964_718383_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	6.8e-61	32.6
WP_152386356.1\|718383_719079_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_167520024.1\|719152_719320_-	hypothetical protein	NA	NA	NA	NA
WP_152389770.1\|719316_719913_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A2K9L0M4	Tupanvirus	5.3e-23	32.9
WP_152386357.1\|720051_722901_+	RNA polymerase-associated protein RapA	A0A1B1IUI1	uncultured_Mediterranean_phage	3.8e-18	37.8
WP_152386358.1\|723025_725380_-	NAD-dependent DNA ligase LigA	A0A1Y0SVC9	Pseudomonas_phage	2.1e-131	38.1

DBSCAN-SWA_40

731465 : 732323

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386362.1\|731465_732323_+	ion transporter	A0A1B0Y2S3	Lactobacillus_phage	6.5e-06	31.8

DBSCAN-SWA_41

739148 : 739835

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386372.1\|739148_739835_-	cytochrome c biogenesis heme-transporting ATPase CcmA	A0A2H4PQG7	Staphylococcus_phage	1.1e-13	25.3

DBSCAN-SWA_42

743529 : 747795

Indivirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385914.1\|743529_744570_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1
WP_152386373.1\|744772_745612_-	P-loop NTPase	NA	NA	NA	NA
WP_167520025.1\|745763_746285_+	superoxide dismutase [Cu-Zn] SodC1	Q9MC02	Salmonella_phage	4.6e-47	55.2
WP_152386375.1\|746994_747795_-	aliphatic sulfonates ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-26	34.2

DBSCAN-SWA_43

753630 : 754611

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386382.1\|753630_754611_+	bifunctional glyoxylate/hydroxypyruvate reductase B	M1I4S0	Paramecium_bursaria_Chlorella_virus	1.3e-21	29.0

DBSCAN-SWA_44

760050 : 760881

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386390.1\|760050_760881_-	ATP-binding cassette domain-containing protein	A0A1V0SKJ1	Klosneuvirus	5.7e-07	26.9

DBSCAN-SWA_45

771953 : 772589

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386397.1\|771953_772589_-	N-6 DNA methylase	A0A2H4YF91	Aeromonas_phage	2.5e-07	35.0

DBSCAN-SWA_46

776979 : 779290

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386403.1\|776979_777771_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.2e-29	35.5
WP_152386404.1\|778153_779290_+	glycerate kinase	W6LM47	Streptococcus_phage	2.8e-41	40.5

DBSCAN-SWA_47

793540 : 794632

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386417.1\|793540_794632_+	acyltransferase family protein	A0A2H4JA46	uncultured_Caudovirales_phage	7.4e-23	32.3

DBSCAN-SWA_48

803195 : 803948

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389773.1\|803195_803948_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.3e-20	35.1

DBSCAN-SWA_49

818066 : 818825

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386438.1\|818066_818825_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.4e-22	45.0

DBSCAN-SWA_50

834258 : 835410

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386449.1\|834258_835410_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.8e-28	39.8

DBSCAN-SWA_51

844777 : 845749

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386460.1\|844777_845749_+	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.0e-31	33.7

DBSCAN-SWA_52

852478 : 915532

Pseudomonas_phage(19.35%)

head,terminase,capsid,holin,transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386468.1\|852478_853990_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.5e-122	52.1
WP_167520026.1\|854071_854329_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_152386470.1\|854390_854720_-\|transposase	transposase	NA	NA	NA	NA
WP_152386471.1\|855843_856155_-	hypothetical protein	NA	NA	NA	NA
WP_152386472.1\|856396_856813_-	hypothetical protein	NA	NA	NA	NA
WP_152386473.1\|856885_857344_-	Hsp20 family protein	A0A218MMV3	uncultured_virus	7.9e-19	37.8
WP_152386474.1\|859108_859384_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152386475.1\|860250_860538_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152386476.1\|860543_860813_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_152386477.1\|861240_861636_+	hypothetical protein	NA	NA	NA	NA
WP_152386478.1\|861855_862245_-	hypothetical protein	NA	NA	NA	NA
WP_152386479.1\|862540_862984_-	hypothetical protein	A0A1B1IWZ0	uncultured_Mediterranean_phage	4.8e-13	33.3
WP_152386480.1\|863141_863378_-	hypothetical protein	NA	NA	NA	NA
WP_152389777.1\|863488_864376_-	EamA family transporter	NA	NA	NA	NA
WP_152386481.1\|866317_866599_+	Pyocin activator protein PrtN	A0A2K8HN48	Pseudomonas_phage	2.3e-29	70.2
WP_152386482.1\|866846_867158_+	hypothetical protein	NA	NA	NA	NA
WP_152386483.1\|868990_869368_-	PIN domain-containing protein	NA	NA	NA	NA
WP_152386484.1\|869364_869610_-	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_152386485.1\|870103_870391_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152386486.1\|870871_872005_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_167520027.1\|872983_874054_+	hypothetical protein	A0A0M3LR56	Mannheimia_phage	2.6e-28	46.3
WP_152386487.1\|874167_874422_+	addiction module toxin, HicA family	NA	NA	NA	NA
WP_152386488.1\|874418_874751_+	toxin-antitoxin system HicB family antitoxin	R4JJS9	Burkholderia_phage	2.2e-26	51.4
WP_152386489.1\|874956_875400_-	hypothetical protein	A0A2H4FY72	Methylophilaceae_phage	1.0e-15	40.3
WP_152386490.1\|875396_875885_-	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	2.9e-51	66.0
WP_152386491.1\|875945_876182_-	hypothetical protein	NA	NA	NA	NA
WP_152386492.1\|876480_877845_+	hypothetical protein	NA	NA	NA	NA
WP_152386493.1\|877998_879750_-	hypothetical protein	NA	NA	NA	NA
WP_152386494.1\|879749_880496_-	hypothetical protein	NA	NA	NA	NA
WP_152386495.1\|880499_881477_-	hypothetical protein	A0A1L2C9I0	Pseudomonas_phage	4.1e-57	43.7
WP_152386496.1\|881476_885016_-	hypothetical protein	A0A0M4U447	Ralstonia_phage	5.8e-186	36.8
WP_152386497.1\|885068_885899_-	hypothetical protein	A0A2H4IZE1	uncultured_Caudovirales_phage	1.2e-44	37.9
WP_152386498.1\|886041_887325_-	hypothetical protein	A0A0M3LR56	Mannheimia_phage	7.9e-32	49.6
WP_152386499.1\|887765_888803_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_152386500.1\|888907_889276_+	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|889693_890674_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386501.1\|891236_892754_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_152386502.1\|893105_894149_+	hypothetical protein	NA	NA	NA	NA
WP_152386503.1\|894684_894930_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_152386504.1\|894919_895201_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	A0A2H4JBF4	uncultured_Caudovirales_phage	7.2e-23	63.4
WP_152386505.1\|895358_895634_+	BrnT family toxin	A0A2H4J3D4	uncultured_Caudovirales_phage	1.4e-18	80.0
WP_152386506.1\|895611_895917_+	hypothetical protein	A0A2H4J5Y5	uncultured_Caudovirales_phage	6.8e-35	75.0
WP_152386507.1\|896082_896475_-	hypothetical protein	NA	NA	NA	NA
WP_152386508.1\|896475_899757_-	tape measure protein	A0A2I7S9D9	Vibrio_phage	1.1e-45	40.7
WP_152386509.1\|899835_900588_-	hypothetical protein	A0A2I7QRV3	Vibrio_phage	8.1e-21	28.3
WP_152386510.1\|900603_901041_-	hypothetical protein	NA	NA	NA	NA
WP_152389779.1\|901042_901333_-	hypothetical protein	NA	NA	NA	NA
WP_152386511.1\|901349_902357_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	6.7e-79	47.3
WP_152386512.1\|902415_902763_-\|head	head decoration protein	NA	NA	NA	NA
WP_152386513.1\|902766_903984_-	S49 family peptidase	A0A219YAK4	Aeromonas_phage	5.3e-54	39.7
WP_152386514.1\|903986_905570_-\|portal	phage portal protein	A0A067ZJA4	Vibrio_phage	2.3e-102	45.5
WP_152386515.1\|905572_905785_-	hypothetical protein	NA	NA	NA	NA
WP_152386516.1\|905794_907681_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	5.3e-170	49.5
WP_152386517.1\|907724_908249_-	DNA packaging protein	A0A2D1GMW4	Marinobacter_phage	1.0e-22	42.2
WP_152386518.1\|908352_909126_-	hypothetical protein	A0A1B0Z000	Pseudomonas_phage	1.6e-48	45.1
WP_152386519.1\|909129_909468_-\|holin	holin	B5TK61	Pseudomonas_phage	2.6e-11	38.2
WP_152386520.1\|910189_910468_+	BrnT family toxin	K4NX81	Burkholderia_phage	9.6e-28	69.7
WP_152386521.1\|910421_910751_+	hypothetical protein	K4NZP3	Burkholderia_phage	4.3e-19	51.8
WP_152386522.1\|910767_911139_-	hypothetical protein	NA	NA	NA	NA
WP_152389780.1\|911135_913358_-	conjugal transfer protein TraC	A0A2D1GN57	Marinobacter_phage	1.8e-193	47.2
WP_152389781.1\|913362_913731_-	hypothetical protein	NA	NA	NA	NA
WP_167520028.1\|914221_914455_-	helix-turn-helix domain-containing protein	J7I423	Pseudomonas_phage	3.3e-13	63.5
WP_152389783.1\|914611_915532_+	transcriptional regulator	A0A1B0Z078	Pseudomonas_phage	2.6e-69	57.0

DBSCAN-SWA_53

921406 : 925585

Pseudomonas_phage(25.0%)

tRNA,integrase

attL 920882:920895|attR 925037:925050

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
920882:920895	attL	NA	NA	NA	NA
WP_152386533.1\|921406_921913_+	hypothetical protein	H2BD44	Pseudomonas_phage	1.3e-17	40.8
WP_152386534.1\|921988_922255_+	Pyocin activator protein PrtN	I6NSR8	Burkholderia_phage	1.2e-22	61.9
WP_167520030.1\|922234_923389_-\|integrase	tyrosine-type recombinase/integrase	L7TP61	Pseudomonas_virus	2.4e-128	60.2
WP_152386535.1\|923513_924518_+\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_152386536.1\|924658_925585_+	transaldolase	A0A127KNC6	Cyanophage	4.2e-11	33.5
925037:925050	attR	NA	NA	NA	NA

DBSCAN-SWA_54

929163 : 939123

uncultured_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386541.1\|929163_930558_+	adenylate cyclase	A0A218MLZ2	uncultured_virus	2.2e-32	38.5
WP_152386542.1\|930819_931875_-	glycosyltransferase	NA	NA	NA	NA
WP_152386543.1\|931871_932696_-	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	5.9e-65	46.9
WP_152386544.1\|932801_933086_-	SelT/SelW/SelH family protein	NA	NA	NA	NA
WP_152386545.1\|933184_933631_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_152386546.1\|933754_935878_-	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	5.0e-84	34.8
WP_152386547.1\|936118_936706_+	UPF0149 family protein	NA	NA	NA	NA
WP_152386548.1\|936716_937121_+	DUF454 family protein	NA	NA	NA	NA
WP_152386549.1\|937086_937728_-	DTW domain-containing protein	NA	NA	NA	NA
WP_167520032.1\|937816_937954_-	hypothetical protein	NA	NA	NA	NA
WP_152386550.1\|938145_939123_-	cysteine synthase A	A0A1X9I5K7	Streptococcus_phage	1.3e-71	50.0

DBSCAN-SWA_55

967445 : 1027241

Bacillus_phage(17.65%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386579.1\|967445_969299_-	TonB-dependent vitamin B12 receptor	A0A0P0I887	Acinetobacter_phage	6.7e-08	32.4
WP_152386580.1\|969695_970433_-	NAD-dependent protein deacylase	S5M4R0	Bacillus_phage	3.8e-23	31.7
WP_152386581.1\|970533_971241_+	glutamine amidotransferase	A0A2K9L2L9	Tupanvirus	3.1e-06	37.7
WP_152386582.1\|971255_971963_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_152386583.1\|971987_972500_-	hydrolase Nlp/P60	A0A1S5SEZ8	Streptococcus_phage	1.8e-11	36.1
WP_152386584.1\|972633_973260_-	peptidoglycan endopeptidase	B6V2P9	Bacillus_phage	2.0e-17	39.1
WP_152386585.1\|973610_974378_-	NAD-dependent protein deacylase	A0A2I2L319	Orpheovirus	1.3e-18	34.6
WP_152386586.1\|974502_975174_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_152386587.1\|975265_976345_-	3-deoxy-7-phosphoheptulonate synthase	S4W5F1	Pandoravirus	2.5e-87	51.9
WP_152386588.1\|976813_977638_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	3.2e-103	70.8
WP_152386589.1\|977922_978522_+	DUF1282 family protein	NA	NA	NA	NA
WP_152386590.1\|978723_979395_+	DUF1282 family protein	NA	NA	NA	NA
WP_152386591.1\|979459_979954_+\|protease	SprT family zinc-dependent metalloprotease	NA	NA	NA	NA
WP_152386592.1\|979928_981260_-	C4-dicarboxylate transporter DctA	NA	NA	NA	NA
WP_152386593.1\|981565_982351_+	prolyl oligopeptidase family serine peptidase	NA	NA	NA	NA
WP_152386594.1\|982444_983155_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_152386595.1\|983883_986766_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	5.3e-177	46.0
WP_152386596.1\|987052_988300_+	ribonucleotide-diphosphate reductase subunit beta	K4K678	Caulobacter_phage	8.4e-31	29.0
WP_152386597.1\|988631_989267_+	TIR domain-containing protein	NA	NA	NA	NA
WP_152385958.1\|989404_990385_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386598.1\|991187_991721_+\|transposase	transposase	NA	NA	NA	NA
WP_152386599.1\|991828_992614_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_152386600.1\|992832_993081_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_152386601.1\|993654_993879_-	hypothetical protein	NA	NA	NA	NA
WP_152386602.1\|994302_995340_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6
WP_152386603.1\|995479_995689_-	hypothetical protein	NA	NA	NA	NA
WP_152386604.1\|995855_996197_-	hypothetical protein	NA	NA	NA	NA
WP_152386605.1\|996351_997203_-	CAP domain-containing protein	NA	NA	NA	NA
WP_152386606.1\|997543_998287_+	hypothetical protein	NA	NA	NA	NA
WP_152386607.1\|998432_998843_-	ribosomal subunit interface protein	NA	NA	NA	NA
WP_152389788.1\|999484_1001485_+\|protease	collagenase-like protease	Q6DW11	Phage_TP	2.1e-23	27.6
WP_152386608.1\|1001614_1002187_-	fructose-2,6-bisphosphatase	NA	NA	NA	NA
WP_152386609.1\|1002688_1003039_+	hypothetical protein	NA	NA	NA	NA
WP_152386610.1\|1003563_1003845_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_152386611.1\|1004028_1005285_-	acyltransferase family protein	NA	NA	NA	NA
WP_152386612.1\|1005882_1006176_-	hypothetical protein	A0A1V0E5P9	Salmonella_phage	3.1e-08	44.9
WP_152386613.1\|1006399_1006684_-	cell division protein ZapA	NA	NA	NA	NA
WP_152386614.1\|1006680_1006908_-	hypothetical protein	NA	NA	NA	NA
WP_152386615.1\|1007051_1007837_-	TSUP family transporter	NA	NA	NA	NA
WP_152386616.1\|1008008_1008851_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_152386617.1\|1008989_1010030_-	DUF1176 domain-containing protein	NA	NA	NA	NA
WP_152386618.1\|1010271_1010649_+	DUF3597 family protein	NA	NA	NA	NA
WP_167520033.1\|1010942_1021163_-	hypothetical protein	A0A2H4JEI4	uncultured_Caudovirales_phage	1.7e-20	42.5
WP_152386620.1\|1021809_1022295_-	hypothetical protein	NA	NA	NA	NA
WP_152386036.1\|1023036_1023889_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152386621.1\|1023834_1025094_-	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_167520034.1\|1025090_1027241_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.2e-46	29.3

DBSCAN-SWA_56

1034982 : 1036740

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386630.1\|1034982_1036740_+	AAA family ATPase	A0A172JHZ0	Bacillus_phage	6.0e-91	36.8

DBSCAN-SWA_57

1041200 : 1042571

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386635.1\|1041200_1042571_-	MFS transporter	Q6JIH2	Burkholderia_virus	4.0e-42	29.3

DBSCAN-SWA_58

1045958 : 1052706

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386638.1\|1045958_1050032_-	ATP-dependent helicase	A0A160DHD3	Gordonia_phage	6.6e-40	29.0
WP_152386639.1\|1050235_1050583_+	HNH nuclease family protein	NA	NA	NA	NA
WP_152386640.1\|1050821_1051379_+	magnesium transporter	NA	NA	NA	NA
WP_152386641.1\|1051445_1051874_-	universal stress protein	NA	NA	NA	NA
WP_152386642.1\|1051939_1052176_-	DUF2789 family protein	NA	NA	NA	NA
WP_152386643.1\|1052496_1052706_+	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	6.3e-16	59.7

DBSCAN-SWA_59

1064956 : 1067705

Phage_Gifsy-1(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385995.1\|1064956_1066099_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	3.0e-168	75.3
WP_152389792.1\|1066226_1066343_-	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_152386653.1\|1066579_1066810_-	hypothetical protein	NA	NA	NA	NA
WP_152386654.1\|1067021_1067705_+	response regulator	W8CYM9	Bacillus_phage	2.3e-30	35.0

DBSCAN-SWA_60

1078169 : 1079636

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386665.1\|1078169_1079636_-	glucose-6-phosphate dehydrogenase	H6WFS4	Cyanophage	7.0e-77	36.6

DBSCAN-SWA_61

1091222 : 1092485

Musca_hytrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386677.1\|1091222_1092485_+	nucleoside:proton symporter	B2YG43	Musca_hytrovirus	6.0e-08	22.7

DBSCAN-SWA_62

1099767 : 1107320

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386682.1\|1099767_1101117_-	type I restriction endonuclease subunit S	A0A2H4PQP5	Staphylococcus_phage	3.0e-18	28.9
WP_152386683.1\|1101109_1102660_-	N-6 DNA methylase	NA	NA	NA	NA
WP_152386684.1\|1102699_1103695_-	Abi family protein	NA	NA	NA	NA
WP_152386685.1\|1103843_1107320_-	type I restriction-modification system endonuclease	G9FI19	Nocardia_phage	1.3e-09	21.2

DBSCAN-SWA_63

1112874 : 1114575

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386689.1\|1112874_1114575_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	2.6e-99	42.7

DBSCAN-SWA_64

1120214 : 1121948

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386694.1\|1120214_1121948_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.4e-185	58.6

DBSCAN-SWA_65

1127341 : 1130092

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167520038.1\|1127341_1130092_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	7.3e-27	35.3

