CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP045404	Roseovarius sp. THAF9 chromosome, complete genome	1 crisprs	csa3,WYL,cas3,DEDDh	1	1
NZ_CP045405	Roseovarius sp. THAF9 plasmid pTHAF9_a, complete sequence	0 crisprs	WYL	0	0
NZ_CP045408	Roseovarius sp. THAF9 plasmid pTHAF9_d, complete sequence	0 crisprs	NA	0	0
NZ_CP045406	Roseovarius sp. THAF9 plasmid pTHAF9_b, complete sequence	0 crisprs	NA	0	1
NZ_CP045407	Roseovarius sp. THAF9 plasmid pTHAF9_c, complete sequence	0 crisprs	NA	0	0
NZ_CP045409	Roseovarius sp. THAF9 plasmid pTHAF9_e, complete sequence	0 crisprs	NA	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045404_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045404_1

3650940-3651102

Orphan

Consensus_repeat	Method
CATTGCCGTTGAGCGTATCATTGCCGCC	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP045404_1

>merge|NZ_CP045404|1|3650940-3651102|CRISPRCasFinder
TTTCGCCAAAAAGCGTATCGTTGCCGTCGCCGCCGAAAATCGAGTCGAACCCGGTGCCGCCCAGCAGGCTGTCGTTGCCGCCATTGCCGTTGAGCGTATCATTGCCGCCTTCCCCCTGCAGAACCTCGTCGGCGTCATTGCCGTTGAGCGTATCATTGCCGCC

>NZ_CP045404|1|1|3650940-3651102|CRISPRCasFinder
TTTCGCCAAAAAGCGTATCGTTGCCGTC	GCCGCCGAAAATCGAGTCGAACCCGGTGCCGCCCAGCAGGCTGTCGTTGCCGC
CATTGCCGTTGAGCGTATCATTGCCGCC	TTCCCCCTGCAGAACCTCGTCGGCGT
CATTGCCGTTGAGCGTATCATTGCCGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045404.1\|WP_152476319.1\|3635748_3636603_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|132060
NZ_CP045404.1\|WP_152476320.1\|3636603_3638157_+\|lipopolysaccharide-biosynthesis-protein	unknown	unknown	gnl\|CDD\|274386
NZ_CP045404.1\|WP_152476332.1\|3660382_3660775_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045404.1\|WP_152476323.1\|3640001_3642002_-\|acyltransferase-family-protein	unknown	unknown	gnl\|CDD\|224748
NZ_CP045404.1\|WP_103762904.1\|3664302_3664572_+\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170
NZ_CP045404.1\|WP_152476318.1\|3634796_3635414_-\|polysaccharide-biosynthesis/export-family-protein	unknown	unknown	gnl\|CDD\|376821
NZ_CP045404.1\|WP_152476336.1\|3664652_3665612_-\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP045404.1\|WP_152476324.1\|3642331_3642700_-\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|235094
NZ_CP045404.1\|WP_152476335.1\|3663144_3664143_+\|calcium-binding-protein	unknown	unknown	gnl\|CDD\|380205
NZ_CP045404.1\|WP_172977548.1\|3642696_3644187_-\|UbiA-family-prenyltransferase	unknown	unknown	gnl\|CDD\|236195
NZ_CP045404.1\|WP_152476329.1\|3656277_3657768_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045404.1\|WP_172977547.1\|3638398_3639052_+\|CpsD/CapB-family-tyrosine-protein-kinase	unknown	unknown	gnl\|CDD\|349772
NZ_CP045404.1\|WP_152476330.1\|3657888_3658848_-\|T9SS-C-terminal-target-domain-containing-protein	unknown	unknown	unknown
NZ_CP045404.1\|WP_152476331.1\|3659880_3660369_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045404.1\|WP_152476322.1\|3639377_3639638_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045404.1\|WP_152477224.1\|3655037_3655871_-\|2OG-Fe(II)-oxygenase	unknown	unknown	gnl\|CDD\|379309
NZ_CP045404.1\|WP_152476326.1\|3644301_3646047_+\|phospholipid-carrier-dependent-glycosyltransferase	unknown	unknown	gnl\|CDD\|224206
NZ_CP045404.1\|WP_172977549.1\|3646708_3649060_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|223395
NZ_CP045404.1\|WP_152476334.1\|3662023_3662977_+\|NAD-binding-protein	unknown	unknown	gnl\|CDD\|224995
NZ_CP045404.1\|WP_152476333.1\|3660904_3661933_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380489

Protein	Function_ID	Function_description	E-value
NZ_CP045404.1\|WP_152476319.1\|3635748_3636603_+\|AAA-family-ATPase	gnl\|CDD\|132060	TIGR03015, pepcterm_ATPase, putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems. [Protein fate, Protein and peptide secretion and trafficking].	6.87874e-80
NZ_CP045404.1\|WP_152476320.1\|3636603_3638157_+\|lipopolysaccharide-biosynthesis-protein	gnl\|CDD\|274386	TIGR03007, pepcterm_ChnLen, polysaccharide chain length determinant protein, PEP-CTERM locus subfamily. Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides].	5.65077e-45
NZ_CP045404.1\|WP_152476323.1\|3640001_3642002_-\|acyltransferase-family-protein	gnl\|CDD\|224748	COG1835, COG1835, Predicted acyltransferases [Lipid metabolism].	3.6741e-57
NZ_CP045404.1\|WP_103762904.1\|3664302_3664572_+\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	9.71292e-54
NZ_CP045404.1\|WP_152476318.1\|3634796_3635414_-\|polysaccharide-biosynthesis/export-family-protein	gnl\|CDD\|376821	pfam02563, Poly_export, Polysaccharide biosynthesis/export protein. This is a family of periplasmic proteins involved in polysaccharide biosynthesis and/or export.	1.27289e-18
NZ_CP045404.1\|WP_152476336.1\|3664652_3665612_-\|diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	3.11491e-45
NZ_CP045404.1\|WP_152476324.1\|3642331_3642700_-\|EamA-family-transporter	gnl\|CDD\|235094	PRK02971, PRK02971, 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF; Provisional.	1.68618e-06
NZ_CP045404.1\|WP_152476335.1\|3663144_3664143_+\|calcium-binding-protein	gnl\|CDD\|380205	NF033203, entero_EhxA, enterohemolysin EhxA. Members of this family are the RTX toxin called enterohemolysin or EhxA, because it is found in enterohemorrhagic Escherichia coli (EHEC) strains such as O157:H7.	1.00203e-21
NZ_CP045404.1\|WP_152476333.1\|3660904_3661933_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|380489	cd01575, PBP1_GntR, ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. This group represents the ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of GntR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type 1 periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type 1 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding, which in turn changes the DNA binding affinity of the repressor.	2.55996e-104
NZ_CP045404.1\|WP_172977547.1\|3638398_3639052_+\|CpsD/CapB-family-tyrosine-protein-kinase	gnl\|CDD\|349772	cd05387, BY-kinase, bacterial tyrosine-kinase. Bacterial tyrosine (BY)-kinases catalyze the autophosphorylation on a C-terminal tyrosine cluster and also phosphorylate endogenous protein substrates by using ATP as phosphoryl donor. Besides their capacity to function as tyrosine kinase, most of these proteins are also involved in the production and transport of exopolysaccharides. BY-kinases are involved in a number of physiological processes ranging from stress resistance to pathogenicity.	4.85155e-36
NZ_CP045404.1\|WP_152476334.1\|3662023_3662977_+\|NAD-binding-protein	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	4.52505e-64
NZ_CP045404.1\|WP_152477224.1\|3655037_3655871_-\|2OG-Fe(II)-oxygenase	gnl\|CDD\|379309	pfam13640, 2OG-FeII_Oxy_3, 2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.	1.26558e-18
NZ_CP045404.1\|WP_172977548.1\|3642696_3644187_-\|UbiA-family-prenyltransferase	gnl\|CDD\|236195	PRK08238, PRK08238, UbiA family prenyltransferase.	2.12927e-167
NZ_CP045404.1\|WP_152476326.1\|3644301_3646047_+\|phospholipid-carrier-dependent-glycosyltransferase	gnl\|CDD\|224206	COG1287, COG1287, Uncharacterized membrane protein, required for N-linked glycosylation [General function prediction only].	2.27778e-09
NZ_CP045404.1\|WP_172977549.1\|3646708_3649060_-\|AMP-binding-protein	gnl\|CDD\|223395	COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism].	4.88252e-50