DBSCAN-SWA_66

1152953 : 1210027

Escherichia_phage(21.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385958.1\|1152953_1153934_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386717.1\|1154194_1154626_-\|transposase	IS200/IS605 family transposase	A0A0P0IQC6	Lactobacillus_phage	2.0e-11	33.3
WP_152389797.1\|1154753_1157948_-	hypothetical protein	NA	NA	NA	NA
WP_152386718.1\|1158238_1162306_-	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	1.2e-54	31.6
WP_152386719.1\|1162440_1163820_-	undecaprenyl-phosphate glucose phosphotransferase	NA	NA	NA	NA
WP_152386720.1\|1163886_1165104_-	glycosyltransferase	NA	NA	NA	NA
WP_152386602.1\|1165934_1166972_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6
WP_152386721.1\|1167388_1168222_+	hypothetical protein	NA	NA	NA	NA
WP_152386722.1\|1168282_1169380_+	DUF4214 domain-containing protein	NA	NA	NA	NA
WP_152386723.1\|1169593_1171570_+	glycosyltransferase	NA	NA	NA	NA
WP_152386724.1\|1171573_1173916_+	glycosyltransferase	NA	NA	NA	NA
WP_152386725.1\|1174212_1174818_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_152386726.1\|1174977_1177629_+	hypothetical protein	NA	NA	NA	NA
WP_152386727.1\|1177631_1179185_+	hypothetical protein	NA	NA	NA	NA
WP_152386728.1\|1179166_1179751_+	hypothetical protein	NA	NA	NA	NA
WP_152389798.1\|1179787_1182835_+	glycosyltransferase	NA	NA	NA	NA
WP_152386729.1\|1183253_1183892_+	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|1184209_1185190_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386730.1\|1187117_1188422_+	hypothetical protein	NA	NA	NA	NA
WP_152386732.1\|1191352_1192159_+	hypothetical protein	NA	NA	NA	NA
WP_152385966.1\|1192284_1193382_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386733.1\|1193628_1194795_+	nucleotide sugar dehydrogenase	O41091	Paramecium_bursaria_Chlorella_virus	3.7e-113	54.3
WP_152389799.1\|1194850_1195858_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_152386734.1\|1196002_1197100_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.5e-87	46.6
WP_152386735.1\|1197096_1198002_+	dTDP-4-dehydrorhamnose reductase	NA	NA	NA	NA
WP_152386736.1\|1198006_1198891_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.4e-96	59.6
WP_152386737.1\|1198890_1199436_+	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A291LA62	Escherichia_phage	3.4e-53	56.7
WP_167520040.1\|1199650_1200772_+	acyltransferase family protein	NA	NA	NA	NA
WP_152386739.1\|1200753_1201929_-	glycosyltransferase	NA	NA	NA	NA
WP_152386740.1\|1201925_1202879_-	NAD-dependent epimerase/dehydratase family protein	A0A0N7KVW3	Yellowstone_lake_phycodnavirus	7.4e-19	28.7
WP_152386741.1\|1202915_1203950_-	GDP-mannose 4,6-dehydratase	M1HKK4	Acanthocystis_turfacea_Chlorella_virus	1.0e-106	56.7
WP_152386742.1\|1203982_1206094_-	hypothetical protein	NA	NA	NA	NA
WP_152386499.1\|1206324_1207362_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_152386602.1\|1207518_1208556_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6
WP_152386743.1\|1208577_1209039_-	GtrA family protein	NA	NA	NA	NA
WP_152386744.1\|1209013_1210027_-	glycosyltransferase	A8CG95	Salmonella_phage	3.8e-90	53.5

DBSCAN-SWA_67

1215468 : 1219243

Sulfolobus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386747.1\|1215468_1217874_-	glycosyltransferase	Q684B1	Sulfolobus_virus	8.4e-11	36.7
WP_152386748.1\|1218025_1219243_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-13	26.4

DBSCAN-SWA_68

1222924 : 1227693

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386751.1\|1222924_1224667_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.8e-29	31.9
WP_152386752.1\|1224967_1226152_-	glycosyltransferase	NA	NA	NA	NA
WP_152386753.1\|1226256_1227693_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	1.3e-54	29.4

DBSCAN-SWA_69

1231021 : 1231300

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012700218.1\|1231021_1231300_-	integration host factor subunit beta	A4JWM7	Burkholderia_virus	2.2e-11	40.0

DBSCAN-SWA_70

1236243 : 1242613

Pacmanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386759.1\|1236243_1237356_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	6.8e-24	27.9
WP_152386760.1\|1237449_1238547_-	prephenate dehydratase	NA	NA	NA	NA
WP_152386761.1\|1238546_1239632_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	1.0e-88	48.8
WP_152386762.1\|1239802_1242613_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	1.7e-103	40.7

DBSCAN-SWA_71

1254282 : 1255023

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386773.1\|1254282_1255023_-	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	5.2e-20	33.9

DBSCAN-SWA_72

1258375 : 1259053

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386778.1\|1258375_1259053_+	response regulator	W8CYM9	Bacillus_phage	5.2e-27	34.2

DBSCAN-SWA_73

1263789 : 1268446

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386784.1\|1263789_1264620_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A1S5R3L8	Pseudomonas_phage	4.9e-35	37.6
WP_152386785.1\|1264741_1265425_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.5e-29	33.8
WP_152386786.1\|1265421_1266741_+	heavy metal sensor histidine kinase	NA	NA	NA	NA
WP_152386787.1\|1266737_1267517_-	ABC transporter permease	NA	NA	NA	NA
WP_152386788.1\|1267513_1268446_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-22	26.2

DBSCAN-SWA_74

1271834 : 1279140

Pseudomonas_phage(40.0%)

integrase

attL 1271643:1271672|attR 1286608:1286637

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1271643:1271672	attL	NA	NA	NA	NA
WP_152386791.1\|1271834_1273082_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A077KET4	Ralstonia_phage	5.8e-80	43.4
WP_152386792.1\|1273181_1274141_+	hypothetical protein	NA	NA	NA	NA
WP_152386793.1\|1274254_1274491_+	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_152386794.1\|1274492_1275269_+	KilA-N domain-containing protein	K7PGT4	Enterobacteria_phage	2.7e-27	50.8
WP_152386795.1\|1275265_1275835_+	hypothetical protein	A0A1B0VP73	Pseudomonas_phage	6.8e-20	46.9
WP_152386796.1\|1275831_1276134_+	hypothetical protein	NA	NA	NA	NA
WP_167520042.1\|1276137_1276296_+	hypothetical protein	NA	NA	NA	NA
WP_152389804.1\|1276366_1278733_+	hypothetical protein	A0A0F7L738	uncultured_marine_virus	7.4e-36	39.1
WP_152389805.1\|1278945_1279140_+	hypothetical protein	A0A1B0VML7	Pseudomonas_phage	1.0e-15	70.8
1286608:1286637	attR	NA	NA	NA	NA

DBSCAN-SWA_75

1282522 : 1291018

Lactobacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386800.1\|1282522_1283152_+	hypothetical protein	U3PCU6	Lactobacillus_phage	6.4e-19	58.8
WP_152386801.1\|1284161_1285250_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386802.1\|1285238_1285961_-	hypothetical protein	I6NW45	Burkholderia_virus	5.8e-40	54.7
WP_152386803.1\|1286050_1286371_-	hypothetical protein	NA	NA	NA	NA
WP_152386804.1\|1287148_1288030_-	DUF815 domain-containing protein	NA	NA	NA	NA
WP_152386805.1\|1288133_1290452_+	response regulator	A0A1V0SGX0	Hokovirus	1.2e-41	28.3
WP_152386806.1\|1290541_1291018_-	glutathione peroxidase	A0A1S7DLQ4	Molluscum_contagiosum_virus	1.2e-17	40.7

DBSCAN-SWA_76

1295895 : 1297584

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386813.1\|1295895_1297584_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.3e-46	32.3

DBSCAN-SWA_77

1303535 : 1304573

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386499.1\|1303535_1304573_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0

DBSCAN-SWA_78

1328723 : 1330687

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386842.1\|1328723_1329740_-	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	1.7e-45	33.2
WP_152386843.1\|1329751_1330687_-	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	3.5e-37	36.2

DBSCAN-SWA_79

1340003 : 1341615

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386854.1\|1340003_1340990_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.7e-15	34.9
WP_152386855.1\|1340982_1341615_-	dTMP kinase	W8D0J5	Erwinia_phage	3.4e-20	36.7

DBSCAN-SWA_80

1344972 : 1346140

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003283670.1\|1344972_1345209_-	acyl carrier protein	B2ZXV3	Ralstonia_phage	3.4e-10	46.6
WP_152386858.1\|1345396_1346140_-	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	5.2e-12	30.9

DBSCAN-SWA_81

1349661 : 1350636

Shewanella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386863.1\|1349661_1350636_-	S49 family peptidase	A0A1V0DYI5	Shewanella_phage	2.7e-08	28.7

DBSCAN-SWA_82

1360985 : 1368089

Geobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389810.1\|1360985_1363196_-	DNA internalization-related competence protein ComEC/Rec2	Q0H255	Geobacillus_phage	2.8e-13	26.0
WP_152386873.1\|1363337_1363865_+	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_152386874.1\|1363890_1365135_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_152386875.1\|1365137_1365836_-	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.4e-36	40.3
WP_152386876.1\|1365828_1367079_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_152386877.1\|1367366_1368089_+	glycerophosphodiester phosphodiesterase	A0A292GJA3	Xanthomonas_phage	1.9e-06	32.6

DBSCAN-SWA_83

1386155 : 1390900

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386893.1\|1386155_1386764_+	repressor LexA	A0A1W6JNS2	Morganella_phage	1.7e-13	38.2
WP_152386894.1\|1386772_1387243_+	CDP-glycerol--UDP-pyrophosphoryl-N- acetylglucosaminyl-N-acetylmannosamine glycerophosphotransferase	NA	NA	NA	NA
WP_152386895.1\|1387310_1387544_-	hypothetical protein	NA	NA	NA	NA
WP_152386896.1\|1387630_1388155_-	PasA protein	NA	NA	NA	NA
WP_152386897.1\|1388293_1390900_-	type I DNA topoisomerase	E3T4K4	Cafeteria_roenbergensis_virus	1.3e-86	36.7

DBSCAN-SWA_84

1395118 : 1412813

Paenibacillus_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386650.1\|1395118_1396216_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386901.1\|1396303_1397401_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386009.1\|1397488_1398586_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386219.1\|1398673_1399771_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386036.1\|1399907_1400760_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152386902.1\|1400780_1401266_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_152386903.1\|1401311_1402223_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152386904.1\|1402388_1403573_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_152386905.1\|1403769_1405038_+	malate dehydrogenase	NA	NA	NA	NA
WP_152386906.1\|1405111_1406008_-\|transposase	transposase	NA	NA	NA	NA
WP_152386907.1\|1406579_1407020_+	universal stress protein	NA	NA	NA	NA
WP_152386908.1\|1407057_1407738_-	hypothetical protein	NA	NA	NA	NA
WP_152386909.1\|1407816_1409736_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.9e-50	28.7
WP_152386910.1\|1409924_1411856_+	transglycosylase SLT domain-containing protein	A0A0S2SXL7	Bacillus_phage	6.1e-12	39.9
WP_152386911.1\|1411859_1412813_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	5.0e-07	27.1

DBSCAN-SWA_85

1417296 : 1418829

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386918.1\|1417296_1418829_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.5e-122	48.4

DBSCAN-SWA_86

1431117 : 1433144

Only_Syngen_Nebraska_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386925.1\|1431117_1432038_+	ornithine carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	2.0e-21	27.3
WP_152386926.1\|1432034_1433144_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.2e-24	33.7

DBSCAN-SWA_87

1448407 : 1450807

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386934.1\|1448407_1450807_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.1e-140	39.0

DBSCAN-SWA_88

1460899 : 1470186

Heterosigma_akashiwo_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386945.1\|1460899_1461589_-	ribonuclease III	A0A1C9C5A7	Heterosigma_akashiwo_virus	3.2e-24	39.8
WP_152386946.1\|1461585_1461963_-	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_152386947.1\|1462056_1462908_-	signal peptidase I	NA	NA	NA	NA
WP_152386948.1\|1462912_1464712_-	elongation factor 4	A0A2K9L2P9	Tupanvirus	2.0e-20	38.5
WP_152386949.1\|1464861_1466283_-	Do family serine endopeptidase	A0A1B1IT49	uncultured_Mediterranean_phage	1.3e-24	29.5
WP_152386950.1\|1466294_1466765_-	positive regulator for alginate biosynthesis MucC	NA	NA	NA	NA
WP_152386951.1\|1466761_1467715_-	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_152386952.1\|1467723_1468311_-	RNA polymerase subunit sigma	NA	NA	NA	NA
WP_152386953.1\|1468343_1468925_-	RNA polymerase sigma factor RpoE	NA	NA	NA	NA
WP_152385958.1\|1469205_1470186_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6

DBSCAN-SWA_89

1473843 : 1474542

Macropodid_alphaherpesvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386958.1\|1473843_1474542_-	uracil-DNA glycosylase	A0A0Y0A6W9	Macropodid_alphaherpesvirus	2.6e-53	50.0

DBSCAN-SWA_90

1478486 : 1480467

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386965.1\|1478486_1480127_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	5.6e-176	64.8
WP_152386966.1\|1480173_1480467_-	co-chaperone GroES	A0A221S308	uncultured_virus	6.4e-14	44.1

DBSCAN-SWA_91

1514397 : 1519271

Streptococcus_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386997.1\|1514397_1515261_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.3e-42	42.6
WP_152389813.1\|1515379_1517203_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152386998.1\|1517204_1517567_+	YraN family protein	NA	NA	NA	NA
WP_152386999.1\|1517689_1518283_+	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	4.0e-15	33.3
WP_152387000.1\|1518279_1518813_+	BON domain-containing protein	NA	NA	NA	NA
WP_152387001.1\|1518863_1519271_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.6e-31	54.4

DBSCAN-SWA_92

1529310 : 1535385

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387012.1\|1529310_1531212_-	sulfate adenylyltransferase subunit CysN	A0A1V0SGC3	Hokovirus	6.8e-32	29.5
WP_152387013.1\|1531224_1532142_-	sulfate adenylyltransferase subunit CysD	NA	NA	NA	NA
WP_152387014.1\|1532268_1533027_-	Nif3-like dinuclear metal center hexameric protein	NA	NA	NA	NA
WP_152387015.1\|1533138_1534290_+	PDZ domain-containing protein	A0A1B1IRD3	uncultured_Mediterranean_phage	2.9e-09	32.5
WP_152387016.1\|1534329_1535385_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	1.4e-23	28.3

DBSCAN-SWA_93

1541554 : 1549429

Planktothrix_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387025.1\|1541554_1542364_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-24	31.7
WP_152387026.1\|1542592_1543567_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	1.7e-34	31.8
WP_152387027.1\|1543568_1544093_+	HAD hydrolase family protein	A0A140XBD6	Dickeya_phage	3.7e-28	49.6
WP_167520043.1\|1544101_1544671_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_152387029.1\|1544657_1545212_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_152387030.1\|1545211_1545937_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.2e-22	26.0
WP_152387031.1\|1546068_1547577_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_152387032.1\|1547690_1547999_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_152387033.1\|1548011_1548476_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_152387034.1\|1548571_1549429_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	6.2e-09	31.9

DBSCAN-SWA_94

1566187 : 1566559

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387048.1\|1566187_1566559_+	septal ring lytic transglycosylase RlpA family protein	H2BCY4	Synechococcus_phage	1.2e-14	48.3

DBSCAN-SWA_95

1575160 : 1577085

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387057.1\|1575160_1576129_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.0e-13	30.1
WP_152387058.1\|1576125_1577085_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-18	33.2

DBSCAN-SWA_96

1585223 : 1585904

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387063.1\|1585223_1585904_+	Fe2+-dependent dioxygenase	A0A127KMW2	Cyanophage	5.8e-18	27.9

DBSCAN-SWA_97

1593426 : 1595010

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387071.1\|1593426_1595010_+	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	6.1e-10	30.9

DBSCAN-SWA_98

1598663 : 1605856

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387075.1\|1598663_1601540_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.8e-07	30.1
WP_152387076.1\|1601715_1602708_+	catabolite repressor/activator	NA	NA	NA	NA
WP_152387077.1\|1602729_1604289_-	alkaline phosphatase	NA	NA	NA	NA
WP_152387078.1\|1604479_1605856_+	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	1.1e-74	36.5

DBSCAN-SWA_99

1620177 : 1627543

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387096.1\|1620177_1622742_-	ATP-dependent chaperone ClpB	H6X3M6	Enterobacteria_phage	2.5e-122	36.2
WP_152387097.1\|1622915_1623644_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_152387098.1\|1623643_1624615_-	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	A0A2H4UV25	Bodo_saltans_virus	1.2e-05	29.2
WP_152387099.1\|1624761_1625775_+	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_152387100.1\|1625872_1627543_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	3.5e-96	37.2

DBSCAN-SWA_100

1642169 : 1649830

Klosneuvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387113.1\|1642169_1645001_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	9.1e-81	26.9
WP_152387114.1\|1645003_1645954_-	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SD03	Indivirus	1.5e-08	32.2
WP_152387115.1\|1646089_1647634_-	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_152387116.1\|1647886_1648165_+	30S ribosomal protein S20	NA	NA	NA	NA
WP_152387117.1\|1648249_1648702_-	hypothetical protein	NA	NA	NA	NA
WP_152389819.1\|1648711_1649830_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	7.8e-60	39.4

DBSCAN-SWA_101

1662905 : 1666180

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387131.1\|1662905_1664570_-	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	3.5e-32	24.1
WP_152387132.1\|1664926_1666180_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.3e-97	51.6

DBSCAN-SWA_102

1687900 : 1688863

Only_Syngen_Nebraska_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387151.1\|1687900_1688863_+	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	4.1e-17	25.2

DBSCAN-SWA_103

1692563 : 1693181

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387156.1\|1692563_1693181_-	SOS response-associated peptidase	A0A1P8CX02	Bacillus_phage	7.9e-06	27.1

DBSCAN-SWA_104

1704571 : 1710554

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387169.1\|1704571_1705516_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	2.8e-18	33.3
WP_152387170.1\|1705503_1706916_+	deoxyribodipyrimidine photo-lyase	A0A167RC11	Powai_lake_megavirus	1.7e-43	27.8
WP_152387171.1\|1706922_1707714_-	glutamate racemase	NA	NA	NA	NA
WP_152387172.1\|1707703_1708462_-	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_152387173.1\|1708540_1709371_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_152387174.1\|1709471_1710554_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	4.8e-06	41.4

DBSCAN-SWA_105

1715561 : 1716503

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387178.1\|1715561_1716503_+	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	7.7e-45	34.5

DBSCAN-SWA_106

1720399 : 1722916

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387184.1\|1720399_1722916_-	pyrroloquinoline quinone biosynthesis protein PqqF	A0A1V0SJA4	Klosneuvirus	3.0e-11	22.7

DBSCAN-SWA_107

1734905 : 1737163

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387194.1\|1734905_1736018_+	acetoin dehydrogenase dihydrolipoyllysine-residue acetyltransferase subunit	A0A1I9SC21	Mycobacterium_phage	1.1e-10	33.6
WP_152387195.1\|1736080_1737163_+	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	1.8e-08	23.8

DBSCAN-SWA_108

1741134 : 1744819

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387198.1\|1741134_1742580_-	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	3.9e-88	41.5
WP_152387199.1\|1742865_1743144_+	Killer protein	NA	NA	NA	NA
WP_090900022.1\|1743157_1743445_+	HigA family addiction module antidote protein	A0A0M3LPV0	Mannheimia_phage	2.7e-17	50.6
WP_152387200.1\|1743658_1744819_-	DUF4172 domain-containing protein	A0A1V0E025	Clostridioides_phage	1.9e-08	31.6

DBSCAN-SWA_109

1753935 : 1755486

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387210.1\|1753935_1755486_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	5.2e-06	25.7

DBSCAN-SWA_110

1767587 : 1769312

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387216.1\|1767587_1769312_-	acetolactate synthase 3 large subunit	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	8.9e-55	27.9

DBSCAN-SWA_111

1776400 : 1777168

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387221.1\|1776400_1777168_-	heme ABC transporter ATP-binding protein	W5SAS9	Pithovirus	2.7e-11	28.3

DBSCAN-SWA_112

1787456 : 1790248

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387230.1\|1787456_1788851_+	polynucleotide adenylyltransferase PcnB	G3MAR3	Bacillus_virus	1.7e-27	36.9
WP_152389825.1\|1788853_1789366_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_152387231.1\|1789447_1790248_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.2e-35	32.8

DBSCAN-SWA_113

1793524 : 1795462

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387234.1\|1793524_1795462_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.1e-85	39.0

DBSCAN-SWA_114

1803000 : 1805514

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387240.1\|1803000_1805514_-	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	2.9e-22	23.6

DBSCAN-SWA_115

1810778 : 1812689

Ostreococcus_tauri_virus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389828.1\|1810778_1812689_-\|protease	ATP-dependent zinc metalloprotease FtsH	H8ZJI5	Ostreococcus_tauri_virus	1.0e-115	43.5

DBSCAN-SWA_116

1817720 : 1823102

Halovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387248.1\|1817720_1818857_-	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	1.0e-46	33.2
WP_152387249.1\|1819044_1819848_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_152387250.1\|1819929_1821057_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	1.6e-28	37.4
WP_152387251.1\|1821173_1823102_-	molecular chaperone DnaK	G8DDB7	Micromonas_pusilla_virus	3.8e-147	49.7

DBSCAN-SWA_117

1827770 : 1828253

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387257.1\|1827770_1828253_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	5.4e-26	44.1

DBSCAN-SWA_118

1836942 : 1839438

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389830.1\|1836942_1839438_-	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	3.8e-22	29.9

DBSCAN-SWA_119

1843085 : 1848357

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387266.1\|1843085_1845344_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	5.9e-83	35.0
WP_152387267.1\|1845478_1846465_-	DNA topoisomerase IV	NA	NA	NA	NA
WP_152387268.1\|1846464_1848357_-	DNA topoisomerase IV subunit B	G3M9Z3	Bacillus_virus	8.7e-96	36.9

DBSCAN-SWA_120

1857614 : 1858976

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387277.1\|1857614_1858976_+	chromate efflux transporter	A0A219VHC2	Ochrobactrum_phage	8.6e-29	60.6

DBSCAN-SWA_121

1862739 : 1866209

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386499.1\|1862739_1863777_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_152386470.1\|1864304_1864634_+\|transposase	transposase	NA	NA	NA	NA
WP_167520046.1\|1864630_1864966_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_152386499.1\|1865171_1866209_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0

DBSCAN-SWA_122

1879268 : 1882475

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387289.1\|1879268_1882475_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.4e-40	20.3

DBSCAN-SWA_123

1889457 : 1892493

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387298.1\|1889457_1891218_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.5e-25	27.6
WP_167520047.1\|1891290_1892493_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	D2TEZ5	Emiliania_huxleyi_virus	2.1e-42	33.8

DBSCAN-SWA_124

1895727 : 1896768

Indivirus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385914.1\|1895727_1896768_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1

DBSCAN-SWA_125

1905259 : 1907874

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387308.1\|1905259_1906024_+	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	S4VR59	Pandoravirus	9.4e-25	35.3
WP_152387309.1\|1906310_1906511_+	Em GEA1 (EM1)	NA	NA	NA	NA
WP_152387310.1\|1906566_1906761_+	Em GEA1 (EM1)	NA	NA	NA	NA
WP_152389835.1\|1906856_1907051_+	DUF2795 domain-containing protein	NA	NA	NA	NA
WP_152387311.1\|1907106_1907874_-	aspartyl/asparaginyl beta-hydroxylase domain-containing protein	S4VR59	Pandoravirus	2.1e-24	35.3

DBSCAN-SWA_126

1912521 : 1915854

uncultured_marine_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387315.1\|1912521_1913544_+	glycosyltransferase	A0A0F7L2F7	uncultured_marine_virus	3.1e-07	31.2
WP_152387316.1\|1913580_1914297_+	hypothetical protein	NA	NA	NA	NA
WP_152389836.1\|1914306_1915854_-	diguanylate cyclase	G3MA91	Bacillus_virus	1.4e-22	37.3

DBSCAN-SWA_127

1918925 : 1919762

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389837.1\|1918925_1919762_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	3.3e-31	37.0

DBSCAN-SWA_128

1930089 : 1933632

Enterobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389839.1\|1930089_1932033_-	acyltransferase family protein	A0A193GZ69	Enterobacter_phage	1.0e-54	36.8
WP_152387327.1\|1932207_1933632_-	bifunctional D-glycero-beta-D-manno-heptose-7-phosphate kinase/D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase HldE	A0A0K0KVL9	Prochlorococcus_phage	2.0e-20	39.7

DBSCAN-SWA_129

1937062 : 1942076

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387330.1\|1937062_1938853_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	6.0e-54	29.9
WP_152387331.1\|1938886_1939537_+	phosphotransferase	NA	NA	NA	NA
WP_167520107.1\|1939574_1940753_-	O-antigen ligase family protein	NA	NA	NA	NA
WP_152387332.1\|1941068_1942076_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.3e-77	44.1

DBSCAN-SWA_130

1947771 : 1949526

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387338.1\|1947771_1949526_-	carbamoyltransferase	E3SL71	Synechococcus_phage	3.7e-40	26.5

DBSCAN-SWA_131

1974614 : 1981122

Microcystis_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387355.1\|1974614_1976078_+	YdiU family protein	A0A075BSJ0	Microcystis_phage	3.3e-58	33.0
WP_152387356.1\|1976193_1976526_-	DUF1992 domain-containing protein	NA	NA	NA	NA
WP_152387357.1\|1976717_1977695_+	TSUP family transporter	NA	NA	NA	NA
WP_152387358.1\|1977806_1978241_+	thioredoxin TrxC	A0A0A7CHH9	Dinoroseobacter_phage	3.7e-10	35.7
WP_152387359.1\|1978342_1979158_+	universal stress protein	NA	NA	NA	NA
WP_152387360.1\|1979355_1980126_-	AAA family ATPase	NA	NA	NA	NA
WP_152387361.1\|1980195_1981122_-	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.4e-06	24.5

DBSCAN-SWA_132

1993224 : 1995339

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167520048.1\|1993224_1995339_-	type IV pilus secretin PilQ	R9TEZ5	Vibrio_phage	1.4e-17	24.3

DBSCAN-SWA_133

2003153 : 2017166

Anoxybacillus_phage(20.0%)

tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389842.1\|2003153_2003936_-	thermonuclease family protein	A0A2P1JU10	Anoxybacillus_phage	9.7e-09	34.3
WP_152387377.1\|2003977_2004190_-	50S ribosomal protein L31	NA	NA	NA	NA
WP_152387378.1\|2004364_2006584_+	primosomal protein N'	NA	NA	NA	NA
WP_152387379.1\|2006739_2008479_+\|tRNA	arginine--tRNA ligase	A0A2K9L2F0	Tupanvirus	6.1e-88	36.5
WP_152387380.1\|2008501_2009290_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_152387381.1\|2009404_2009932_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_152387382.1\|2010031_2011372_+	HslU--HslV peptidase ATPase subunit	A0A2H5BJT2	Erwinia_phage	4.5e-46	29.6
WP_152387383.1\|2011510_2011885_+	DUF971 domain-containing protein	NA	NA	NA	NA
WP_152387384.1\|2011964_2012735_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_152387385.1\|2012734_2013358_+	SCP2 domain-containing protein	NA	NA	NA	NA
WP_152387386.1\|2013354_2014974_+	ubiquinone biosynthesis regulatory protein kinase UbiB	M4R0M8	Ostreococcus_lucimarinus_virus	1.9e-35	28.7
WP_152387387.1\|2015014_2015416_+	phosphoribosyl-AMP cyclohydrolase	NA	NA	NA	NA
WP_152387388.1\|2015408_2015741_+	phosphoribosyl-ATP diphosphatase	NA	NA	NA	NA
WP_152387389.1\|2015791_2016025_+	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_152387390.1\|2016027_2016405_+	Sec-independent protein translocase subunit TatB	NA	NA	NA	NA
WP_152387391.1\|2016401_2017166_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.0e-27	32.2

DBSCAN-SWA_134

2031671 : 2036234

Acanthamoeba_castellanii_mimivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387402.1\|2031671_2032250_-	lipocalin	A0A1E1EXN3	Acanthamoeba_castellanii_mimivirus	4.6e-16	35.8
WP_152387403.1\|2032246_2032501_-	outer membrane protein assembly factor BamE	NA	NA	NA	NA
WP_152387404.1\|2032652_2033663_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	1.0e-50	35.8
WP_152387405.1\|2033786_2036234_-	glycogen/starch/alpha-glucan family phosphorylase	A0A140XAG6	Dickeya_phage	6.1e-09	45.7

DBSCAN-SWA_135

2042916 : 2043770

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386036.1\|2042916_2043770_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5

DBSCAN-SWA_136

2049779 : 2050817

Leptospira_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386602.1\|2049779_2050817_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6

DBSCAN-SWA_137

2062779 : 2063865

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387426.1\|2062779_2063865_+	nitrogen regulation protein NR(II)	Q8QKV7	Ectocarpus_siliculosus_virus	1.8e-05	22.1

DBSCAN-SWA_138

2106414 : 2108325

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387461.1\|2106414_2108325_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.2e-17	34.3

DBSCAN-SWA_139

2113825 : 2117001

Sinorhizobium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387467.1\|2113825_2114170_-	DUF3175 domain-containing protein	A0A0F6TH17	Sinorhizobium_phage	1.4e-23	67.0
WP_152387468.1\|2114980_2116102_-	alanine dehydrogenase	NA	NA	NA	NA
WP_152387469.1\|2116242_2117001_-	slipin family protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	1.6e-24	30.7

DBSCAN-SWA_140

2134618 : 2135809

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387482.1\|2134618_2135809_+	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.3e-120	58.1

DBSCAN-SWA_141

2138878 : 2139445

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387485.1\|2138878_2139445_-	ADP compounds hydrolase NudE	D0R7J3	Paenibacillus_phage	2.8e-05	33.3

DBSCAN-SWA_142

2142587 : 2148148

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387489.1\|2142587_2144132_-	phosphoenolpyruvate carboxykinase	A0A2H4PQN1	Staphylococcus_phage	1.2e-130	48.3
WP_152387490.1\|2144418_2145312_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_152387491.1\|2145677_2147030_+	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	9.0e-79	37.6
WP_152387492.1\|2147026_2148148_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SG19	Hokovirus	1.8e-16	22.0

DBSCAN-SWA_143

2181545 : 2184646

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387517.1\|2181545_2182451_+	30S ribosomal protein S6--L-glutamate ligase	A0A1D7SR78	Cyanophage	6.8e-38	34.5
WP_152387518.1\|2182493_2183807_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	5.8e-06	23.0
WP_152387519.1\|2183905_2184646_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	7.7e-32	34.9

DBSCAN-SWA_144

2208575 : 2209994

Wolbachia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387531.1\|2208575_2209994_-\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.3e-61	32.8

DBSCAN-SWA_145

2227766 : 2229032

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387546.1\|2227766_2229032_-	phosphate permease	M4QMY4	Ostreococcus_lucimarinus_virus	2.1e-53	34.1

DBSCAN-SWA_146

2237220 : 2238021

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387555.1\|2237220_2238021_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.6e-17	32.5

DBSCAN-SWA_147

2241709 : 2250922

Mycobacterium_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389855.1\|2241709_2242861_-	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	B5LJF5	Mycobacterium_phage	1.4e-08	31.5
WP_152387560.1\|2243108_2244008_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152387561.1\|2244748_2245210_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_152387562.1\|2245262_2245757_-	protein-export chaperone SecB	NA	NA	NA	NA
WP_152387563.1\|2245783_2246038_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	4.7e-13	41.0
WP_152387564.1\|2246045_2246459_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_152387565.1\|2246639_2248175_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_152387566.1\|2248301_2249570_+	peptidoglycan DD-metalloendopeptidase family protein	G9BW84	Planktothrix_phage	4.6e-08	37.6
WP_152387567.1\|2249599_2250922_+	PDZ domain-containing protein	A0A0R6PIZ1	Moraxella_phage	6.0e-27	28.9

DBSCAN-SWA_148

2270922 : 2272821

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387586.1\|2270922_2272821_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.3e-19	36.1

DBSCAN-SWA_149

2291476 : 2300920

Pseudomonas_phage(71.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385958.1\|2291476_2292457_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152389857.1\|2293024_2293321_-	hypothetical protein	NA	NA	NA	NA
WP_152387597.1\|2293825_2294494_-	hypothetical protein	A0A0A0YUE3	Pseudomonas_phage	1.3e-17	37.6
WP_152387598.1\|2294497_2294857_-	hypothetical protein	NA	NA	NA	NA
WP_152387599.1\|2295189_2297412_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	6.2e-234	68.8
WP_152387600.1\|2297408_2297639_-	hypothetical protein	A0A1B0VRK9	Pseudomonas_phage	2.6e-10	50.6
WP_152387601.1\|2297635_2297818_-	hypothetical protein	NA	NA	NA	NA
WP_167520060.1\|2297810_2297966_-	hypothetical protein	NA	NA	NA	NA
WP_152387602.1\|2298331_2298634_-	hypothetical protein	NA	NA	NA	NA
WP_152387603.1\|2298630_2298897_-	hypothetical protein	NA	NA	NA	NA
WP_152387604.1\|2298893_2299088_-	hypothetical protein	NA	NA	NA	NA
WP_167520061.1\|2299084_2299258_-	hypothetical protein	A0A1B0VP73	Pseudomonas_phage	5.4e-05	61.2
WP_152387605.1\|2299560_2299800_-	hypothetical protein	NA	NA	NA	NA
WP_152387606.1\|2299796_2300546_-	ORF6N domain-containing protein	A0A1B5FPC0	Escherichia_phage	9.3e-25	45.8
WP_152387607.1\|2300542_2300920_-	hypothetical protein	A0A1B0VRK7	Pseudomonas_phage	4.5e-28	67.0

DBSCAN-SWA_150

2310372 : 2310978

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387615.1\|2310372_2310978_-	hypothetical protein	A0A1B0VMK2	Pseudomonas_phage	2.4e-31	42.1

DBSCAN-SWA_151

2315838 : 2316594

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387618.1\|2315838_2316594_-	serine/threonine protein phosphatase	A0A142EZR4	Stenotrophomonas_phage	1.3e-26	31.0

DBSCAN-SWA_152

2353737 : 2355120

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387645.1\|2353737_2355120_+	sigma 54-interacting transcriptional regulator	W8CYM9	Bacillus_phage	4.5e-09	30.4

DBSCAN-SWA_153

2363633 : 2391624

Pseudomonas_phage(23.08%)

integrase

attL 2370603:2370626|attR 2390426:2390449

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387653.1\|2363633_2365307_+	NAD-dependent DNA ligase LigB	A0A1L7N1Q6	Ralstonia_phage	6.9e-28	25.3
WP_152387654.1\|2365402_2365903_-	cytochrome c	NA	NA	NA	NA
WP_152387655.1\|2366108_2367518_+	adenosylhomocysteinase	S4W1G4	Pandoravirus	8.1e-38	30.5
WP_152387656.1\|2367721_2368567_+	methylenetetrahydrofolate reductase [NAD(P)H]	NA	NA	NA	NA
WP_152387657.1\|2368791_2370579_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.3e-45	31.1
2370603:2370626	attL	NA	NA	NA	NA
WP_152387658.1\|2370796_2371783_+	hypothetical protein	Q6V7L9	Burkholderia_virus	2.3e-39	45.5
WP_152387659.1\|2371745_2372798_+	TraN	A0A0R6PHM5	Moraxella_phage	6.6e-37	39.4
WP_152387660.1\|2372815_2373109_+	hypothetical protein	NA	NA	NA	NA
WP_061291112.1\|2373970_2374162_+	hypothetical protein	NA	NA	NA	NA
WP_152387661.1\|2374233_2377254_+	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	7.8e-22	24.1
WP_152387662.1\|2377257_2378550_+	restriction endonuclease subunit S	NA	NA	NA	NA
WP_152387663.1\|2378553_2379720_+	AAA family ATPase	NA	NA	NA	NA
WP_152387664.1\|2379892_2381545_+	type I restriction-modification system subunit M	A0A2H4PQP4	Staphylococcus_phage	5.1e-108	43.4
WP_152387665.1\|2381853_2382078_-	hypothetical protein	NA	NA	NA	NA
WP_152387666.1\|2382327_2382540_-	hypothetical protein	NA	NA	NA	NA
WP_152389861.1\|2382640_2382835_-	hypothetical protein	A0A1B0VML7	Pseudomonas_phage	7.2e-14	68.8
WP_152387667.1\|2383352_2385158_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	2.0e-243	69.5
WP_152387668.1\|2385144_2386128_-	DNA primase	A0A1B0VML8	Pseudomonas_phage	2.3e-55	59.1
WP_152387669.1\|2386120_2386360_-	hypothetical protein	NA	NA	NA	NA
WP_167520110.1\|2386363_2386669_-	hypothetical protein	NA	NA	NA	NA
WP_167520111.1\|2386665_2386839_-	hypothetical protein	NA	NA	NA	NA
WP_152387671.1\|2387217_2388048_-	hypothetical protein	A0A1B5FPC0	Escherichia_phage	9.0e-21	40.8
WP_152387672.1\|2388049_2388286_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_152387673.1\|2388397_2388907_-	hypothetical protein	NA	NA	NA	NA
WP_152387674.1\|2389006_2390254_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A088F800	Sulfitobacter_phage	9.0e-41	33.7
WP_152387675.1\|2390474_2391053_-	YceI family protein	NA	NA	NA	NA
2390426:2390449	attR	NA	NA	NA	NA
WP_152387676.1\|2391069_2391624_-	DUF4405 domain-containing protein	A0A0U2QLA7	Escherichia_phage	3.5e-05	36.0

DBSCAN-SWA_154

2397852 : 2408856

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387682.1\|2397852_2404695_-	response regulator	W8CYM9	Bacillus_phage	3.9e-13	33.3
WP_152389863.1\|2404716_2405586_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_152387683.1\|2405671_2407720_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-16	39.3
WP_152387684.1\|2407903_2408446_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_152387685.1\|2408490_2408856_-	response regulator	W8CYM9	Bacillus_phage	4.8e-11	34.2

DBSCAN-SWA_155

2415487 : 2415889

Aeromonas_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387693.1\|2415487_2415889_-	NINE protein	Q19CT9	Aeromonas_virus	2.2e-09	42.6