>NZ_CP045404.1|WP_172977549.1|3646708_3649060_-|AMP-binding-protein
MPPQISLTSVESPRSGGGWLQRSFGEYPPDSIAQITFTSGTEGTPKGIAISHRALSDTVSRLNDVMEVDETIREYIGVPVYYSFGFGRCRAVCRAGGAAYIPEKGFSLTDFAAMLRDGKVNALSAVPTLLRLVLRNPELFDQCGARLRWIEIGSQYMAPEEKAALCEIFPNARIVMHYGMTEASRTTFQIVSETTGEALGGVGHAYGEVELALAPDGRIRIRGPHVASYALEQGEQRDLTDMDGWYQSNDLGEFRDGQLWFLGRADDVINVSGVKVSSEAIEQKLHAVVPDPTRVAVTPFSDPLRGEKVLVATEPDAGLELETLKEIAETVLTDIHPALKGAVQVSEIDHIPRTQTNKVRRKALRETLMAASEDNAPASDMPPARVRAATRLDTVIALFERQFPRAKITPDTTLESVGGTSLDYVELSLALEQSLGHDPGDWHTATVRELAQAAGSDGWSLKFDQMAARAACAFLVVLAHVIGDTPESGLHLPGDHPMRLFNEFANYFKMPLFAFVSGWSFALLGTAAMRPANFAQSTFKTLIVPTVLSMLAFAGLVSAIGRSSGAHPPGLADVFLYPYEHFWFIQTLILLVVVVYAAMRLPERLRFIALSALVVLPIAMPWLFGTNILSINGILVLGPFYALGILLSDKIATLAQRPGLTLIVIGATSLAGIVFAYLVFDRTGGVLLMPHPAGFLIGLPLVFLCLLVSAYLPFVKRIAPYTFYIYLWHVFATSATRRALYSAGVEDLGIHIVAGLGAGIAVPVLACLALQRFGLFAVFSGRW
>NZ_CP045404.1|WP_152476326.1|3644301_3646047_+|phospholipid-carrier-dependent-glycosyltransferase
MRFLLKHKPAILLTIFPCAALFLLAFVLRALGVDYGYFHGDERISDAAKVLTGDLIPGQHFYPPFINYVNGIAFGALFAVGLPFGWWDGVGSFRAQYFDDPTVFYVTARLVTAAFGALLAPIFYLCARRIGLAPGTSLITGLLAALFPLAVYQSHIAKGDVAMATFIVAAIAATLARVGTDRPFRWDALFGLAVVLALSFKHSAVFVLAPLALGHLLILGFREGARAAGLAFLRGIIVVLILWPILNIGTILDFKTFLEYQQIQSVMSIRGNDGPLSGVATLAARLPHLVLGLTPVFGLVALVFPVCLLAPIIARRFKPHLLMIWLALMIGTLSTAVLVGPRQPEHLWIGNFAGFLLLAGLGLAGLLSGVRSGLRPVVTVLIIAGVGLATLGAARPIMQAIADPVYLETDDILRDRYVGTRVLSMVETDIPIKEAARDMQIARWERLAEKYQVTLPDMAEERLQKTEAPDAQFIFPMPVAMYGLEHVDEDAEDYTVQAHAWPLQSQEWQLDYWLKQGFTVVILKDLDYMRNEVSSQLIRAFAEELVGRCTIVDSIEPRKPLFLEREISVFECAEADDNASG
>NZ_CP045404.1|WP_172977548.1|3642696_3644187_-|UbiA-family-prenyltransferase
MSAQDHALPTKQAKSPAAMPLYVDLDGTLIRSDAAQEMLIATLRKPDGIRALLRAAMNRDVTQIKRVSADHALLDAARLPYNAEVVDYLAEARAEGRRVVLATAADAKVAHAVADHLGVFDAVIATEPGANQKGKVKLAAIKRDCGDAPFEYLGDSDADLPIWQAAAGRGFVNPTGKAYDASKQAGDALTVLVQDKPDTRRGLIKAMRPHQWVKNVLVFIPVLFAHAYGDLKTVALACAAFVVFSALTSGTYLINDLFDIEADRQHPRKRNRPFAAGVVTPLTGVKVAVALIGGALLAGFWGIGFGFGMGLLSYLVMTMTYTFVLKSLSTIDVIVLGLLFTVRVVAGGLATGILISPWLLTFSFFFFVSLAYLKRYIELFKMKDAEKLPSRNYWREELSVVQSFGITTAALSLLTLSQYLMHPDVRLTYSGKDLLWLIIPLLMFWTYRIWMWASRGKVHDDPVLFAFKDKISRISLGLMLLLVILARYVSLEPILQ
>NZ_CP045404.1|WP_152476324.1|3642331_3642700_-|EamA-family-transporter
MTIAAFTLIFASVSLSALGQTLFKAGVGQAHFAEGASTLLKAVSLLTSPGVLAGLAAYGVGTVLWLFALKRIDLSLAYPFVAMSFVMVAASAVLFLGETLTIARVVGLSLIVAGLLVMAFGH
>NZ_CP045404.1|WP_152476323.1|3640001_3642002_-|acyltransferase-family-protein