DBSCAN-SWA_156

2425292 : 2479280

Escherichia_phage(20.0%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387706.1\|2425292_2426015_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_152387707.1\|2426104_2426899_-	thiazole synthase	NA	NA	NA	NA
WP_152387708.1\|2426989_2427190_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_152387709.1\|2427276_2427654_-	DUF423 domain-containing protein	NA	NA	NA	NA
WP_152387710.1\|2427690_2428437_+	monofunctional biosynthetic peptidoglycan transglycosylase	NA	NA	NA	NA
WP_152387711.1\|2428449_2429124_-	DNA repair protein RadC	NA	NA	NA	NA
WP_152389864.1\|2429279_2430488_+	bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC	Q9HH70	Methanothermobacter_phage	9.6e-40	32.2
WP_152387712.1\|2430495_2430951_+	dUTP diphosphatase	Q2NP83	Xanthomonas_phage	1.3e-50	63.9
WP_152387713.1\|2431058_2432525_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.2e-57	31.9
WP_152387714.1\|2432661_2433564_+	acetylglutamate kinase	NA	NA	NA	NA
WP_152387715.1\|2433683_2435138_-	DUF3360 family protein	NA	NA	NA	NA
WP_152387716.1\|2435504_2436146_-	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_152387717.1\|2436226_2437006_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_152387718.1\|2437057_2437426_-	DUF4870 domain-containing protein	NA	NA	NA	NA
WP_152387719.1\|2437442_2438162_-	ribonuclease PH	NA	NA	NA	NA
WP_152387720.1\|2438303_2439167_+	YicC family protein	NA	NA	NA	NA
WP_152387721.1\|2439207_2439825_+	guanylate kinase	K4JYM5	Abalone_herpesvirus	2.3e-21	38.6
WP_152387722.1\|2439861_2440665_-	TSUP family transporter	NA	NA	NA	NA
WP_152387723.1\|2441065_2441329_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_152387724.1\|2441389_2443498_+	bifunctional GTP diphosphokinase/guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	1.9e-11	34.0
WP_152387725.1\|2443552_2443936_+	RidA family protein	NA	NA	NA	NA
WP_152389865.1\|2444168_2444687_-	aspartate carbamoyltransferase	NA	NA	NA	NA
WP_152387726.1\|2444803_2445076_-	MoaD/ThiS family protein	NA	NA	NA	NA
WP_152389866.1\|2445092_2445806_-	HesA/MoeB/ThiF family protein	NA	NA	NA	NA
WP_152387727.1\|2445939_2447073_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	1.7e-09	34.5
WP_152387728.1\|2447708_2449070_-	aromatic acid/H+ symport family MFS transporter	NA	NA	NA	NA
WP_152387729.1\|2449424_2449643_-	DUF465 domain-containing protein	NA	NA	NA	NA
WP_152387730.1\|2449922_2450480_+	AAA family ATPase	NA	NA	NA	NA
WP_152385958.1\|2450974_2451955_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152389867.1\|2452285_2452753_+	hemolysin E	NA	NA	NA	NA
WP_152387731.1\|2452868_2453282_+	hemolysin E	NA	NA	NA	NA
WP_152385958.1\|2453414_2454395_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152386229.1\|2454612_2455593_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.0e-92	55.2
WP_152387732.1\|2455941_2456553_-	PAS domain S-box protein	NA	NA	NA	NA
WP_152387733.1\|2456866_2457901_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.4e-58	34.6
WP_152387734.1\|2457933_2460444_-	magnesium-translocating P-type ATPase	M1HX51	Paramecium_bursaria_Chlorella_virus	2.7e-36	23.0
WP_152387735.1\|2461270_2463001_+	DUF3459 domain-containing protein	NA	NA	NA	NA
WP_152387736.1\|2463055_2464273_+	DUF4432 family protein	NA	NA	NA	NA
WP_152387737.1\|2464429_2466466_-	AsmA family protein	NA	NA	NA	NA
WP_152387738.1\|2466693_2467518_+	alpha/beta fold hydrolase	A0A076YK43	Mycobacterium_phage	1.7e-19	27.8
WP_152387739.1\|2467641_2467833_-	CsbD family protein	NA	NA	NA	NA
WP_152389868.1\|2468043_2468295_-	hypothetical protein	NA	NA	NA	NA
WP_152387740.1\|2468446_2468926_-	DUF3429 family protein	NA	NA	NA	NA
WP_152387741.1\|2469112_2469919_+	deoxyribonuclease	NA	NA	NA	NA
WP_152387742.1\|2469963_2470191_-	hypothetical protein	NA	NA	NA	NA
WP_152387743.1\|2470624_2470912_+	stress-induced protein	NA	NA	NA	NA
WP_152387744.1\|2471182_2471734_+\|protease	Clp protease	NA	NA	NA	NA
WP_152387745.1\|2471785_2471998_-	hypothetical protein	NA	NA	NA	NA
WP_152389869.1\|2472265_2473069_+	hypothetical protein	NA	NA	NA	NA
WP_152387746.1\|2473121_2473643_+	hypothetical protein	A0A2K9L4K0	Tupanvirus	2.1e-15	31.4
WP_152387747.1\|2473658_2474153_-	hypothetical protein	NA	NA	NA	NA
WP_152387748.1\|2474262_2475120_-	glycosyltransferase	NA	NA	NA	NA
WP_152387749.1\|2475312_2475582_-	hypothetical protein	NA	NA	NA	NA
WP_152387750.1\|2476382_2476703_-	chaperone modulatory protein CbpM	NA	NA	NA	NA
WP_152387751.1\|2476684_2477626_-	curved DNA-binding protein	A0A1V0SIM1	Klosneuvirus	2.3e-12	51.4
WP_152387752.1\|2477831_2478083_+	hypothetical protein	NA	NA	NA	NA
WP_152386036.1\|2478427_2479280_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5

DBSCAN-SWA_157

2486368 : 2493114

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387760.1\|2486368_2487406_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	1.0e-85	47.9
WP_152387761.1\|2487728_2488952_+	glycosyltransferase	NA	NA	NA	NA
WP_152387762.1\|2488894_2490094_+	UDP-galactopyranose mutase	E4ZFQ1	Streptococcus_phage	1.5e-69	39.7
WP_152387763.1\|2490172_2491318_+	beta-glucosidase	NA	NA	NA	NA
WP_152387764.1\|2491314_2493114_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.3e-43	27.9

DBSCAN-SWA_158

2500565 : 2502008

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387771.1\|2500565_2502008_+	glucose-6-phosphate dehydrogenase	M4SP85	Cyanophage	3.2e-82	38.0

DBSCAN-SWA_159

2505492 : 2506269

Sphingobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387776.1\|2505492_2506269_+	N-acetylmuramoyl-L-alanine amidase	A0A1W6DX33	Sphingobium_phage	1.6e-08	33.6

DBSCAN-SWA_160

2512044 : 2512575

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387783.1\|2512044_2512575_-	acyloxyacyl hydrolase	A0A2H4J0I5	uncultured_Caudovirales_phage	2.2e-49	61.4

DBSCAN-SWA_161

2518221 : 2518980

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386438.1\|2518221_2518980_+\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.4e-22	45.0

DBSCAN-SWA_162

2543837 : 2545160

Agrobacterium_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387802.1\|2543837_2545160_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	A0A2L0UZ48	Agrobacterium_phage	1.7e-90	46.1

DBSCAN-SWA_163

2548225 : 2554442

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387807.1\|2548225_2549380_-	homocitrate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	8.7e-06	24.6
WP_152387808.1\|2549449_2550658_-	cysteine desulfurase NifS	NA	NA	NA	NA
WP_152387809.1\|2550659_2551601_-	Fe-S cluster assembly protein NifU	A0A2H4N7M4	Lake_Baikal_phage	4.0e-25	50.8
WP_039800873.1\|2551665_2551989_-	iron-sulfur cluster assembly accessory protein	A0A2H4N7M3	Lake_Baikal_phage	4.6e-13	39.6
WP_152387810.1\|2552230_2552992_-	hypothetical protein	NA	NA	NA	NA
WP_152387811.1\|2553365_2554442_+	molybdenum ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.4e-10	26.2

DBSCAN-SWA_164

2581443 : 2581935

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387840.1\|2581443_2581935_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.8e-19	41.7

DBSCAN-SWA_165

2591352 : 2602029

Indivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387848.1\|2591352_2593398_+	oligopeptidase A	A0A1V0SD92	Indivirus	9.9e-37	22.8
WP_152387849.1\|2593407_2593689_+	YheV family putative metal-binding protein	NA	NA	NA	NA
WP_152387850.1\|2593732_2594047_-	hypothetical protein	NA	NA	NA	NA
WP_152389880.1\|2594228_2595005_+	DUF1835 domain-containing protein	NA	NA	NA	NA
WP_152387851.1\|2595528_2596275_+	carbonic anhydrase	NA	NA	NA	NA
WP_152387852.1\|2596377_2597952_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	2.2e-23	24.2
WP_152387853.1\|2598097_2598775_-	hypothetical protein	NA	NA	NA	NA
WP_152387855.1\|2599247_2600423_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_152387856.1\|2600436_2602029_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	9.8e-08	34.0

DBSCAN-SWA_166

2608060 : 2609044

Acanthamoeba_castellanii_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387865.1\|2608060_2609044_+	zinc-binding alcohol dehydrogenase family protein	A0A1E1EWH3	Acanthamoeba_castellanii_mimivirus	2.8e-21	30.9

DBSCAN-SWA_167

2612287 : 2648593

Bacillus_phage(18.18%)

transposase,tRNA,integrase

attL 2612731:2612746|attR 2633994:2634009

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387868.1\|2612287_2613058_-	zinc ABC transporter ATP-binding protein ZnuC	A0A2H4PQG7	Staphylococcus_phage	6.8e-15	29.7
2612731:2612746	attL	NA	NA	NA	NA
WP_152387869.1\|2613054_2613540_-	transcriptional repressor	NA	NA	NA	NA
WP_152387870.1\|2613602_2614502_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_152387871.1\|2614622_2615558_+	transglutaminase family protein	NA	NA	NA	NA
WP_152387872.1\|2615588_2618852_+	ribonucleoside-diphosphate reductase	F9VHP7	Thermus_phage	6.1e-97	27.5
WP_152387873.1\|2619109_2619793_+	NrdJb	A0A191VYJ2	Roseobacter_phage	1.4e-27	41.3
WP_152387874.1\|2619856_2620822_-\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	6.7e-68	44.7
WP_152389882.1\|2621035_2621449_+	hypothetical protein	NA	NA	NA	NA
WP_152387875.1\|2621527_2621899_+	hypothetical protein	NA	NA	NA	NA
WP_152387876.1\|2621870_2622548_+	hypothetical protein	NA	NA	NA	NA
WP_152387877.1\|2622883_2624410_+\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_152387878.1\|2624618_2625143_+	hypothetical protein	NA	NA	NA	NA
WP_152386010.1\|2625189_2626287_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152386036.1\|2626296_2627150_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152385832.1\|2627491_2628472_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.2e-93	55.6
WP_152387879.1\|2628648_2629740_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152389883.1\|2630187_2631234_-	hypothetical protein	NA	NA	NA	NA
WP_167520064.1\|2631916_2632375_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_152387881.1\|2632498_2633341_+	alpha/beta fold hydrolase	A0A076YK43	Mycobacterium_phage	4.9e-06	28.1
WP_152387882.1\|2633562_2634513_-	homoserine kinase	NA	NA	NA	NA
2633994:2634009	attR	NA	NA	NA	NA
WP_152387883.1\|2634529_2634817_-	DUF2782 domain-containing protein	NA	NA	NA	NA
WP_152387884.1\|2634890_2637617_+	DNA polymerase I	A0A0C5K9B9	Enterococcus_phage	4.5e-45	27.4
WP_152387885.1\|2638131_2638533_-	hypothetical protein	NA	NA	NA	NA
WP_152387886.1\|2638963_2639272_-	hypothetical protein	NA	NA	NA	NA
WP_152387887.1\|2639327_2639639_-	hypothetical protein	NA	NA	NA	NA
WP_152387888.1\|2639637_2640999_+\|tRNA	tRNA 5-hydroxyuridine modification protein YegQ	Q6DW11	Phage_TP	4.9e-165	76.2
WP_152387889.1\|2641002_2643174_-	EAL domain-containing protein	NA	NA	NA	NA
WP_152387890.1\|2643291_2645472_+	DNA helicase II	A7KV33	Bacillus_phage	5.1e-116	37.3
WP_152387891.1\|2645573_2646140_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_152387892.1\|2646296_2647151_+	TIM44-like domain-containing protein	NA	NA	NA	NA
WP_152387893.1\|2647198_2648593_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.0e-21	39.1

DBSCAN-SWA_168

2652312 : 2653866

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387897.1\|2652312_2653866_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.1e-17	35.5

DBSCAN-SWA_169

2661640 : 2662135

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387905.1\|2661640_2662135_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	5.7e-15	39.4

DBSCAN-SWA_170

2669305 : 2672209

Thermus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387913.1\|2669305_2670406_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	2.5e-26	37.0
WP_152387914.1\|2670521_2671550_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_152387915.1\|2671702_2672209_+	peptide deformylase	E3SLL2	Synechococcus_phage	6.7e-19	40.3

DBSCAN-SWA_171

2683634 : 2685053

Wolbachia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387924.1\|2683634_2685053_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.3e-61	32.8

DBSCAN-SWA_172

2688635 : 2693284

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387926.1\|2688635_2691056_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	3.1e-114	34.9
WP_152387927.1\|2691061_2692162_-	DNA replication/repair protein RecF	NA	NA	NA	NA
WP_152387928.1\|2692180_2693284_-	DNA polymerase III subunit beta	B4UTW9	Rhizobium_phage	4.6e-57	36.7

DBSCAN-SWA_173

2702325 : 2704002

Natrialba_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387937.1\|2702325_2703114_+	AAA family ATPase	Q8JL10	Natrialba_phage	7.7e-22	30.0
WP_152387938.1\|2703123_2704002_+	ParB/RepB/Spo0J family partition protein	I3NLC2	Bifidobacterium_phage	5.6e-13	32.7

DBSCAN-SWA_174

2723394 : 2724114

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387952.1\|2723394_2724114_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	9.2e-14	32.4

DBSCAN-SWA_175

2730099 : 2737569

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387957.1\|2730099_2731464_+	bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU	A0A0N7G7I9	Chrysochromulina_ericina_virus	2.5e-28	35.4
WP_152387958.1\|2731637_2732402_+	DeoR family transcriptional regulator	A0A077SK06	Escherichia_phage	2.0e-22	31.5
WP_152387959.1\|2732415_2734251_+	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.6e-131	42.5
WP_152387960.1\|2734335_2734995_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_152387961.1\|2735114_2735675_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_152387962.1\|2735943_2737569_-	glycoside hydrolase family 32 protein	F8WPR5	Bacillus_phage	3.0e-97	38.9

DBSCAN-SWA_176

2744000 : 2744999

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152387967.1\|2744000_2744999_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	4.3e-17	24.4

DBSCAN-SWA_177

2748084 : 2810148

uncultured_Caudovirales_phage(16.67%)

transposase,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385914.1\|2748084_2749125_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1
WP_152387969.1\|2749302_2750781_-	sucrose-6-phosphate hydrolase	NA	NA	NA	NA
WP_152387970.1\|2750879_2752163_-	oligosaccharide MFS transporter	NA	NA	NA	NA
WP_152387971.1\|2752427_2754047_+	porin	NA	NA	NA	NA
WP_152387972.1\|2754620_2756642_+	glycoside hydrolase family 97 protein	NA	NA	NA	NA
WP_152387973.1\|2756898_2757516_-	hemolysin III family protein	NA	NA	NA	NA
WP_152387974.1\|2757800_2758124_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_152387975.1\|2758307_2759642_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	1.1e-55	36.1
WP_152387976.1\|2759775_2763231_+	exodeoxyribonuclease V subunit gamma	NA	NA	NA	NA
WP_152387977.1\|2763227_2766902_+	exodeoxyribonuclease V subunit beta	A0A068EQC7	Bacillus_phage	3.5e-08	22.3
WP_152387978.1\|2766898_2768974_+	exodeoxyribonuclease V subunit alpha	A0A0K2FLP8	Brevibacillus_phage	3.1e-14	21.3
WP_152389892.1\|2769002_2769359_+	DUF559 domain-containing protein	NA	NA	NA	NA
WP_167520065.1\|2769959_2772197_+	diguanylate cyclase	G3MA91	Bacillus_virus	4.4e-14	32.0
WP_152387980.1\|2772413_2772923_-	hypothetical protein	NA	NA	NA	NA
WP_152387981.1\|2772919_2774203_-	AAA family ATPase	NA	NA	NA	NA
WP_152387982.1\|2774525_2775209_+	DUF2170 family protein	NA	NA	NA	NA
WP_152387983.1\|2775224_2775926_+	PspA/IM30 family protein	NA	NA	NA	NA
WP_152387984.1\|2775984_2776317_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_152387985.1\|2776357_2777395_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	8.3e-40	30.0
WP_152387986.1\|2777295_2777700_+\|protease	rhomboid family intramembrane serine protease	NA	NA	NA	NA
WP_152387987.1\|2777758_2778793_+	potassium channel protein	NA	NA	NA	NA
WP_152387988.1\|2778779_2779433_+	DUF2491 family protein	NA	NA	NA	NA
WP_152387989.1\|2779447_2779870_+	DUF350 domain-containing protein	NA	NA	NA	NA
WP_152387990.1\|2779890_2780580_+	DUF1190 domain-containing protein	NA	NA	NA	NA
WP_152387991.1\|2780589_2781747_+	glutathionylspermidine synthase family protein	B2ZXR7	Ralstonia_phage	2.2e-78	42.4
WP_167520001.1\|2781842_2782001_-	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|2782150_2783131_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152387993.1\|2783617_2784574_+	hypothetical protein	NA	NA	NA	NA
WP_152387994.1\|2784985_2786689_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-08	58.7
WP_152387995.1\|2786812_2788618_-	EAL domain-containing protein	NA	NA	NA	NA
WP_152387996.1\|2788738_2789359_-	phosphoesterase	NA	NA	NA	NA
WP_152387997.1\|2789488_2790388_+	lipid A hydroxylase LpxO	H8ZJK8	Ostreococcus_tauri_virus	6.5e-33	36.6
WP_152387998.1\|2790490_2791546_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152387999.1\|2791724_2792630_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152388000.1\|2792764_2793463_+	3-oxoacid CoA-transferase subunit A	NA	NA	NA	NA
WP_152388001.1\|2793496_2794153_+	3-oxoacid CoA-transferase subunit B	NA	NA	NA	NA
WP_152388002.1\|2794186_2795377_+	acetyl-CoA C-acetyltransferase	NA	NA	NA	NA
WP_152388003.1\|2795422_2796058_+	hydroxybutyryl-CoA dehydrogenase	NA	NA	NA	NA
WP_152388004.1\|2796115_2797648_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_152388005.1\|2797644_2800776_-	efflux RND transporter permease subunit	NA	NA	NA	NA
WP_152388006.1\|2800779_2801931_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_152388007.1\|2802143_2802929_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152388008.1\|2802963_2804007_-	L-glyceraldehyde 3-phosphate reductase	NA	NA	NA	NA
WP_152388009.1\|2804586_2806305_-	porin	NA	NA	NA	NA
WP_152388010.1\|2806522_2806870_-	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|2808064_2809045_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152388011.1\|2809110_2810148_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	2.8e-40	30.0

DBSCAN-SWA_178

2815046 : 2815829

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388016.1\|2815046_2815829_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	3.2e-12	31.7

DBSCAN-SWA_179

2827710 : 2836179

Oenococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_131341830.1\|2827710_2828859_+	galactonate dehydratase	Q6A202	Oenococcus_phage	4.7e-60	37.3
WP_152388027.1\|2828966_2830271_+	MFS transporter	NA	NA	NA	NA
WP_152388028.1\|2830326_2832915_-	poly(beta-D-mannuronate) C5 epimerase	D4P713	Rhodococcus_phage	4.6e-07	46.8
WP_152388029.1\|2833022_2833292_-	hypothetical protein	NA	NA	NA	NA
WP_152388030.1\|2833608_2836179_+	poly(beta-D-mannuronate) C5 epimerase	A6M964	Geobacillus_virus	9.3e-08	37.0

DBSCAN-SWA_180

2840285 : 2852177

Geobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388031.1\|2840285_2842907_+	poly(beta-D-mannuronate) C5 epimerase	A6M964	Geobacillus_virus	1.0e-06	34.5
WP_152388032.1\|2843177_2844863_+	poly(beta-D-mannuronate) C5 epimerase	D4P713	Rhodococcus_phage	2.0e-06	59.6
WP_152388033.1\|2845163_2848925_+	poly(beta-D-mannuronate) C5 epimerase	A6M964	Geobacillus_virus	1.0e-07	40.2
WP_152388034.1\|2849189_2852177_+	poly(beta-D-mannuronate) C5 epimerase	Q2TLV7	Gordonia_phage	1.8e-07	30.8

DBSCAN-SWA_181

2883073 : 2884024

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388066.1\|2883073_2884024_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.8e-26	38.4

DBSCAN-SWA_182

2887114 : 2893430

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167520113.1\|2887114_2888200_+	molybdenum ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.4e-21	31.7
WP_152388072.1\|2888206_2889169_-	FAD-dependent oxidoreductase	A0A2K9L4X0	Tupanvirus	9.1e-17	27.6
WP_152388073.1\|2889305_2890349_-	response regulator	A0A220YL79	Alteromonas_virus	1.1e-07	24.7
WP_167520114.1\|2890382_2893430_-	response regulator	A0A1V0SGX0	Hokovirus	4.4e-65	32.5

DBSCAN-SWA_183

2914012 : 2916112

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167520066.1\|2914012_2916112_+	AMP-binding protein	A0A2K9KZV5	Tupanvirus	1.5e-11	31.9

DBSCAN-SWA_184

2927220 : 2932518

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388103.1\|2927220_2932518_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.1e-106	25.4

DBSCAN-SWA_185

2937506 : 2952739

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388105.1\|2937506_2940854_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	5.9e-87	24.5
WP_152388106.1\|2940857_2948648_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.0e-77	19.7
WP_152388107.1\|2948647_2952739_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.0e-93	26.3

DBSCAN-SWA_186

2956768 : 2962176

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388110.1\|2956768_2957812_+	histone deacetylase family protein	A0A2K9L4C2	Tupanvirus	4.7e-35	35.4
WP_152388111.1\|2957927_2960408_+	penicillin acylase family protein	NA	NA	NA	NA
WP_152388112.1\|2960514_2962176_+	cyclic peptide export ABC transporter	F2Y165	Organic_Lake_phycodnavirus	1.3e-07	25.3