MIHGYRAEIDGLRAIAIIPVVLFHFNLAGLQGGFVGVDVFFVISGFLIGGILWDELRETGRIRLGRFFLRRVRRLAPAYYVMAFASFIAAWFILLPFEFREFGKELIAATVYLSNVLFWRSAGYFDVLGEERVLLHTWSLAVEEQFYLFLPLFLLLLARARTALPWVLSTIGLVSLAACIVVTETSATTAFYLFPFRAWELLAGVLLAIYGRESGFKWEIGAWVSWAGLALILLAVLMLEPGDAFPGALALLPVAGTVLMIANGKQANPVNRVLTTPVFLFFGAISYSLYLWHWPIVTLAKYYTGDALGLGMSVVLIAISVAVAWLSLKLVENPVRRSSIRAIPLFSGYLAASAVVLGVGFVLYSKDGLIERFGPTERPAILATRDFLQDWSRCHTPSEGAFSGIEICPIGPEGAPRVLIWGDSHARAFKEGLEHLAFQEDVPGILIWRAGCPPLLGLSKTEKAATAFEDAACTQSNQAMDEVLSKLPGSIDAALLLARWTYYADGRGIGADAQNRISLSPAPGARISGETAPELLVQAFGETIQRLSDAGAETFVLRQAPEIFDFGAREMARALVYGQMTLRDVTNTIATTSRRELKERNASVDAILADLGVPIIDIWPRLCSGDKCSALQGSEIFYFDNNHVTNTGAIALSNSFKPVFDAAGDL
>NZ_CP045404.1|WP_152476322.1|3639377_3639638_+|hypothetical-protein
MTLGYIIIGIVSGLVASAFALFSGESIPAAFGIYVGVGILMTLIGPLLMILREIIRKRITHASSSRIAQSPAWSVHRVSASTTKRR
>NZ_CP045404.1|WP_172977547.1|3638398_3639052_+|CpsD/CapB-family-tyrosine-protein-kinase
MTTYEHDAESAPFDLLRTRMLQQAHDNGWRRIGLVSPHAGCGKSTVTVNLAFSLARHRDIYSLVLDFDLRRKGMTNVLGQFPSLGTADALRREADFSDVARRFGPNVAFGLNSERRVQDPSEILQSSMTAEFLEKIETKYQPDIVLFDLPPIMDSDDNFGFLKNVDCALIVIAAEKTPMSQIDVAERHVAELTNVMGLVLNKCRYPSKTQGHVYGKY
>NZ_CP045404.1|WP_152476320.1|3636603_3638157_+|lipopolysaccharide-biosynthesis-protein
MEDLRYYLAVFKRRLPYFLIVSTLVSAISVVVAYTLPPVYESRMVLLVEAPKIPEDLASSTVQTPAFEQLQLLQQRVFTRNNLLTIAREHNALPEMSEMSPDEIIGRMRDRTGIQTSNRFAQEVPLMTVSFEAPVAITTAAVLNAYLDLILQQDTEFRRGRSTETLEFFQQELERLGAEIDRQGARILEFKQANTDALPDSLDFRMDQQSDLQDQLAEIDREINGFRSQRSRLVQLYELTGGVEDATTPVQSAEERALEEAKTELQNALAIYAPDNPRVKLLETRIKNLKAAVDASADISNETREPVSEEDLPPVLRVQLDEVDASIDALQAQKERIQERIDALTTTIERTPEVAIVLEEMNRKYETIQDQYERAEERLSAAQIGDQIETRSRGQRITVIEQPTVPDRPTKPSRKKLAVAGSGLGMLAGIALIVLLEFINNTARRPEDIIKRFGVTPISTIPYIQTKGQRIWRRARQLLVLLLIVVGIPAALYAIHIYYLPLDLLAEKVMEKLGIRL
>NZ_CP045404.1|WP_152476319.1|3635748_3636603_+|AAA-family-ATPase
MSADQLYESFFGLTERPFSLVPDPEYMYWTPEHKRAYSILEFGIMSRAPITLITGEVGAGKTTLLQKLLSDIDDNVTIGLISNAQGGRGELVQWILNALDINVDPAAAYVQSFRVLQDFLLSEYAAGSRVVLIIDEAQNLSAEGLEELRMLTNINSNKDVLIQLILVGQPELRDMVNAPNMKQLVQRISANFHLSRMSRETVSQYISHRLRTAGGTGNEFTREACDHIFKETDGVPRLVNQLCDLALLYAWSAEENTVENRTIQAIIDDNVFMNRAADTEEDGS
>NZ_CP045404.1|WP_152476318.1|3634796_3635414_-|polysaccharide-biosynthesis/export-family-protein
MRNSIGNRFAALVLGLGLLLASALTASAQNYVIRSGDILQVDVLEDSSLNRRLLVLPDGSINFPMVGAIRAAGRTVEQVRRNLTTALTPNFASAPTVYVAIDELAEIEETSNLMDVYAIGEFEEPGRIEVKPGTTLLQFLAEAGGLSRFAADKRIELHRTDRHTGRVNTYRFNSRTPAGSATGISGGTRLAPGDVVEAPQRRLFE
>NZ_CP045404.1|WP_152477224.1|3655037_3655871_-|2OG-Fe(II)-oxygenase
MAILNLDPETLLISTDAARNAAKPHAEIYQNREPYPYGGFDDFLPPEILDRVLEEMSQLPDAETSFDRAQEKLKTSYQPERLPPYTRALFYALNSRPVLAFLEELTGIRGLIPDPYFMGGGIHRVANGGHLDIHADFNHHKLMNLERRLNILIYLNKNWKEEYGGSFEIWNKDMTEKVEGFVPVFNRMCCFNTSSDSWHGNPETVNHPNGEARMSIALYYYTATWDSTRKGHTTLFKPRPGTADQPDRVIARREWLQDVLPPFIHRKIGHRLQRFGF
>NZ_CP045404.1|WP_152476329.1|3656277_3657768_+|hypothetical-protein