DBSCAN-SWA_187

2970608 : 2975903

Paenibacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386010.1\|2970608_2971706_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152388117.1\|2971793_2972891_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152388118.1\|2972978_2974076_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_152388119.1\|2974085_2974475_-\|transposase	transposase	NA	NA	NA	NA
WP_152388120.1\|2974360_2974762_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	4.1e-19	39.4
WP_152388121.1\|2974865_2975903_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.4e-41	30.3

DBSCAN-SWA_188

3065760 : 3067422

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389905.1\|3065760_3067422_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	3.1e-12	32.5

DBSCAN-SWA_189

3072104 : 3074104

Acanthocystis_turfacea_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388188.1\|3072104_3073211_-	agmatine deiminase	M1ICB7	Acanthocystis_turfacea_Chlorella_virus	1.9e-103	48.6
WP_152388189.1\|3073225_3074104_-	N-carbamoylputrescine amidase	A7IVZ1	Paramecium_bursaria_Chlorella_virus	5.3e-80	49.3

DBSCAN-SWA_190

3084081 : 3088185

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385958.1\|3084081_3085062_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_167520073.1\|3085613_3086771_+	extracellular solute-binding protein	NA	NA	NA	NA
WP_152388196.1\|3087033_3088185_+	polyamine ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-26	34.7

DBSCAN-SWA_191

3104714 : 3113390

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388212.1\|3104714_3105548_+	phosphate ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.5e-18	30.5
WP_152388213.1\|3105612_3106356_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_152388214.1\|3106487_3107444_+	peptidoglycan DD-metalloendopeptidase family protein	S5M424	Bacillus_phage	2.7e-13	40.0
WP_152388215.1\|3107487_3108828_-	DUF21 domain-containing protein	NA	NA	NA	NA
WP_152388216.1\|3108885_3110208_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.6e-30	34.1
WP_152388217.1\|3110248_3110938_-	phosphate regulon transcriptional regulator PhoB	W8CYM9	Bacillus_phage	1.2e-34	38.2
WP_152388218.1\|3111055_3111943_-	4-hydroxybenzoate octaprenyltransferase	NA	NA	NA	NA
WP_152388219.1\|3111972_3112524_-	chorismate lyase	NA	NA	NA	NA
WP_152388220.1\|3112706_3112874_+	rubredoxin	NA	NA	NA	NA
WP_131252852.1\|3113117_3113390_+	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	1.0e-13	48.3

DBSCAN-SWA_192

3128993 : 3130223

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388232.1\|3128993_3130223_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	3.1e-110	50.1

DBSCAN-SWA_193

3139906 : 3158886

Hokovirus(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388242.1\|3139906_3142186_+	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	1.1e-15	27.7
WP_152388243.1\|3142247_3143282_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-11	40.2
WP_152388244.1\|3143341_3144091_-	hypothetical protein	A0A0M3ZEJ9	Turkeypox_virus	4.2e-25	30.0
WP_152388245.1\|3144217_3145000_+	TSUP family transporter	NA	NA	NA	NA
WP_152388246.1\|3145011_3145839_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_152388247.1\|3145950_3146745_+	thymidylate synthase	A6M9A2	Geobacillus_virus	2.3e-106	68.6
WP_167520074.1\|3147066_3148434_-	DUF3482 domain-containing protein	A0A0R6PFW5	Moraxella_phage	3.7e-56	38.9
WP_152388248.1\|3148426_3149818_-	DUF2868 domain-containing protein	NA	NA	NA	NA
WP_152388249.1\|3149929_3151042_-	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_152389911.1\|3151172_3151688_+	dihydrofolate reductase	A0A0A8JB64	Ralstonia_phage	1.9e-29	46.4
WP_167520115.1\|3151731_3152238_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_152389912.1\|3152771_3153200_-	hypothetical protein	NA	NA	NA	NA
WP_152388251.1\|3153631_3154774_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	3.3e-167	74.5
WP_152388252.1\|3154928_3157823_+	response regulator	A0A1V0SGX0	Hokovirus	1.1e-28	25.4
WP_152388253.1\|3157812_3158886_+	response regulator	W8CYM9	Bacillus_phage	1.0e-08	32.4

DBSCAN-SWA_194

3167957 : 3172278

Staphylococcus_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388262.1\|3167957_3168884_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	3.4e-21	30.7
WP_152388263.1\|3168967_3170548_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.7e-16	35.3
WP_152388264.1\|3170735_3171299_-\|protease	DJ-1/PfpI/YhbO family deglycase/protease	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	1.2e-16	33.1
WP_152388265.1\|3171465_3172278_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	G3MA33	Bacillus_virus	1.7e-24	30.6

DBSCAN-SWA_195

3182587 : 3183431

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388271.1\|3182587_3182839_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	1.3e-20	60.5
WP_152388272.1\|3182951_3183431_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	5.2e-29	44.3

DBSCAN-SWA_196

3186620 : 3192083

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388276.1\|3186620_3187967_-	insulinase family protein	G3MBJ8	Bacillus_virus	6.5e-21	24.8
WP_152388277.1\|3188092_3189454_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_152388278.1\|3189450_3190119_+	cell division ATP-binding protein FtsE	W6JKT0	Anomala_cuprea_entomopoxvirus	3.3e-13	26.4
WP_152388279.1\|3190118_3191126_+	FtsX-like permease family protein	NA	NA	NA	NA
WP_152388280.1\|3191228_3192083_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	9.8e-39	37.1

DBSCAN-SWA_197

3214704 : 3217561

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388298.1\|3214704_3215382_-	SNase-like protein	A0A0R6PHV6	Moraxella_phage	3.3e-29	35.1
WP_152388299.1\|3215551_3217561_-	DNA helicase Rep	A7KV33	Bacillus_phage	7.8e-119	38.1

DBSCAN-SWA_198

3223924 : 3228749

Ostreococcus_tauri_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388307.1\|3223924_3225241_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	5.2e-31	28.2
WP_152388308.1\|3225397_3225823_+	YjbQ family protein	NA	NA	NA	NA
WP_152388309.1\|3225946_3226267_+	hypothetical protein	NA	NA	NA	NA
WP_152389919.1\|3226333_3227119_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_152388310.1\|3227151_3227853_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_152388311.1\|3227849_3228749_-	tyrosine recombinase XerC	A0A1B3B212	Gordonia_phage	7.2e-16	38.4

DBSCAN-SWA_199

3243389 : 3245300

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388327.1\|3243389_3245300_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	8.9e-64	29.2

DBSCAN-SWA_200

3254504 : 3254831

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012703209.1\|3254504_3254831_+	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	1.7e-15	40.9

DBSCAN-SWA_201

3270456 : 3274041

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388350.1\|3270456_3273330_+	glycine dehydrogenase (aminomethyl-transferring)	E3SN07	Prochlorococcus_phage	1.1e-275	52.3
WP_152388351.1\|3273351_3274041_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	6.5e-25	34.1

DBSCAN-SWA_202

3293871 : 3358495

Tupanvirus(15.38%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388369.1\|3293871_3295728_-	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	9.9e-36	34.3
WP_152388370.1\|3295792_3297730_-	DNA primase	A0A1S5RF71	Helicobacter_phage	5.0e-46	34.2
WP_010795989.1\|3297826_3298042_-	30S ribosomal protein S21	NA	NA	NA	NA
WP_152388371.1\|3298243_3299269_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	6.6e-106	56.4
WP_152388372.1\|3299284_3299854_-	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_152388373.1\|3299919_3300273_+	dihydroneopterin aldolase	NA	NA	NA	NA
WP_152388374.1\|3300263_3300812_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_152388375.1\|3300824_3301205_-	sulfurtransferase	NA	NA	NA	NA
WP_152388376.1\|3301188_3303000_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	3.0e-13	24.6
WP_152388377.1\|3302999_3304742_-	TIGR01244 family phosphatase	NA	NA	NA	NA
WP_152388378.1\|3304763_3305630_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_152388379.1\|3305862_3307125_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	9.6e-75	45.4
WP_152388380.1\|3307244_3308807_-	SpoVR family protein	NA	NA	NA	NA
WP_152388381.1\|3308803_3310078_-	DUF444 family protein	A0A140HLI1	Bacillus_phage	2.2e-10	38.9
WP_152388382.1\|3310183_3312106_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_152388383.1\|3312463_3312802_-	thiosulfate sulfurtransferase GlpE	NA	NA	NA	NA
WP_152388384.1\|3312872_3313706_-	symmetrical bis(5'-nucleosyl)-tetraphosphatase	NA	NA	NA	NA
WP_152388385.1\|3313707_3314088_-	Co2+/Mg2+ efflux protein ApaG	NA	NA	NA	NA
WP_152388386.1\|3314128_3314947_-	16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA	NA	NA	NA	NA
WP_152388387.1\|3315083_3316082_-	4-hydroxythreonine-4-phosphate dehydrogenase PdxA	NA	NA	NA	NA
WP_167520079.1\|3316078_3317383_-	molecular chaperone SurA	NA	NA	NA	NA
WP_152388389.1\|3317351_3320111_-	LPS assembly protein LptD	NA	NA	NA	NA
WP_152388390.1\|3320243_3321266_+	phosphotransferase	NA	NA	NA	NA
WP_152388391.1\|3321262_3321931_+	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_152388392.1\|3321932_3322694_+	DnaJ domain-containing protein	NA	NA	NA	NA
WP_152388393.1\|3322828_3324109_+	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	1.1e-28	28.1
WP_152388394.1\|3324207_3324882_+	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_152388395.1\|3324878_3325586_+	phosphoglycolate phosphatase	NA	NA	NA	NA
WP_152388396.1\|3325681_3326575_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152388397.1\|3326660_3327437_+	flavodoxin family protein	NA	NA	NA	NA
WP_152388398.1\|3328027_3329506_+	anthranilate synthase component I	NA	NA	NA	NA
WP_152388399.1\|3329683_3330136_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_152388400.1\|3330295_3331054_-	hypothetical protein	NA	NA	NA	NA
WP_152388401.1\|3331747_3333283_+	DUF3459 domain-containing protein	NA	NA	NA	NA
WP_152388402.1\|3333285_3334908_+	glycosidase	NA	NA	NA	NA
WP_152388403.1\|3335013_3335625_+	exopolysaccharide biosynthesis protein	NA	NA	NA	NA
WP_152388404.1\|3335698_3336526_+\|transposase	transposase	NA	NA	NA	NA
WP_152388405.1\|3336553_3338788_-	alginate lyase	NA	NA	NA	NA
WP_152388406.1\|3339211_3340120_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152388407.1\|3340526_3340808_+	SgcJ/EcaC family oxidoreductase	NA	NA	NA	NA
WP_152385832.1\|3340862_3341843_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.2e-93	55.6
WP_152386468.1\|3342234_3343746_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	1.5e-122	52.1
WP_167520046.1\|3343827_3344163_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_152388408.1\|3344159_3344489_-\|transposase	transposase	NA	NA	NA	NA
WP_152388409.1\|3344513_3344996_+	AAA family ATPase	NA	NA	NA	NA
WP_152388410.1\|3345329_3346700_-\|transposase	transposase	NA	NA	NA	NA
WP_152388411.1\|3347509_3348367_+	EamA family transporter	NA	NA	NA	NA
WP_152388412.1\|3348386_3350366_-	S8 family serine peptidase	A0A2K9L570	Tupanvirus	8.8e-06	31.3
WP_152388413.1\|3351446_3352571_+\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	6.9e-24	28.3
WP_152388414.1\|3352653_3353700_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_167520080.1\|3353910_3354732_-	hypothetical protein	NA	NA	NA	NA
WP_152388416.1\|3354945_3356115_+	alcohol dehydrogenase catalytic domain-containing protein	A0A2K9L7I1	Tupanvirus	4.2e-08	26.0
WP_152388417.1\|3356125_3356692_+	hypothetical protein	NA	NA	NA	NA
WP_152388418.1\|3356755_3357808_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_152388419.1\|3357907_3358495_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A0G2Y1B6	Acanthamoeba_polyphaga_mimivirus	4.4e-14	46.1

DBSCAN-SWA_203

3362360 : 3369798

Pandoravirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388423.1\|3362360_3363473_-	poly-gamma-glutamate biosynthesis protein	S4VS02	Pandoravirus	4.5e-108	53.3
WP_152388424.1\|3363587_3364949_+	nicotinate phosphoribosyltransferase	G3MA18	Bacillus_virus	8.0e-67	37.0
WP_152388425.1\|3365136_3365760_-	bifunctional nicotinamidase/pyrazinamidase	A0A2K9L6K4	Tupanvirus	6.1e-22	36.5
WP_152388426.1\|3365756_3366737_-	ribose-phosphate diphosphokinase	NA	NA	NA	NA
WP_152388427.1\|3366797_3367808_-	phosphotransferase	NA	NA	NA	NA
WP_152388428.1\|3368034_3369798_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.2e-127	48.9

DBSCAN-SWA_204

3373356 : 3378767

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388433.1\|3373356_3374787_+	RNA-splicing ligase RtcB	A2RQD0	Archaeal_BJ1_virus	1.1e-106	45.2
WP_152388434.1\|3374908_3375688_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_152388435.1\|3375711_3376020_-	hypothetical protein	NA	NA	NA	NA
WP_152388436.1\|3376330_3376924_+	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.9e-73	63.7
WP_152388437.1\|3376923_3377970_+	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.5e-105	56.5
WP_152388438.1\|3377966_3378767_+	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.3e-69	56.9

DBSCAN-SWA_205

3384123 : 3387089

Lake_Baikal_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388446.1\|3384123_3384474_+	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	8.7e-26	51.4
WP_152388447.1\|3384541_3385636_-	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_152388448.1\|3385637_3387089_-	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.2e-17	43.7

DBSCAN-SWA_206

3391220 : 3392732

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388451.1\|3391220_3392732_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	4.1e-120	48.1

DBSCAN-SWA_207

3397288 : 3398482

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388454.1\|3397288_3398482_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.1e-14	27.4

DBSCAN-SWA_208

3402181 : 3414965

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388460.1\|3402181_3406258_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	4.0e-21	28.1
WP_152388461.1\|3406323_3410523_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	7.7e-68	27.5
WP_039806165.1\|3410660_3411032_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_012699299.1\|3411138_3411609_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_039806162.1\|3411638_3413741_+	elongation factor G	A0A1S5SF82	Streptococcus_phage	4.5e-53	25.5
WP_152388462.1\|3413771_3414965_+	elongation factor Tu	A0A1V0SLW6	Klosneuvirus	1.4e-14	27.4

DBSCAN-SWA_209

3429154 : 3438829

uncultured_Mediterranean_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388477.1\|3429154_3431989_-	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	2.6e-311	56.3
WP_152388478.1\|3432122_3433511_+	MFS transporter	NA	NA	NA	NA
WP_152388479.1\|3433520_3434018_+	single-stranded DNA-binding protein	A0A0S2SY36	Pseudomonas_phage	4.5e-52	63.8
WP_152388480.1\|3434474_3435359_+	sugar nucleotide-binding protein	NA	NA	NA	NA
WP_152388481.1\|3435351_3436290_+	NAD-dependent epimerase/dehydratase family protein	A0A1V0SAI6	Catovirus	1.2e-40	34.0
WP_152388482.1\|3437794_3438829_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.8e-58	34.6

DBSCAN-SWA_210

3446531 : 3503837

Staphylococcus_phage(29.41%)

transposase,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385995.1\|3446531_3447674_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	3.0e-168	75.3
WP_152388491.1\|3447708_3448224_-	DUF3299 domain-containing protein	NA	NA	NA	NA
WP_152388492.1\|3448233_3449499_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_152389926.1\|3449500_3450148_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.5e-20	35.9
WP_152388493.1\|3450249_3450816_-	DUF2796 domain-containing protein	NA	NA	NA	NA
WP_152388494.1\|3450937_3451273_+	hypothetical protein	NA	NA	NA	NA
WP_152388495.1\|3451283_3452153_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	6.5e-14	39.1
WP_152388496.1\|3452244_3452904_-	methyltransferase	NA	NA	NA	NA
WP_152388497.1\|3452900_3453350_-	hypothetical protein	NA	NA	NA	NA
WP_152388498.1\|3453462_3453927_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_152389927.1\|3453941_3455027_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	1.8e-37	33.1
WP_152388499.1\|3455384_3456044_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.9e-30	36.9
WP_152388500.1\|3456059_3457139_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.3e-51	35.9
WP_152388501.1\|3457271_3457748_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.2e-30	46.4
WP_152388502.1\|3457744_3458233_+	transcription antitermination factor NusB	NA	NA	NA	NA
WP_152388503.1\|3458243_3459209_+	thiamine-phosphate kinase	NA	NA	NA	NA
WP_152389928.1\|3459213_3459693_+	phosphatidylglycerophosphatase A	NA	NA	NA	NA
WP_152388504.1\|3459689_3460439_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_152388505.1\|3460457_3461117_+\|protease	TIGR02281 family clan AA aspartic protease	NA	NA	NA	NA
WP_152388506.1\|3461215_3461842_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	4.5e-41	47.9
WP_152388507.1\|3461843_3462284_+	MFS transporter	NA	NA	NA	NA
WP_152388508.1\|3462283_3463078_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152388509.1\|3463074_3463473_-	termination factor Rho	NA	NA	NA	NA
WP_152389929.1\|3464500_3464875_-	hypothetical protein	NA	NA	NA	NA
WP_152388510.1\|3465024_3466290_-	Hsp70 family protein	NA	NA	NA	NA
WP_152388511.1\|3466353_3469155_-	response regulator	A0A1V0SGX0	Hokovirus	3.5e-40	27.2
WP_152388512.1\|3469285_3470566_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_152388513.1\|3470779_3472387_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	3.7e-63	47.1
WP_152388514.1\|3472459_3472780_-	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
WP_152388515.1\|3472776_3473775_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_152389930.1\|3473729_3473945_-	hypothetical protein	NA	NA	NA	NA
WP_152388516.1\|3473950_3475102_-	DUF3426 domain-containing protein	NA	NA	NA	NA
WP_152388517.1\|3475178_3476057_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_152388518.1\|3476283_3477633_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_152388519.1\|3477650_3478115_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_152388520.1\|3478137_3478581_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_152388521.1\|3478746_3480525_-	protein-disulfide reductase DsbD	NA	NA	NA	NA
WP_152388522.1\|3480744_3481794_+	DUF2333 family protein	NA	NA	NA	NA
WP_152388523.1\|3481793_3482327_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_152389931.1\|3482517_3484038_+	UbiA family prenyltransferase	NA	NA	NA	NA
WP_152388524.1\|3484034_3485345_+	FAD-binding protein	NA	NA	NA	NA
WP_152388525.1\|3485341_3486082_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_152388526.1\|3486078_3487038_+	flippase-like domain-containing protein	NA	NA	NA	NA
WP_152388527.1\|3487080_3488718_+	hypothetical protein	NA	NA	NA	NA
WP_152385958.1\|3489106_3490087_-\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152388528.1\|3490390_3491965_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.3e-81	35.6
WP_152389932.1\|3491984_3492341_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.4e-15	39.2
WP_152388529.1\|3493582_3494590_+	2-hydroxyacid dehydrogenase	M1H502	Paramecium_bursaria_Chlorella_virus	6.1e-64	43.9
WP_152388530.1\|3494789_3495161_+	translation initiation factor Sui1	NA	NA	NA	NA
WP_152388531.1\|3495394_3497305_+	arginine decarboxylase	NA	NA	NA	NA
WP_152388532.1\|3497392_3498757_-	MATE family efflux transporter	NA	NA	NA	NA
WP_152388533.1\|3498753_3499047_-	hypothetical protein	NA	NA	NA	NA
WP_152388534.1\|3499136_3499991_-	universal stress protein	A0A2H4J154	uncultured_Caudovirales_phage	2.0e-84	58.1
WP_152388535.1\|3500006_3501488_-	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	2.2e-219	82.4
WP_152386036.1\|3501811_3502664_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5
WP_152385967.1\|3502739_3503837_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_211

3525660 : 3527586

Phage_Gifsy-1(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388551.1\|3525660_3526803_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	Q9G0F2	Phage_Gifsy-1	1.5e-167	74.8
WP_152388552.1\|3526851_3527586_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.4e-33	41.2

DBSCAN-SWA_212

3549960 : 3550503

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388575.1\|3549960_3550503_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-25	37.4