MPNLTAYIVLFTFPLVVVILFKRMPLQHALVWSIVAGYLLLPLRAGFDLPVLPPVDKTLIPAGCAGLMCLIASRSDPHPFKIARGQSIFWGLIALLTVGPVITALQNGQPIIIGATYLPAIRPYDAASMVLSMLVMILPFLLGRRYLGTEEGQWILLRVLVLSILAYSPLILFESRMSPQLNQMIYGFFPHIFEMHVRGNGFRPLVFLNHGLWLAIAVATAFVSCLAMVRLSPDGKMRARWMMAAFYLFFVLLLCRSLGPLSLSLLAAPLVLLLSPRLQGLVAAVLAATVLLYPILRGSDLVPTEQVYQIAESINEERAASLQYRLDNEDLLLEKAEQKPLGGWGSWGRNFVYNQEGQNISTTDGYWIIVIGVYGWIGYLAQFGLLTLPMILLGLARIRLSLGLASSCLGVVMSINLIDQIPNATVSPIVWLIAGSMMGLYQTAPLRGTTTEQAPESAPNTDPAPPPELAYRREFTKASRRHVSSSNKTTRFENRD
>NZ_CP045404.1|WP_152476330.1|3657888_3658848_-|T9SS-C-terminal-target-domain-containing-protein
MKVVLLLVIAVATSVLGAGYFTDRLPLTAENGARSSDVVLANLLSGNTTPKTHVRSFIIGNSLVNHEAGRGSDLTSVPYWLARLARQDGNTYAMAGTYTLLREFKDKGPESTWSFNGVTSAWNSDGGVSFGDADFTSVQINPLNYVQWRGPTEPYWDDNGTPVGATLEVIDVVTAAEPGIEVLIYEGWADMGPFVSGDFPPSPRAFAKYHAYNLGEYHEWYLEYVRELQAARPDVDIRLIPVSSALSTLLTQSPLNQLSPTDLYEDDAPHGTPTKYFLASLVTYVGTYGKLPPTDFAVPPSVHPLVRSNYAEIVAALGG
>NZ_CP045404.1|WP_152476331.1|3659880_3660369_+|hypothetical-protein
MFGNFATATAINENQFALGNPQNTYASPGINLADSTAAQGPVVDCPTTDAAGNLAVDTSALPTAALTSAVQANAGSIAAKSREIASNARGISSNKEGIATAMALDTPYVSSGRTFALSTGVGAFEGKTAFALNMVCRASDTAQFEAGLAHGFEGTRPVAVSG
>NZ_CP045404.1|WP_152476332.1|3660382_3660775_+|hypothetical-protein
MVTRLALKRTSQRIVAALFALALITGDAAAQEMVERSFAVALIRDIMTTVNHDNWTGNDTVLRDYAPPEFSAIKDPTRLAGLFTPVREAGLDMLPVLVTEPEILRAQISAGGQRRSALSHARYFGGGFRS
>NZ_CP045404.1|WP_152476333.1|3660904_3661933_+|substrate-binding-domain-containing-protein
MTSHDTRPLTLRDVSEASGVSEMTVSRVLRNRGDVSDATRKRVLEAARALGYVPNKIAGALASQRVNLVAVVIPSMSNMVFPDVMTGISEALDETELQPVVGVTGYRPEKEEKVLYEMLSWRPSGVIIAGMEHSDAARAMLRASGIPVVEIMDVDGTAIDSVVGISHRRAGSQMAQAIIKAGYRRIAFLGTKMPLDHRARKRFEGFTETLAKAGIEIEDREFYSGGSALKKGREMTRDVLARSPDLDFIYYSNDLIGAGGLLYLTEQGIDIPGQMGLAGFNGVDLIKGLPRELATMESCRQEIGRRAAELIVARASGTDSPGVPSRIVLEPTLTYGDTLRRH
>NZ_CP045404.1|WP_152476334.1|3662023_3662977_+|NAD-binding-protein
MKTGFIGLGNVGGKLAGSLLRNGVDLTVHDLDPDLVAGFTARGAQAAESPAQMMQDCDAVITCLPSPAASDAVLRQMLPHMGPGKIWMEMSTTDEAEVKRLGSQVIAAGGAAVDCPVSGGCHRADTGNISIFAGCDRATFDRILPLLKTMGRRILHTGDLGSASVLKVMTNYLATANLLTLCEALVTMKGAGMDLATTYQAIAISSGTSFVHETESQVILNGSRDINFTMDLVKKDIGLFQAIADRAGVPLEISPLMISILEDGIRRYGLRAQSDDIIRRLEEATGLDITAPGFPAEMVDDEPEETGYEVYAPGRIS
>NZ_CP045404.1|WP_152476335.1|3663144_3664143_+|calcium-binding-protein
MLFLAGLIGMVAVSTAAMWGFEELSTENARDEVTTPGDTEQPEMTTNSSALLDIATGPEDAADDPEGDDYGVSRGTTVADTLSGTSINEFLDGLDDDDTILAGDGDDVANGGDGNDAVSGDRGDDTLHGGAGNDTVSGGDGNDSVLGHDGDDLLDGEDGDDSLLGGEGDDTLSGGAGNDALHGYLDDDTLDGGAGSDTLFGGDGNDQLSGIAPGGTPPEDDQDYLNGGAGDDRISLGAGDIATGGNGADSFILRDWLDAQHQGQIVDFNTSEDNLVLLYDDTGDAAPDVSIEGGTDVPGLHRILLDGEVVAEVTSDAALTLAHITLIPQTEG
>NZ_CP045404.1|WP_103762904.1|3664302_3664572_+|30S-ribosomal-protein-S15