DBSCAN-SWA_213

3553618 : 3556953

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389937.1\|3553618_3555043_+	AMIN domain-containing protein	A0A067ZJB6	Vibrio_phage	6.9e-13	28.6
WP_152388579.1\|3555039_3556953_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	9.8e-87	33.0

DBSCAN-SWA_214

3563374 : 3567869

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388586.1\|3563374_3564667_+	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	2.4e-73	38.7
WP_152388587.1\|3565283_3567869_+	ribonuclease R	Q0GXV6	Lactococcus_phage	4.4e-66	32.4

DBSCAN-SWA_215

3570956 : 3576801

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388591.1\|3570956_3572348_+	replicative DNA helicase	O80281	Escherichia_phage	1.3e-144	57.3
WP_152388592.1\|3572418_3573636_+	MFS transporter	NA	NA	NA	NA
WP_167520083.1\|3573649_3574162_-	DUF2271 domain-containing protein	NA	NA	NA	NA
WP_152388594.1\|3574524_3576801_-	YgiQ family radical SAM protein	M1QSD9	Pseudomonas_phage	3.1e-124	87.5

DBSCAN-SWA_216

3582016 : 3586616

Rhodococcus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388600.1\|3582016_3582871_-	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	1.0e-35	37.4
WP_152388601.1\|3582962_3583397_-	DUF411 domain-containing protein	NA	NA	NA	NA
WP_152388602.1\|3583579_3584083_+	DUF4345 family protein	NA	NA	NA	NA
WP_152388603.1\|3584090_3585179_-\|tRNA	tRNA (uridine(54)-C5)-methyltransferase TrmA	A0A2K5B251	Erysipelothrix_phage	5.1e-16	29.2
WP_152388604.1\|3585320_3586616_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.3e-62	39.8

DBSCAN-SWA_217

3592027 : 3598093

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388609.1\|3592027_3594427_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.0e-16	35.5
WP_152388610.1\|3594420_3595350_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152388611.1\|3595544_3596072_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	3.3e-69	71.1
WP_152388612.1\|3596148_3596979_-	zinc-dependent peptidase	NA	NA	NA	NA
WP_152388613.1\|3597064_3598093_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	1.4e-34	28.9

DBSCAN-SWA_218

3606083 : 3609733

Bacillus_virus(50.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389940.1\|3606083_3607433_-	diguanylate cyclase	G3MA91	Bacillus_virus	3.3e-12	27.9
WP_152388619.1\|3607882_3609733_+\|protease	ATP-dependent zinc metalloprotease FtsH	C7U047	Ostreococcus_tauri_virus	2.9e-104	42.3

DBSCAN-SWA_219

3616123 : 3617389

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388625.1\|3616123_3617389_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-91	46.7

DBSCAN-SWA_220

3622991 : 3625236

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388632.1\|3622991_3623966_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	3.8e-18	54.1
WP_152388633.1\|3624027_3625236_+	serine-type D-Ala-D-Ala carboxypeptidase	B6DZZ7	Stx2-converting_phage	8.7e-65	41.4

DBSCAN-SWA_221

3657600 : 3662424

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388660.1\|3657600_3658557_+	acetaldehyde dehydrogenase (acetylating)	E5EQ71	Micromonas_sp._RCC1109_virus	2.1e-34	33.8
WP_152388661.1\|3658586_3658901_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_152388662.1\|3658909_3659833_+	catechol 2,3-dioxygenase	NA	NA	NA	NA
WP_152388663.1\|3659858_3661319_+	2-hydroxymuconic semialdehyde dehydrogenase	NA	NA	NA	NA
WP_152388664.1\|3661374_3662424_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	1.0e-45	32.6

DBSCAN-SWA_222

3667321 : 3669934

Staphylococcus_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388670.1\|3667321_3669934_-\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	4.9e-182	41.7

DBSCAN-SWA_223

3674332 : 3675346

Erwinia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388676.1\|3674332_3675346_-	AAA family ATPase	A0A1B2ICF6	Erwinia_phage	1.2e-46	46.6

DBSCAN-SWA_224

3698276 : 3698726

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388695.1\|3698276_3698726_-	Tellurite resistance TerB	Q1MVI3	Enterobacteria_phage	1.6e-08	29.5

DBSCAN-SWA_225

3708329 : 3710861

Saudi_moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388705.1\|3708329_3710861_+	ATP-dependent helicase HrpB	A0A1S5V1F0	Saudi_moumouvirus	2.5e-21	29.4

DBSCAN-SWA_226

3714901 : 3716230

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388710.1\|3714901_3716230_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.4e-52	34.4

DBSCAN-SWA_227

3722379 : 3725666

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386499.1\|3722379_3723417_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_152388713.1\|3723454_3724690_-	TIGR03862 family flavoprotein	NA	NA	NA	NA
WP_152388714.1\|3724745_3725666_-	histone deacetylase	A0A1V0SJS0	Klosneuvirus	1.5e-13	34.3

DBSCAN-SWA_228

3761036 : 3762041

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388751.1\|3761036_3762041_-	TerC/Alx family metal homeostasis membrane protein	K4F9T9	Cronobacter_phage	5.6e-33	34.4

DBSCAN-SWA_229

3768333 : 3771801

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388754.1\|3768333_3769800_-	DUF4118 domain-containing protein	A0A2K9L5I4	Tupanvirus	1.8e-11	23.7
WP_152388755.1\|3769911_3771801_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	8.2e-62	30.0

DBSCAN-SWA_230

3775474 : 3776371

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388759.1\|3775474_3776371_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	7.9e-31	33.7

DBSCAN-SWA_231

3785433 : 3786420

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388768.1\|3785433_3786420_+	alpha-ketoacid dehydrogenase subunit beta	A0A0K0KW14	Prochlorococcus_phage	3.6e-08	28.5

DBSCAN-SWA_232

3792164 : 3800750

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388774.1\|3792164_3794786_-	helicase	A0A0P0YNJ0	Yellowstone_lake_phycodnavirus	3.2e-40	32.8
WP_152388775.1\|3794932_3795397_-	multidrug transporter	NA	NA	NA	NA
WP_152388776.1\|3795854_3797300_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	M1I2R1	Acanthocystis_turfacea_Chlorella_virus	6.8e-16	41.2
WP_152388777.1\|3797397_3798042_-	alginate O-acetyltransferase	NA	NA	NA	NA
WP_152388778.1\|3798076_3799243_-	alginate O-acetyltransferase	NA	NA	NA	NA
WP_152388779.1\|3799256_3800750_-	membrane-bound O-acyltransferase family protein	A0A125RNP0	Pseudomonas_phage	6.3e-73	41.8

DBSCAN-SWA_233

3810838 : 3813975

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388787.1\|3810838_3812149_-	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	4.2e-41	31.0
WP_152385958.1\|3812994_3813975_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6

DBSCAN-SWA_234

3821766 : 3822627

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388798.1\|3821766_3822627_+	glucose 1-dehydrogenase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	3.4e-55	43.4

DBSCAN-SWA_235

3828477 : 3830991

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388805.1\|3828477_3830991_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	7.7e-07	34.7

DBSCAN-SWA_236

3834343 : 3843320

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388810.1\|3834343_3835738_+	AAA family ATPase	A0A2I7SAD7	Vibrio_phage	6.2e-99	45.5
WP_152388811.1\|3835841_3836312_+	cyclic pyranopterin monophosphate synthase MoaC	NA	NA	NA	NA
WP_152388812.1\|3836335_3836584_+	molybdopterin synthase sulfur carrier subunit	NA	NA	NA	NA
WP_152388813.1\|3836585_3837032_+	molybdopterin synthase catalytic subunit MoaE	NA	NA	NA	NA
WP_152388814.1\|3837191_3838796_-	ATP-dependent RNA helicase RhlB	A0A1V0SBR7	Catovirus	3.3e-43	27.6
WP_152388815.1\|3839047_3839227_-	hypothetical protein	NA	NA	NA	NA
WP_152388816.1\|3839493_3840153_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_152388817.1\|3840287_3840986_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_152388818.1\|3840982_3841261_+	GIY-YIG nuclease family protein	A0A2I7QNM5	Vibrio_phage	6.1e-06	42.3
WP_152388819.1\|3841292_3842228_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_152388820.1\|3842306_3843320_-	nucleoid-associated protein YejK	L7TI92	Pseudomonas_virus	1.4e-145	75.6

DBSCAN-SWA_237

3849202 : 3853854

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388827.1\|3849202_3850435_+	exonuclease subunit SbcD	L0LAJ8	Bacillus_phage	4.6e-05	30.1
WP_152388828.1\|3850431_3853854_+	AAA family ATPase	G3MAB6	Bacillus_virus	6.3e-12	26.2

DBSCAN-SWA_238

3857128 : 3866264

Bacillus_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388832.1\|3857128_3858892_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	2.3e-10	31.7
WP_152388833.1\|3859246_3860629_-	sodium:proton antiporter NhaD	NA	NA	NA	NA
WP_152388834.1\|3860982_3863817_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	6.0e-149	37.5
WP_152388835.1\|3863953_3864292_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_152388836.1\|3864298_3864727_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_152388837.1\|3864773_3866264_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.5e-50	37.3

DBSCAN-SWA_239

3869356 : 3869569

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039805696.1\|3869356_3869569_-	cold-shock protein	A0A1X9IGI9	Lactococcus_phage	1.7e-16	59.7

DBSCAN-SWA_240

3872903 : 3877253

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389954.1\|3872903_3874019_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	6.9e-93	48.5
WP_152388843.1\|3874060_3874396_+	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.3e-10	41.8
WP_152388844.1\|3874459_3876328_+	protein translocase subunit SecD	NA	NA	NA	NA
WP_152388845.1\|3876338_3877253_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.6e-50	42.4

DBSCAN-SWA_241

3881124 : 3886639

Faustovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388850.1\|3881124_3882339_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.4e-30	30.8
WP_152388851.1\|3882381_3882768_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	8.3e-54	79.8
WP_039802419.1\|3882795_3883119_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	2.8e-23	50.5
WP_152388852.1\|3883128_3883653_+	co-chaperone HscB	NA	NA	NA	NA
WP_152388853.1\|3883692_3885558_+	Fe-S protein assembly chaperone HscA	F2Y2E1	Organic_Lake_phycodnavirus	8.3e-99	39.1
WP_152388854.1\|3885561_3885900_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_152388855.1\|3885910_3886111_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_152388856.1\|3886207_3886639_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	4.7e-21	41.7

DBSCAN-SWA_242

3899968 : 3900727

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386438.1\|3899968_3900727_-\|transposase	IS5 family transposase	A0A0N9SJT9	Paenibacillus_phage	4.4e-22	45.0

DBSCAN-SWA_243

3925405 : 3926258

Paenibacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386036.1\|3925405_3926258_+\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	3.9e-19	40.5

DBSCAN-SWA_244

3939172 : 3942158

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388893.1\|3939172_3939997_-	peptidoglycan DD-metalloendopeptidase family protein	I2E8W3	Clostridium_phage	1.7e-16	39.6
WP_152388894.1\|3940018_3940783_-	D-alanyl-D-alanine dipeptidase	NA	NA	NA	NA
WP_152389959.1\|3940787_3942158_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	4.0e-34	34.9

DBSCAN-SWA_245

3946223 : 3958125

Klosneuvirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388898.1\|3946223_3947693_+	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	6.6e-91	39.3
WP_152388899.1\|3947917_3949498_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.2e-21	31.0
WP_152388900.1\|3950004_3950373_+	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_152388901.1\|3950683_3952054_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_152388902.1\|3952105_3952582_+\|tRNA	tRNA-specific adenosine deaminase	S4VYT2	Pandoravirus	4.0e-05	40.2
WP_152388903.1\|3952595_3954065_-	membrane-bound lytic murein transglycosylase MltF	NA	NA	NA	NA
WP_152388904.1\|3954228_3958125_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	1.6e-120	58.0

DBSCAN-SWA_246

3968449 : 3969346

Brevibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388918.1\|3968449_3969346_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	3.1e-35	32.4

DBSCAN-SWA_247

3974985 : 3976206

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388924.1\|3974985_3976206_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.7e-13	37.7

DBSCAN-SWA_248

3980786 : 3983556

Pseudomonas_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388929.1\|3980786_3981881_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	4.0e-08	48.3
WP_152388930.1\|3982053_3983556_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	4.4e-82	39.0

DBSCAN-SWA_249

3987206 : 3988920

Heterosigma_akashiwo_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388935.1\|3987206_3988097_+	alpha/beta fold hydrolase	A0A1C9C5K3	Heterosigma_akashiwo_virus	1.9e-08	34.7
WP_152388936.1\|3988093_3988420_+	hypothetical protein	NA	NA	NA	NA
WP_152388937.1\|3988416_3988920_+	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	9.6e-34	54.7

DBSCAN-SWA_250

3992350 : 4013357

Tupanvirus(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388940.1\|3992350_3992998_+	adenylate kinase	A0A2K9L833	Tupanvirus	1.9e-10	31.5
WP_152388941.1\|3993109_3993787_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_152389960.1\|3993794_3994649_+	DUF72 domain-containing protein	Q859D1	Escherichia_coli_phage	2.0e-23	47.6
WP_152389961.1\|3994706_3995375_+	extensin	NA	NA	NA	NA
WP_152389962.1\|3995485_3996262_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_152388942.1\|3996272_3996950_-	DUF4197 family protein	NA	NA	NA	NA
WP_152388943.1\|3997275_3998196_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	4.6e-18	30.1
WP_152388944.1\|3998192_3998927_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_152388945.1\|3998928_4000764_+	ABC transporter	NA	NA	NA	NA
WP_152388946.1\|4001058_4001268_+	cold shock domain-containing protein	Q9AZD3	Lactococcus_phage	2.4e-15	61.3
WP_152388947.1\|4001337_4001712_-	hypothetical protein	NA	NA	NA	NA
WP_152388948.1\|4001722_4002526_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_152388949.1\|4002519_4003677_-	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_152388950.1\|4003805_4006397_-	glycosyltransferase	M1I277	Paramecium_bursaria_Chlorella_virus	1.4e-16	24.9
WP_152388951.1\|4006640_4007453_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.6e-14	30.5
WP_152388952.1\|4008694_4009105_-	SufE family protein	NA	NA	NA	NA
WP_152388953.1\|4009101_4010307_-	aminotransferase class V-fold PLP-dependent enzyme	Q2XUY6	environmental_halophage	4.6e-58	33.3
WP_152388954.1\|4010462_4011497_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_152388955.1\|4011536_4011893_-	ArsC family reductase	NA	NA	NA	NA
WP_152388956.1\|4012052_4013357_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.3e-21	41.9

DBSCAN-SWA_251

4030194 : 4030950

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388967.1\|4030194_4030950_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	7.2e-17	36.8

DBSCAN-SWA_252

4040954 : 4068449

Cafeteria_roenbergensis_virus(14.29%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152388975.1\|4040954_4041590_+	ribonuclease HII	E3T5H8	Cafeteria_roenbergensis_virus	5.8e-20	39.4
WP_152388976.1\|4041670_4045198_+	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	1.7e-201	37.4
WP_152388977.1\|4045340_4046291_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_152388978.1\|4046422_4047730_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_152388979.1\|4047892_4049524_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	8.2e-159	53.8
WP_152388980.1\|4049525_4050371_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	6.1e-49	40.7
WP_152388981.1\|4050411_4051701_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	2.2e-138	61.5
WP_152388982.1\|4051824_4052112_+	cell division protein FtsB	NA	NA	NA	NA
WP_152388983.1\|4052108_4052816_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_152388984.1\|4052931_4054047_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	5.6e-34	28.5
WP_152388985.1\|4054127_4054973_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_152388986.1\|4055042_4055516_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_152388987.1\|4055512_4056571_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_152388988.1\|4056558_4057308_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.8e-61	49.0
WP_152388989.1\|4057307_4057988_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.8e-43	52.8
WP_152388990.1\|4058005_4058944_+	DUF368 domain-containing protein	NA	NA	NA	NA
WP_152388991.1\|4058994_4059861_+	peptidoglycan DD-metalloendopeptidase family protein	I3PV79	Clostridium_phage	2.9e-14	37.9
WP_152388992.1\|4059960_4060965_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	2.0e-35	35.2
WP_152388993.1\|4061659_4063477_+	PAS domain-containing protein	A0A1B0V854	Salmonella_phage	5.3e-34	45.5
WP_152388994.1\|4063537_4063861_-	ferredoxin family protein	NA	NA	NA	NA
WP_152388995.1\|4063995_4066569_-	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	1.5e-26	22.6
WP_152388996.1\|4066778_4067312_+	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	2.0e-53	69.3
WP_152388997.1\|4067399_4068449_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.9e-114	62.3

DBSCAN-SWA_253

4081354 : 4082512

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389010.1\|4081354_4082512_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-15	34.1

DBSCAN-SWA_254

4106611 : 4109172

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389032.1\|4106611_4107445_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	4.5e-28	32.1
WP_152389033.1\|4107462_4109172_-	FAD-dependent oxidoreductase	A0A2P0ZL82	Lactobacillus_phage	3.4e-30	27.7

DBSCAN-SWA_255

4117420 : 4125677

Pseudomonas_phage(42.86%)

integrase

attL 4115026:4115041|attR 4126727:4126742

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4115026:4115041	attL	NA	NA	NA	NA
WP_152389040.1\|4117420_4118707_+\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A2H4JAT5	uncultured_Caudovirales_phage	1.4e-137	59.0
WP_152389966.1\|4119362_4119608_+	hypothetical protein	NA	NA	NA	NA
WP_152389967.1\|4119835_4120018_+	transcriptional regulator	NA	NA	NA	NA
WP_152389041.1\|4120018_4120327_+	hypothetical protein	NA	NA	NA	NA
WP_152389042.1\|4120323_4120563_+	hypothetical protein	NA	NA	NA	NA
WP_152389043.1\|4120783_4121035_-	hypothetical protein	K4NZP3	Burkholderia_phage	9.3e-06	44.3
WP_152389044.1\|4121045_4121348_-	putative addiction module antidote protein	A4JWV1	Burkholderia_virus	1.3e-14	48.9
WP_152389045.1\|4121357_4121648_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	6.7e-24	58.2
WP_167520088.1\|4121973_4122144_+	hypothetical protein	A0A1B0VP73	Pseudomonas_phage	4.4e-07	68.8
WP_152389047.1\|4122140_4122443_+	hypothetical protein	NA	NA	NA	NA
WP_152389048.1\|4122808_4123348_+	hypothetical protein	A0A1B0VNG0	Pseudomonas_phage	9.8e-61	76.2
WP_152389049.1\|4123344_4123566_+	hypothetical protein	NA	NA	NA	NA
WP_152389050.1\|4123562_4125677_+	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	9.4e-232	68.2
4126727:4126742	attR	NA	NA	NA	NA

DBSCAN-SWA_256

4146916 : 4147498

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389062.1\|4146916_4147498_-	superoxide dismutase [Fe]	Q56AR7	Bacillus_thuringiensis_phage	6.9e-44	45.3

DBSCAN-SWA_257

4166114 : 4171482

Streptococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389972.1\|4166114_4168829_-	response regulator	A0A1V0SGX0	Hokovirus	2.8e-47	30.0
WP_152389080.1\|4169185_4170085_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	2.3e-54	40.6
WP_152389081.1\|4170117_4171482_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A1X9I6F4	Streptococcus_phage	4.1e-31	28.3

DBSCAN-SWA_258

4182855 : 4187132

Prochlorococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389086.1\|4182855_4183836_-	aspartyl beta-hydroxylase	H8ZJK8	Ostreococcus_tauri_virus	7.8e-32	37.6
WP_152389087.1\|4184104_4184644_+	DUF2058 family protein	NA	NA	NA	NA
WP_152389088.1\|4184699_4185416_-	DUF3108 domain-containing protein	NA	NA	NA	NA
WP_152389089.1\|4185429_4186077_-	phosphoribosylglycinamide formyltransferase	E3SNR5	Prochlorococcus_phage	1.1e-26	37.9
WP_152389090.1\|4186076_4187132_-	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	3.9e-77	47.3

DBSCAN-SWA_259

4194349 : 4201100

Geobacillus_virus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389101.1\|4194349_4194919_-	transglycosylase SLT domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	7.1e-09	38.7
WP_152389102.1\|4194929_4195877_-	hypothetical protein	NA	NA	NA	NA
WP_152389103.1\|4195886_4197602_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_152389104.1\|4197906_4199682_+\|tRNA	aspartate--tRNA ligase	A0A1V0SIS0	Klosneuvirus	7.3e-12	27.6
WP_152389105.1\|4199767_4200517_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_152389106.1\|4200575_4201100_+	crossover junction endodeoxyribonuclease RuvC	G3MA90	Bacillus_virus	1.1e-05	23.8

DBSCAN-SWA_260

4209291 : 4209966

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389116.1\|4209291_4209966_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	3.1e-27	37.7

DBSCAN-SWA_261

4217246 : 4218116

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389123.1\|4217246_4218116_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	9.6e-50	36.2

DBSCAN-SWA_262

4230703 : 4243011

Pseudomonas_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389132.1\|4230703_4231624_-	recombination-associated protein RdgC	L7TP07	Pseudomonas_virus	2.2e-124	74.5
WP_152389133.1\|4232194_4232950_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_152389976.1\|4233337_4233694_+	DUF1232 domain-containing protein	NA	NA	NA	NA
WP_152389134.1\|4233783_4234125_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152389135.1\|4234121_4234484_+	hypothetical protein	NA	NA	NA	NA
WP_152389136.1\|4234597_4236679_-	carboxy terminal-processing peptidase	A0A0R6PIZ1	Moraxella_phage	2.7e-106	35.2
WP_152389137.1\|4236803_4237766_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_152389138.1\|4237849_4239139_-	M18 family aminopeptidase	NA	NA	NA	NA
WP_152389139.1\|4239217_4239853_-	RNA pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	9.6e-07	29.5
WP_152389140.1\|4239951_4240206_-	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_152389141.1\|4240202_4241018_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_152389142.1\|4241115_4241859_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_152389143.1\|4242087_4243011_+	lipid A biosynthesis lauroyl acyltransferase	A0A1W6JP29	Morganella_phage	1.4e-46	35.4

DBSCAN-SWA_263

4250353 : 4253363

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389151.1\|4250353_4250581_-	YheU family protein	A0A2H4J8A7	uncultured_Caudovirales_phage	1.1e-21	69.3
WP_152389152.1\|4250618_4253363_-	response regulator	A0A1V0SGX0	Hokovirus	1.0e-52	30.3

DBSCAN-SWA_264

4256909 : 4258679

Acanthamoeba_polyphaga_mimivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389154.1\|4256909_4258679_-	N-acetylglutaminylglutamine amidotransferase	A0A0G2Y369	Acanthamoeba_polyphaga_mimivirus	9.8e-25	25.0

DBSCAN-SWA_265

4268960 : 4270748

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389162.1\|4268960_4270748_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	5.4e-39	27.8

DBSCAN-SWA_266

4278100 : 4281264

Escherichia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385958.1\|4278100_4279081_+\|transposase	IS5 family transposase	Q38213	Escherichia_phage	1.6e-93	55.6
WP_152389169.1\|4279334_4279862_-	hypothetical protein	NA	NA	NA	NA
WP_152386602.1\|4280226_4281264_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.8e-40	30.6

DBSCAN-SWA_267

4297177 : 4301779

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389181.1\|4297177_4299139_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	3.1e-80	37.7
WP_152389183.1\|4299361_4300336_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152389184.1\|4300558_4301779_+	acetylornithine/succinyldiaminopimelate transaminase	A0A1V0SKB7	Klosneuvirus	3.1e-22	26.9

DBSCAN-SWA_268

4304896 : 4309225

Klosneuvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389188.1\|4304896_4307521_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	2.6e-74	37.9
WP_152389189.1\|4307620_4308856_+	aspartate kinase	NA	NA	NA	NA
WP_003283978.1\|4309039_4309225_+	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	9.9e-13	68.6

DBSCAN-SWA_269

4312260 : 4312599

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389987.1\|4312260_4312599_-	Arc family DNA-binding protein	A0A1Y0SXL4	Pseudomonas_phage	8.7e-15	59.7

DBSCAN-SWA_270

4317731 : 4322850

Bacillus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389195.1\|4317731_4319459_+	SpoIIE family protein phosphatase	W8CYM9	Bacillus_phage	4.6e-11	31.2
WP_152389196.1\|4319465_4319813_+	Hpt domain-containing protein	NA	NA	NA	NA
WP_152389197.1\|4319835_4320486_+	bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase	NA	NA	NA	NA
WP_152389988.1\|4320524_4320917_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_152389198.1\|4320963_4321953_+\|tRNA	tRNA dihydrouridine(16) synthase DusC	NA	NA	NA	NA
WP_152389199.1\|4322004_4322151_-	DUF2474 family protein	NA	NA	NA	NA
WP_152389200.1\|4322406_4322850_+	Hsp20 family protein	A0A218MMV3	uncultured_virus	2.6e-19	37.6

DBSCAN-SWA_271

4337994 : 4339500

Mollivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389212.1\|4337994_4339500_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.9e-86	40.8

DBSCAN-SWA_272

4350501 : 4357631

Catovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389221.1\|4350501_4351962_+	AMP-binding protein	A0A1V0SBX8	Catovirus	3.6e-17	25.3
WP_152389222.1\|4351972_4352626_+	biliverdin-producing heme oxygenase	NA	NA	NA	NA
WP_152389223.1\|4352636_4353428_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_152389224.1\|4353461_4354118_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_152389225.1\|4354139_4354799_+	response regulator	W8CYM9	Bacillus_phage	6.9e-32	35.9
WP_152389226.1\|4354798_4356217_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_152389227.1\|4356334_4356760_+	HIT domain-containing protein	NA	NA	NA	NA
WP_152389228.1\|4356762_4356972_+	hypothetical protein	NA	NA	NA	NA
WP_152389229.1\|4357013_4357631_-	cold shock domain-containing protein	A0A1X9IGI9	Lactococcus_phage	3.4e-09	48.3

DBSCAN-SWA_273

4400956 : 4409579

Bodo_saltans_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389262.1\|4400956_4401511_-	peptidylprolyl isomerase A	A0A2H4UTF4	Bodo_saltans_virus	7.6e-08	33.1
WP_152389263.1\|4401593_4402520_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152389264.1\|4402714_4403314_+	FMN-dependent NADH-azoreductase	NA	NA	NA	NA
WP_152389265.1\|4403340_4403754_-	hypothetical protein	NA	NA	NA	NA
WP_152389266.1\|4403931_4405251_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.5e-49	30.8
WP_152389267.1\|4405254_4406217_-	L-histidine N(alpha)-methyltransferase	NA	NA	NA	NA
WP_152389268.1\|4406219_4407509_-	ergothioneine biosynthesis protein EgtB	NA	NA	NA	NA
WP_152389269.1\|4407770_4409579_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-43	27.9

DBSCAN-SWA_274

4417351 : 4420422

Leptospira_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152386499.1\|4417351_4418389_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	1.1e-39	30.0
WP_152389275.1\|4418517_4420422_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	3.0e-112	36.7

DBSCAN-SWA_275

4444862 : 4445429

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389293.1\|4444862_4445429_+	dCTP deaminase	S5VM63	Pseudomonas_phage	1.1e-75	79.5

DBSCAN-SWA_276

4455240 : 4456752

uncultured_virus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389301.1\|4455240_4456752_+\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	2.1e-121	48.4

DBSCAN-SWA_277

4459761 : 4461906

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389305.1\|4459761_4461906_+	ATP-dependent DNA helicase DinG	A0A127AW80	Bacillus_phage	1.4e-46	25.3

DBSCAN-SWA_278

4481419 : 4482885

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389324.1\|4481419_4482121_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.8e-15	29.9
WP_152389325.1\|4482120_4482885_-	high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG	G3M9Y6	Bacillus_virus	2.9e-10	22.6

DBSCAN-SWA_279

4488418 : 4489219

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389332.1\|4488418_4489219_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.9e-16	32.7

DBSCAN-SWA_280

4494402 : 4496478

Bacteriophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389337.1\|4494402_4496478_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.5e-45	34.5

DBSCAN-SWA_281

4504917 : 4507320

uncultured_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389348.1\|4504917_4507320_-	cadmium-translocating P-type ATPase	A0A218MNH6	uncultured_virus	3.8e-80	31.3

DBSCAN-SWA_282

4534478 : 4535462

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389366.1\|4534478_4535462_-	SDR family oxidoreductase	A0A2P0VP75	Tetraselmis_virus	1.0e-10	35.2

DBSCAN-SWA_283

4549746 : 4550787

Indivirus(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152385914.1\|4549746_4550787_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1

DBSCAN-SWA_284

4564087 : 4620903

Pseudomonas_phage(34.04%)

head,terminase,integrase,holin,tRNA

attL 4571590:4571638|attR 4622229:4622277

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389386.1\|4564087_4566010_+\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	1.2e-124	36.3
WP_152389387.1\|4566027_4566561_+	translation initiation factor IF-3	A0A2I7S9Q1	Vibrio_phage	5.2e-14	38.1
WP_039804765.1\|4566623_4566818_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_152389388.1\|4566848_4567205_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_152389389.1\|4567403_4568420_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2K9L3A8	Tupanvirus	1.9e-28	36.5
WP_152389390.1\|4568456_4570835_+\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_011913482.1\|4570840_4571143_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	1.4e-11	38.9
WP_152389391.1\|4571123_4571480_+	MerR family transcriptional regulator	NA	NA	NA	NA
4571590:4571638	attL	NA	NA	NA	NA
WP_152389392.1\|4571715_4572885_-\|integrase	tyrosine-type recombinase/integrase	A0A059VF45	Pseudomonas_phage	1.4e-168	74.0
WP_152389393.1\|4573225_4573528_-	hypothetical protein	NA	NA	NA	NA
WP_152389394.1\|4573593_4573938_-	hypothetical protein	C8XUN3	Shigella_phage	3.4e-06	28.0
WP_152389395.1\|4573934_4574537_-	hypothetical protein	NA	NA	NA	NA
WP_152389396.1\|4574526_4574781_-	hypothetical protein	NA	NA	NA	NA
WP_152389397.1\|4574777_4575059_-	hypothetical protein	NA	NA	NA	NA
WP_152389398.1\|4575055_4575451_-	hypothetical protein	NA	NA	NA	NA
WP_152389399.1\|4575454_4576486_-	DUF551 domain-containing protein	NA	NA	NA	NA
WP_152389400.1\|4576503_4577313_-	phage antirepressor	A0A1W6JTB0	Pseudomonas_phage	1.7e-48	43.0
WP_152389401.1\|4577393_4577987_-	hypothetical protein	Q8HA44	Vibrio_phage	1.2e-24	48.7
WP_152389402.1\|4578549_4578849_+	hypothetical protein	NA	NA	NA	NA
WP_152389403.1\|4579046_4579226_-	hypothetical protein	NA	NA	NA	NA
WP_152389404.1\|4579222_4579618_-	hypothetical protein	NA	NA	NA	NA
WP_152389405.1\|4579704_4580166_-	single-stranded DNA-binding protein	W6MWX5	Pseudomonas_phage	2.3e-42	75.7
WP_152389406.1\|4580168_4580786_-	YqaJ-like viral recombinase	S0A2A9	Cellulophaga_phage	3.8e-40	45.5
WP_152389407.1\|4580772_4581282_-	hypothetical protein	NA	NA	NA	NA
WP_152389408.1\|4581451_4581712_-	hypothetical protein	NA	NA	NA	NA
WP_152389409.1\|4581711_4582116_-	hypothetical protein	NA	NA	NA	NA
WP_152389410.1\|4582180_4582696_-	hypothetical protein	NA	NA	NA	NA
WP_152389411.1\|4582707_4583490_-	hypothetical protein	U5P4K5	Shigella_phage	1.1e-23	46.4
WP_152389412.1\|4583486_4583837_-	hypothetical protein	NA	NA	NA	NA
WP_152389413.1\|4584886_4585147_-	hypothetical protein	NA	NA	NA	NA
WP_152389414.1\|4585190_4585379_-	hypothetical protein	NA	NA	NA	NA
WP_152389415.1\|4585445_4585688_-	hypothetical protein	NA	NA	NA	NA
WP_152389416.1\|4586096_4586342_-	DUF1654 domain-containing protein	H2BD60	Pseudomonas_phage	5.3e-06	40.3
WP_152389417.1\|4586513_4586765_-	DUF1654 domain-containing protein	A0A127KNY9	Pseudomonas_phage	6.5e-07	37.2
WP_152389418.1\|4586941_4587199_+	hypothetical protein	NA	NA	NA	NA
WP_167520095.1\|4587236_4587626_-	hypothetical protein	NA	NA	NA	NA
WP_152389420.1\|4587585_4588536_-	hypothetical protein	NA	NA	NA	NA
WP_152389421.1\|4588874_4589525_-	helix-turn-helix domain-containing protein	A0A1W6JTC8	Pseudomonas_phage	3.7e-46	58.2
WP_152389422.1\|4589638_4589875_+	helix-turn-helix domain-containing protein	A0A127KNT2	Pseudomonas_phage	7.6e-26	86.6
WP_152389423.1\|4589877_4590189_+	transcriptional regulator	NA	NA	NA	NA
WP_152389424.1\|4590188_4591160_+	hypothetical protein	A0A067ZIA1	Vibrio_phage	3.4e-19	34.1
WP_152389425.1\|4591159_4591822_+	Replication protein P	W6MVG8	Pseudomonas_phage	9.5e-74	64.9
WP_167520096.1\|4591814_4591976_+	hypothetical protein	NA	NA	NA	NA
WP_152389426.1\|4591972_4592164_+	hypothetical protein	NA	NA	NA	NA
WP_167520097.1\|4592156_4592327_+	hypothetical protein	NA	NA	NA	NA
WP_167520098.1\|4592319_4593198_+	hypothetical protein	A0A0K0L9C7	Pseudomonas_phage	2.2e-17	46.0
WP_152389428.1\|4593190_4593373_+	hypothetical protein	NA	NA	NA	NA
WP_152389429.1\|4593365_4593788_+	NinB family protein	A0A2H4J1T9	uncultured_Caudovirales_phage	2.9e-52	71.4
WP_152389430.1\|4593787_4594087_+	DUF1364 family protein	K7P7Q1	Enterobacteria_phage	3.6e-28	65.5
WP_152389431.1\|4594083_4594686_+	DNA-binding protein	A0A0H5ARR4	Pseudomonas_phage	2.9e-37	45.4
WP_152389432.1\|4594782_4595019_+	hypothetical protein	NA	NA	NA	NA
WP_152389433.1\|4595005_4595371_+	endodeoxyribonuclease RusA	A0A088F6Y8	Sulfitobacter_phage	6.1e-06	35.5
WP_152389434.1\|4595367_4595733_+	hypothetical protein	NA	NA	NA	NA
WP_152389435.1\|4595942_4596365_-	type II toxin-antitoxin system HicB family antitoxin	Q7Y3V7	Yersinia_phage	5.4e-22	44.0
WP_152389436.1\|4596416_4596608_-	addiction module toxin, HicA family	A0A2H4JDU5	uncultured_Caudovirales_phage	2.1e-10	57.4
WP_152389437.1\|4596753_4597074_+\|holin	phage holin, lambda family	A0A0U4III7	Pseudomonas_phage	3.8e-28	63.7
WP_152389438.1\|4597078_4597705_+	hypothetical protein	A0A2H4J2I6	uncultured_Caudovirales_phage	1.8e-18	50.0
WP_152389439.1\|4597694_4598888_+\|terminase	PBSX family phage terminase large subunit	B1GS77	Salmonella_phage	3.9e-86	44.1
WP_152389440.1\|4598896_4600306_+	DUF1073 domain-containing protein	W5S8I3	Pseudomonas_phage	4.1e-106	47.7
WP_167520099.1\|4600256_4601111_+\|head	phage head morphogenesis protein	Q6IWU3	Burkholderia_phage	5.4e-45	39.0
WP_152389442.1\|4601235_4601745_+	DNA-binding protein	A0A0H5ARR4	Pseudomonas_phage	3.5e-52	54.5
WP_152389443.1\|4601757_4602921_+	DUF2213 domain-containing protein	Q6IWU4	Burkholderia_phage	4.9e-49	36.9
WP_152389444.1\|4602920_4603418_+	hypothetical protein	NA	NA	NA	NA
WP_152389445.1\|4603430_4604522_+	DUF2184 domain-containing protein	Q6IWU6	Burkholderia_phage	6.6e-72	41.4
WP_152389446.1\|4604524_4604911_+	hypothetical protein	NA	NA	NA	NA
WP_152389447.1\|4604914_4605337_+	DUF4054 domain-containing protein	A0A088C3T8	Shewanella_sp._phage	1.2e-21	43.6
WP_152390012.1\|4605375_4605819_+	hypothetical protein	A0A077KC03	Edwardsiella_phage	1.0e-18	39.3
WP_152389448.1\|4605815_4606211_+	hypothetical protein	NA	NA	NA	NA
WP_152389449.1\|4606207_4606717_+	hypothetical protein	A0A2H4P6T9	Pseudomonas_phage	7.0e-08	35.3
WP_152389450.1\|4606717_4609003_+	hypothetical protein	A0A2H4P7F7	Pseudomonas_phage	8.7e-159	46.5
WP_152389451.1\|4609002_4610556_+	hypothetical protein	A0A2H4P7P1	Pseudomonas_phage	3.6e-63	36.1
WP_152389452.1\|4610561_4612076_+	DUF3383 family protein	I7B2P4	Escherichia_phage	1.3e-73	38.7
WP_152389453.1\|4612088_4612550_+	hypothetical protein	A1Z014	Burkholderia_virus	1.0e-26	43.4
WP_152389454.1\|4612551_4613007_+	hypothetical protein	NA	NA	NA	NA
WP_152389455.1\|4613107_4614805_+	hypothetical protein	Q4L1H3	Burkholderia_phage	2.5e-09	22.0
WP_152389456.1\|4614804_4615362_+	hypothetical protein	Q6IWP8	Burkholderia_phage	1.1e-14	33.3
WP_152389457.1\|4615361_4615670_+	hypothetical protein	NA	NA	NA	NA
WP_152389458.1\|4615659_4616478_+	hypothetical protein	A1Z005	Burkholderia_virus	5.6e-15	26.9
WP_152390013.1\|4616480_4617125_+	hypothetical protein	A1Z003	Burkholderia_virus	1.8e-37	39.9
WP_152389459.1\|4617121_4617475_+	hypothetical protein	NA	NA	NA	NA
WP_152389460.1\|4617461_4618646_+	hypothetical protein	Q6IWQ3	Burkholderia_phage	1.4e-75	45.4
WP_152389461.1\|4618642_4619263_+	DUF2612 domain-containing protein	Q6IWQ4	Burkholderia_phage	5.4e-47	48.5
WP_152389462.1\|4619259_4620363_+	hypothetical protein	H9C1B7	Pectobacterium_phage	3.6e-17	40.5
WP_152389463.1\|4620426_4620903_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	1.1e-52	66.0
4622229:4622277	attR	NA	NA	NA	NA

DBSCAN-SWA_285

4627418 : 4629662

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152390014.1\|4627418_4627880_+	host-nuclease inhibitor protein Gam	L7P7T1	Pseudomonas_phage	1.9e-33	49.0
WP_152390015.1\|4628015_4629662_-	hypothetical protein	A0A0N9QAZ1	Chrysochromulina_ericina_virus	4.8e-26	28.9

DBSCAN-SWA_286

4640802 : 4642323

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389474.1\|4640802_4642323_+	protein kinase	A0A2R8FF19	Brazilian_cedratvirus	1.0e-17	27.3

DBSCAN-SWA_287

4645337 : 4653159

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389479.1\|4645337_4646270_+	hypothetical protein	A0A2K9L690	Tupanvirus	2.5e-43	34.8
WP_152390016.1\|4646310_4648002_+	SufS family cysteine desulfurase	A0A2K9L2Y3	Tupanvirus	6.6e-87	41.1
WP_152389480.1\|4648055_4650536_-	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	9.1e-93	34.5
WP_152390017.1\|4650880_4651138_+	hypothetical protein	NA	NA	NA	NA
WP_152389481.1\|4651174_4652266_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_152389482.1\|4652262_4653159_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.0e-30	33.9