MSITVEEKAKVLKEFATKEGDTGSPEVQVAILTSRITTLTEHFKTHKKDNHGRRGLLKMVAQRRKLLDYLKGKDEGRYQDLIKRLGIRR
>NZ_CP045404.1|WP_152476336.1|3664652_3665612_-|diguanylate-cyclase
MTTDPRLAGVGIALDALSQAAMVVDATGTILLDNRPARARYATGRPGGIVDLAAASRGQVLAELRRVVRTTGASFLRLCRDGHATGVFKLKRLDGMCPAQNRLILMLEDQNAVMVGKILKASELVKTRDGALQLSKRREEDLRREARRLRELGRIDPVTDLLNRRAFEEAVRNGLRSGPGALLFCDLDDFKAVNDRLGHRAGDCVLQQAALRLRDVFQANGICGRIGGDEFAAWLPAVGRAEAAVGADAVVRSCAERFPLGEGEQVAVGVSVGVAVAPEDGGDFEALMACADMRMYAEKARLRVCDWPDARSAPPRIEA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	FJ168661	Mycobacterium phage Gumball, complete genome	11815-11840	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	FJ168662	Mycobacterium phage Troll4, complete genome	11866-11891	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	JF937107	Mycobacterium phage SirHarley, complete genome	11797-11822	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	MK524498	Mycobacterium phage Chill, complete genome	11868-11893	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	MK494102	Mycobacterium phage WaldoWhy, complete genome	11868-11893	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	JN699014	Mycobacterium phage Nova, complete genome	12292-12317	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	MN234227	Mycobacterium phage Giuseppe, complete genome	11857-11882	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	MH025888	Mycobacterium phage BigMama, complete genome	11878-11903	4	0.846
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_CP029453	Sinorhizobium fredii CCBAU 25509 plasmid pSF25509a, complete sequence	56525-56550	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NC_013855	Azospirillum sp. B510 plasmid pAB510a, complete sequence	917214-917239	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_CP023069	Ensifer sojae CCBAU 05684 plasmid pSJ05684a, complete sequence	56600-56625	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_CP029233	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436a, complete sequence	58691-58716	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_CP022367	Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence	1665128-1665153	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_HG938354	Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence	70037-70062	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	NZ_CP048285	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248a, complete sequence	10852-10877	5	0.808
NZ_CP045404_1	1.2\|3651049\|26\|NZ_CP045404\|CRISPRCasFinder	3651049-3651074	26	CP021131	Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence	86981-87006	6	0.769

1. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to FJ168661 (Mycobacterium phage Gumball, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggctt	Protospacer
.** *** **************** *

2. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to FJ168662 (Mycobacterium phage Troll4, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

3. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to JF937107 (Mycobacterium phage SirHarley, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggctt	Protospacer
.** *** **************** *

4. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to MK524498 (Mycobacterium phage Chill, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

5. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to MK494102 (Mycobacterium phage WaldoWhy, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

6. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to JN699014 (Mycobacterium phage Nova, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

7. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to MN234227 (Mycobacterium phage Giuseppe, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

8. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to MH025888 (Mycobacterium phage BigMama, complete genome) position: , mismatch: 4, identity: 0.846

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ctcgcccagcagaacctcgtcggcct	Protospacer
.** *** **************** *

9. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_CP029453 (Sinorhizobium fredii CCBAU 25509 plasmid pSF25509a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
agccgcctgcagatcctcgtcggcgc	Protospacer
  ** ******** ***********.

10. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NC_013855 (Azospirillum sp. B510 plasmid pAB510a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ggcccacagcagaacctcgtcggcgc	Protospacer
  *** * *****************.

11. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_CP023069 (Ensifer sojae CCBAU 05684 plasmid pSJ05684a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
agccgcctgcagatcctcgtcggcgc	Protospacer
  ** ******** ***********.

12. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_CP029233 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
agccgcctgcagatcctcgtcggcgc	Protospacer
  ** ******** ***********.

13. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_CP022367 (Azospirillum sp. TSH58 plasmid TSH58_p02, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
cttgcgctgcagaacctcgtcggcgc	Protospacer
.*. * *******************.

14. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_HG938354 (Neorhizobium galegae bv. orientalis str. HAMBI 540 plasmid pHAMBI540a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
ttcgccctccagaacctcgtcggtca	Protospacer
*** **** **************.

15. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to NZ_CP048285 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248a, complete sequence) position: , mismatch: 5, identity: 0.808

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
gtcaccctgcagaaactcgtcggcca	Protospacer
 ** ********** *********

16. spacer 1.2|3651049|26|NZ_CP045404|CRISPRCasFinder matches to CP021131 (Meiothermus taiwanensis strain WR-220 plasmid pMtWR-220, complete sequence) position: , mismatch: 6, identity: 0.769

ttccccctgcagaacctcgtcggcgt	CRISPR spacer
caaagcctgcagaacctcgtcggtgt	Protospacer
.    ******************.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3585973 : 3593458

Enterobacteria_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152476285.1\|3585973_3586957_+	DUF2793 domain-containing protein	F4YXU6	Roseobacter_phage	4.0e-28	30.3
WP_172977545.1\|3586960_3587137_+	hypothetical protein	NA	NA	NA	NA
WP_152476286.1\|3587214_3587781_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	2.3e-36	44.0
WP_152476287.1\|3587777_3588821_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.8e-95	53.0
WP_152476288.1\|3588974_3589640_+	sulfotransferase family 2 domain-containing protein	NA	NA	NA	NA
WP_152476289.1\|3589636_3590488_+	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	7.5e-31	37.3
WP_152476290.1\|3590489_3591368_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_152476291.1\|3591379_3592246_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.9e-90	56.8
WP_152476292.1\|3592345_3593458_-	site-specific DNA-methyltransferase	A0A249XUJ2	Enterococcus_phage	2.2e-30	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045406

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12096 : 78038

Escherichia_phage(13.33%)

transposase,integrase

attL 8088:8103|attR 79320:79335

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
8088:8103	attL	NA	NA	NA	NA
WP_152477339.1\|12096_13455_+\|transposase	ISKra4 family transposase	NA	NA	NA	NA
WP_152477427.1\|13454_14183_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	6.0e-45	46.0
WP_152477340.1\|14287_15172_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152477341.1\|15271_16450_+	MFS transporter	NA	NA	NA	NA
WP_152477342.1\|16587_17412_+	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	2.1e-38	36.5
WP_152477343.1\|17443_18115_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_172977601.1\|18231_18459_-	hypothetical protein	NA	NA	NA	NA
WP_152477345.1\|18897_19593_-	hypothetical protein	A0A223W0P2	Agrobacterium_phage	3.4e-13	41.5
WP_152477346.1\|19603_23134_-	hypothetical protein	NA	NA	NA	NA
WP_152477347.1\|23133_36054_-	DUF11 domain-containing protein	NA	NA	NA	NA
WP_057795742.1\|37771_38869_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_152477348.1\|38927_39812_+	recombinase family protein	A0A0C4UR34	Shigella_phage	3.4e-34	55.6
WP_057795746.1\|39938_40232_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152477428.1\|40228_40510_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_144435659.1\|40595_41727_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	1.9e-21	31.1
WP_057795750.1\|42188_42416_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_152477349.1\|42879_44079_+	plasmid partitioning protein RepA	A0A240F4U1	Ochrobactrum_phage	1.2e-87	47.1
WP_152477350.1\|44063_45047_+	plasmid partitioning protein RepB	A0A240F4U0	Ochrobactrum_phage	7.6e-27	31.5
WP_152477351.1\|45285_46341_+	replication initiator RepC	NA	NA	NA	NA
WP_152477352.1\|48536_49490_+	DUF1403 family protein	NA	NA	NA	NA
WP_152477353.1\|49486_50092_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	6.6e-13	27.3
WP_152477354.1\|50115_50856_+	UPF0489 family protein	NA	NA	NA	NA
WP_152477355.1\|50916_52074_+	RES domain-containing protein	NA	NA	NA	NA
WP_152477356.1\|52161_52665_-	type II toxin-antitoxin system VapC family toxin	NA	NA	NA	NA
WP_172977602.1\|52673_53744_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_057795883.1\|53848_54073_+	DUF2188 domain-containing protein	E8ZD70	Streptococcus_phage	2.3e-16	58.3
WP_152477357.1\|54080_55067_+	patatin-like phospholipase family protein	A0A1B2LRS3	Wolbachia_phage	5.0e-18	30.8
WP_152477358.1\|55063_56263_+	nucleotidyltransferase	NA	NA	NA	NA
WP_152477359.1\|56268_56745_+	hypothetical protein	NA	NA	NA	NA
WP_152477360.1\|57062_58085_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_152477361.1\|58086_58599_-	hypothetical protein	NA	NA	NA	NA
WP_152477362.1\|58595_58958_-	hypothetical protein	NA	NA	NA	NA
WP_152477430.1\|59250_59913_+	hypothetical protein	NA	NA	NA	NA
WP_152477363.1\|59909_60953_+	nucleotidyl transferase AbiEii/AbiGii toxin family protein	NA	NA	NA	NA
WP_152477364.1\|61071_62562_+	hypothetical protein	NA	NA	NA	NA
WP_172977603.1\|62793_66093_+	DEAD/DEAH box helicase family protein	A0A2I5ARD8	Synechococcus_phage	5.9e-07	24.5
WP_057795715.1\|66105_67236_+	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_152477366.1\|67323_68271_-	HNH endonuclease	C7BGE9	Burkholderia_phage	1.7e-07	34.0
WP_152477367.1\|68267_70511_-	AAA family ATPase	NA	NA	NA	NA
WP_152477368.1\|70700_71829_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.8e-56	41.2
WP_152477369.1\|71999_72938_-\|integrase	tyrosine-type recombinase/integrase	U5Q0B8	Bacillus_phage