DBSCAN-SWA_288

4662005 : 4669718

Acinetobacter_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389494.1\|4662005_4663520_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	8.1e-28	25.2
WP_152390018.1\|4663514_4664813_-	guanine deaminase	NA	NA	NA	NA
WP_152389495.1\|4664947_4665790_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.1e-41	33.7
WP_152389496.1\|4665883_4668277_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	6.9e-207	48.9
WP_152389497.1\|4668269_4669718_-	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	7.9e-105	47.2

DBSCAN-SWA_289

4686581 : 4689074

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389511.1\|4686581_4687424_+	ABC transporter permease subunit	G3M9Y4	Bacillus_virus	4.1e-13	24.4
WP_152389512.1\|4687436_4688210_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_152389513.1\|4688306_4689074_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	5.9e-27	32.5

DBSCAN-SWA_290

4696445 : 4698614

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389524.1\|4696445_4698614_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	4.2e-54	29.2

DBSCAN-SWA_291

4703366 : 4703861

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389529.1\|4703366_4703861_+	DNA starvation/stationary phase protection protein	W5S6G8	Pithovirus	9.8e-15	34.0

DBSCAN-SWA_292

4718026 : 4720741

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389539.1\|4718026_4720741_-	HAD-IC family P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.6e-61	28.9

DBSCAN-SWA_293

4731914 : 4733342

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389551.1\|4731914_4733342_+	transglycosylase SLT domain-containing protein	A0A0S2SXL7	Bacillus_phage	2.2e-06	37.6

DBSCAN-SWA_294

4736960 : 4737641

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389555.1\|4736960_4737641_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.2e-36	38.2

DBSCAN-SWA_295

4740831 : 4745446

Klebsiella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389560.1\|4740831_4741908_-	3-deoxy-7-phosphoheptulonate synthase	A0A2I6UFP9	Klebsiella_phage	1.4e-87	52.3
WP_152389561.1\|4742257_4743232_+	HTH-type transcriptional regulator CysB	NA	NA	NA	NA
WP_152389562.1\|4743252_4743987_-	phosphoadenylyl-sulfate reductase	NA	NA	NA	NA
WP_152389563.1\|4744111_4745446_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	2.3e-50	36.9

DBSCAN-SWA_296

4756886 : 4759259

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389572.1\|4756886_4759259_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.0e-182	37.6

DBSCAN-SWA_297

4770347 : 4772027

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389581.1\|4770347_4772027_-	protein kinase	A0A1V0SD90	Indivirus	1.2e-11	29.4

DBSCAN-SWA_298

4785417 : 4847292

Pseudomonas_phage(32.61%)

tail,terminase,plate,integrase,holin,tRNA,transposase,protease,portal

attL 4792077:4792127|attR 4840754:4840804

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389591.1\|4785417_4786020_+\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_152389592.1\|4786130_4786856_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_152389593.1\|4786861_4787356_-	peptidylprolyl isomerase	A0A076FI46	Aureococcus_anophage	1.8e-13	32.9
WP_152389594.1\|4787512_4789183_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	3.3e-200	60.5
WP_152389595.1\|4789183_4790569_+\|tRNA	cysteine--tRNA ligase	A0A0U2SJ70	Niemeyer_virus	8.7e-45	34.4
WP_152389596.1\|4790665_4791520_-	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	8.3e-30	34.3
4792077:4792127	attL	NA	NA	NA	NA
WP_152389597.1\|4792136_4793240_-\|integrase	tyrosine-type recombinase/integrase	A0A0S2SYQ7	Pseudomonas_phage	8.8e-157	74.7
WP_152389598.1\|4793125_4793446_-	helix-turn-helix domain-containing protein	Q9MC86	Pseudomonas_phage	2.0e-16	54.3
WP_152389599.1\|4793503_4793740_-	hypothetical protein	NA	NA	NA	NA
WP_152389600.1\|4793792_4795559_-	DNA cytosine methyltransferase	Q5QF27	Pseudomonas_virus	1.1e-148	45.6
WP_152389601.1\|4795540_4795876_-	hypothetical protein	A0A2H4J2C6	uncultured_Caudovirales_phage	7.5e-19	55.3
WP_152389602.1\|4795982_4796198_+	hypothetical protein	NA	NA	NA	NA
WP_152389603.1\|4796239_4796491_-	hypothetical protein	NA	NA	NA	NA
WP_167520101.1\|4796487_4796643_-	hypothetical protein	NA	NA	NA	NA
WP_152389604.1\|4796639_4796822_-	hypothetical protein	NA	NA	NA	NA
WP_152389605.1\|4796805_4797168_-	hypothetical protein	NA	NA	NA	NA
WP_152389606.1\|4797897_4799409_-\|transposase	IS66 family transposase	A0A218MNE7	uncultured_virus	3.1e-120	48.4
WP_167520046.1\|4799490_4799826_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_152388408.1\|4799822_4800152_-\|transposase	transposase	NA	NA	NA	NA
WP_152389607.1\|4801143_4801359_-	hypothetical protein	NA	NA	NA	NA
WP_152389608.1\|4801951_4802266_+	DUF1654 domain-containing protein	A0A0S2SYC9	Pseudomonas_phage	7.3e-24	56.5
WP_152389609.1\|4802738_4803026_+	antitoxin	NA	NA	NA	NA
WP_152389610.1\|4803015_4803303_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	A0A2H4JBF4	uncultured_Caudovirales_phage	3.5e-17	53.8
WP_152389611.1\|4803357_4803810_+	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_152389612.1\|4803882_4804134_-	DUF1654 domain-containing protein	A0A2K8HZW3	Pseudomonas_phage	2.6e-08	34.6
WP_152389613.1\|4804285_4804543_+	hypothetical protein	NA	NA	NA	NA
WP_152389614.1\|4804666_4804903_+	hypothetical protein	NA	NA	NA	NA
WP_152389615.1\|4804999_4806073_-	ImmA/IrrE family metallo-endopeptidase	B6SBZ6	Clostridium_virus	3.5e-25	29.3
WP_152389616.1\|4806059_4806698_-	hypothetical protein	NA	NA	NA	NA
WP_152390025.1\|4806893_4807766_-	helix-turn-helix domain-containing protein	A0A0S2SYF7	Pseudomonas_phage	3.5e-60	47.3
WP_152389617.1\|4807853_4808042_+	Rha family transcriptional regulator	G3EN82	Psychrobacter_phage	2.8e-07	62.8
WP_152389618.1\|4808069_4808375_+	transcriptional regulator	Q37905	Pseudomonas_phage	1.7e-33	71.1
WP_152390026.1\|4808473_4808686_+	hypothetical protein	A0A1S5S9F1	Streptococcus_phage	9.3e-15	59.7
WP_152390027.1\|4808704_4809220_+	hypothetical protein	A0A0U4J8Z7	Pseudomonas_phage	1.0e-38	60.3
WP_152389619.1\|4809219_4810074_+	DUF1376 domain-containing protein	A0A0U2RT81	Escherichia_phage	3.8e-22	54.2
WP_152390028.1\|4810097_4810829_+	Replication protein P	A0A2H4J1T4	uncultured_Caudovirales_phage	4.8e-34	39.1
WP_152389620.1\|4810821_4811211_+	hypothetical protein	NA	NA	NA	NA
WP_152389621.1\|4811203_4811710_+	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	2.3e-35	58.0
WP_152389622.1\|4811702_4812002_+	hypothetical protein	NA	NA	NA	NA
WP_152389623.1\|4811982_4812291_+	hypothetical protein	NA	NA	NA	NA
WP_152389624.1\|4812383_4812695_+	hypothetical protein	B5WZY8	Pseudomonas_phage	8.5e-17	44.0
WP_152389625.1\|4813015_4813336_+\|holin	phage holin, lambda family	A0A0U4III7	Pseudomonas_phage	1.5e-24	55.3
WP_152389626.1\|4813408_4814155_+	hypothetical protein	G8EY51	Synechococcus_phage	1.5e-22	31.5
WP_039804063.1\|4814274_4814802_+	DNA packaging protein	A0A1B0Z033	Pseudomonas_phage	8.2e-20	46.6
WP_152389627.1\|4814818_4816741_+\|terminase	phage terminase large subunit family protein	A0A1B0Z2K0	Pseudomonas_phage	6.1e-214	56.9
WP_039804066.1\|4816740_4816944_+	hypothetical protein	NA	NA	NA	NA
WP_152389628.1\|4816946_4818455_+\|portal	phage portal protein	Q75QM9	Wolbachia_phage	1.0e-75	36.5
WP_152390029.1\|4818462_4820403_+	hypothetical protein	A0A2I7S8L6	Vibrio_phage	2.5e-90	33.5
WP_152389629.1\|4820472_4820826_+	DUF2190 family protein	NA	NA	NA	NA
WP_152389630.1\|4820829_4821153_+	electron transfer flavoprotein	NA	NA	NA	NA
WP_152389631.1\|4821149_4821710_+	hypothetical protein	NA	NA	NA	NA
WP_152389632.1\|4821706_4821898_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_152389633.1\|4821898_4823371_+\|tail	phage tail protein	A0A0C4UQS0	Shigella_phage	1.0e-91	41.9
WP_152389634.1\|4823404_4823764_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152389635.1\|4823763_4824066_+	hypothetical protein	NA	NA	NA	NA
WP_152389636.1\|4824166_4825849_+	hypothetical protein	A0A291AUM6	Sinorhizobium_phage	1.6e-21	36.8
WP_152389637.1\|4825952_4826150_+	hypothetical protein	NA	NA	NA	NA
WP_152389638.1\|4826263_4827457_+	hypothetical protein	A0A2P9JZK2	Alteromonadaceae_phage	2.2e-44	33.2
WP_152389639.1\|4827449_4828568_+\|tail	phage tail protein	M1PVV2	Vibrio_phage	5.4e-61	38.9
WP_152389640.1\|4828564_4829050_+\|plate	phage baseplate assembly protein V	A0A0C4UQZ3	Shigella_phage	3.2e-18	38.3
WP_152389641.1\|4829049_4829517_+	hypothetical protein	A0A2P9JZK5	Alteromonadaceae_phage	1.1e-23	41.6
WP_152389642.1\|4829516_4830581_+\|plate	baseplate J protein	A0A2P9JZK6	Alteromonadaceae_phage	4.8e-75	44.9
WP_152385844.1\|4830590_4831262_+	DUF2313 domain-containing protein	A0A2P9JZK7	Alteromonadaceae_phage	5.0e-46	48.7
WP_152385845.1\|4831258_4833124_+	hypothetical protein	A0A2H4P7F7	Pseudomonas_phage	8.3e-107	48.6
WP_152385846.1\|4833069_4833669_+	hypothetical protein	A0A2H4P7F7	Pseudomonas_phage	1.0e-21	40.6
WP_152389643.1\|4833668_4835150_+	hypothetical protein	A0A0F6R4X0	Sinorhizobium_phage	3.0e-51	57.5
WP_152385935.1\|4835167_4836175_+\|transposase	IS5 family transposase	NA	NA	NA	NA
WP_152389644.1\|4836283_4836493_+	hypothetical protein	NA	NA	NA	NA
WP_152389645.1\|4836526_4837057_+	hypothetical protein	NA	NA	NA	NA
WP_152390030.1\|4837229_4837433_+	hypothetical protein	C8ZKF3	Pseudomonas_phage	5.2e-15	67.8
WP_152389646.1\|4837509_4837992_+	hypothetical protein	A0A2H4JFP9	uncultured_Caudovirales_phage	1.2e-46	60.5
WP_152389647.1\|4838470_4839346_+	polysaccharide lyase family 7 protein	NA	NA	NA	NA
WP_152389648.1\|4839674_4840709_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.7e-59	34.9
WP_152389649.1\|4840940_4842251_+	trigger factor	NA	NA	NA	NA
4840754:4840804	attR	NA	NA	NA	NA
WP_152390031.1\|4842355_4842976_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	3.4e-57	57.5
WP_152389650.1\|4843078_4844359_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.6e-136	59.3
WP_152389651.1\|4844486_4846883_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.1e-223	52.4
WP_012700946.1\|4847019_4847292_+	DNA-binding protein HU-beta	A4JWM7	Burkholderia_virus	4.2e-20	59.6

DBSCAN-SWA_299

4856700 : 4857900

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389658.1\|4856700_4857246_-	GTP cyclohydrolase I FolE	A0A0P0HSD2	Acinetobacter_phage	2.4e-59	65.6
WP_152389659.1\|4857339_4857900_-	DNA mismatch repair protein MutS	A0A0P0IDT4	Acinetobacter_phage	1.4e-17	34.3

DBSCAN-SWA_300

4861338 : 4862430

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389663.1\|4861338_4862430_+	chorismate synthase	A0A291AU41	Pandoravirus	9.5e-79	42.8

DBSCAN-SWA_301

4874894 : 4876136

Pseudomonas_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389676.1\|4874894_4876136_-	DUF3596 domain-containing protein	Q76UT6	Pseudomonas_virus	4.6e-53	49.5

DBSCAN-SWA_302

4880097 : 4928941

Pseudomonas_phage(43.33%)

tail,terminase,plate,holin,transposase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152389684.1\|4880097_4881327_-	phosphoadenosine phosphosulfate reductase family protein	R9TRT5	Rhizobium_phage	3.6e-175	72.1
WP_152389685.1\|4881721_4881937_+	hypothetical protein	NA	NA	NA	NA
WP_152389686.1\|4882046_4882229_-	hypothetical protein	NA	NA	NA	NA
WP_152389687.1\|4882278_4884123_-	AAA family ATPase	H2BD46	Pseudomonas_phage	1.3e-152	52.1
WP_152389688.1\|4884129_4884855_-	cell division protein FtsK	J7I0T4	Pseudomonas_phage	8.8e-81	56.5
WP_152389689.1\|4884867_4885068_-	hypothetical protein	H2BD48	Pseudomonas_phage	1.3e-23	78.8
WP_152389690.1\|4885944_4886160_-	hypothetical protein	J7I4L3	Pseudomonas_phage	2.6e-17	60.6
WP_152389691.1\|4886164_4886974_-	PD-(D/E)XK nuclease family protein	J7HXJ4	Pseudomonas_phage	9.7e-113	72.4
WP_152389692.1\|4887241_4887490_-	hypothetical protein	NA	NA	NA	NA
WP_152389693.1\|4887486_4887723_-	hypothetical protein	NA	NA	NA	NA
WP_152389694.1\|4887706_4888069_-	hypothetical protein	NA	NA	NA	NA
WP_152389695.1\|4889082_4889346_-	hypothetical protein	NA	NA	NA	NA
WP_152389696.1\|4889394_4889574_-	hypothetical protein	A0A2H4J8U0	uncultured_Caudovirales_phage	7.8e-07	52.5
WP_152389697.1\|4890089_4890356_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_152389698.1\|4890609_4890885_+	hypothetical protein	NA	NA	NA	NA
WP_152390035.1\|4891044_4891257_+	hypothetical protein	NA	NA	NA	NA
WP_152389699.1\|4891362_4891611_+	hypothetical protein	NA	NA	NA	NA
WP_152389700.1\|4891999_4892209_+	hypothetical protein	NA	NA	NA	NA
WP_152389701.1\|4892371_4892623_-	DUF1654 domain-containing protein	A0A2K8HZW3	Pseudomonas_phage	3.8e-07	35.9
WP_152389702.1\|4893068_4893485_-	DUF1654 domain-containing protein	NA	NA	NA	NA
WP_152387531.1\|4893705_4895124_+\|transposase	IS4 family transposase	Q9JMP3	Wolbachia_phage	2.3e-61	32.8
WP_152389703.1\|4895341_4896004_-	helix-turn-helix domain-containing protein	K7P850	Enterobacteria_phage	4.9e-46	45.0
WP_152389704.1\|4896100_4896289_+	hypothetical protein	NA	NA	NA	NA
WP_152389705.1\|4896291_4896600_+	transcriptional regulator	A0A2H4J960	uncultured_Caudovirales_phage	9.0e-35	71.6
WP_152389706.1\|4896599_4896842_+	hypothetical protein	A0A127KNT4	Pseudomonas_phage	2.5e-08	50.8
WP_152389707.1\|4896828_4897833_+	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	4.7e-141	77.1
WP_152389708.1\|4897825_4899235_+	replicative DNA helicase	A0A127KNK8	Pseudomonas_phage	5.0e-213	81.8
WP_152389709.1\|4899227_4899677_+	RusA family crossover junction endodeoxyribonuclease	H2BD71	Pseudomonas_phage	1.1e-70	87.2
WP_152389710.1\|4899729_4900293_+	hypothetical protein	H2BDI9	Pseudomonas_virus	8.7e-52	57.1
WP_152389711.1\|4900566_4901124_+	nuclease	NA	NA	NA	NA
WP_152389712.1\|4901272_4901827_-	hypothetical protein	NA	NA	NA	NA
WP_152390036.1\|4901934_4902390_-	SH3 domain-containing protein	NA	NA	NA	NA
WP_152389713.1\|4902797_4905386_-	AAA family ATPase	NA	NA	NA	NA
WP_152389714.1\|4905944_4906628_-	hypothetical protein	NA	NA	NA	NA
WP_152389715.1\|4907116_4907341_+	hypothetical protein	NA	NA	NA	NA
WP_152390037.1\|4907416_4907719_-	helix-turn-helix domain-containing protein	A0A1S5NNJ5	Burkholderia_phage	1.2e-23	60.4
WP_152385914.1\|4907770_4908811_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	1.8e-10	28.1
WP_152388121.1\|4908870_4909908_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	4.4e-41	30.3
WP_152389716.1\|4910131_4910455_+\|holin	phage holin, lambda family	A0A1W6JTC7	Pseudomonas_phage	1.0e-20	50.5
WP_152389717.1\|4910527_4911274_+	hypothetical protein	NA	NA	NA	NA
WP_152389718.1\|4911379_4911925_+	DNA-packaging protein	A0A1B0Z033	Pseudomonas_phage	4.4e-77	79.0
WP_152389719.1\|4911896_4913828_+\|terminase	phage terminase large subunit family protein	A0A1B0Z2K0	Pseudomonas_phage	3.5e-310	78.0
WP_152389720.1\|4913827_4914031_+	hypothetical protein	NA	NA	NA	NA
WP_152389721.1\|4914032_4915589_+\|portal	phage portal protein	A0A1B2LRR5	Wolbachia_phage	4.7e-79	38.0
WP_152389722.1\|4917606_4917960_+	DUF2190 family protein	A0A2I7QRW1	Vibrio_phage	1.6e-11	43.6
WP_152389723.1\|4917963_4918287_+	electron transfer flavoprotein	NA	NA	NA	NA
WP_152389724.1\|4918289_4918844_+	hypothetical protein	NA	NA	NA	NA
WP_152389725.1\|4918840_4919032_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_152389726.1\|4919032_4920505_+\|tail	phage tail protein	A0A0C4UQS0	Shigella_phage	2.0e-87	41.1
WP_039804081.1\|4920538_4920898_+\|tail	tail protein	NA	NA	NA	NA
WP_152389727.1\|4920897_4921200_+	hypothetical protein	NA	NA	NA	NA
WP_152389728.1\|4921300_4922992_+	hypothetical protein	A0A291AUM6	Sinorhizobium_phage	4.1e-20	34.8
WP_152389729.1\|4923095_4923293_+	hypothetical protein	NA	NA	NA	NA
WP_152389730.1\|4923404_4925330_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_152389638.1\|4925687_4926881_+	hypothetical protein	A0A2P9JZK2	Alteromonadaceae_phage	2.2e-44	33.2
WP_152389639.1\|4926873_4927992_+\|tail	phage tail protein	M1PVV2	Vibrio_phage	5.4e-61	38.9
WP_152389640.1\|4927988_4928474_+\|plate	phage baseplate assembly protein V	A0A0C4UQZ3	Shigella_phage	3.2e-18	38.3
WP_152389641.1\|4928473_4928941_+	hypothetical protein	A0A2P9JZK5	Alteromonadaceae_phage	1.1e-23	41.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045303

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045302

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection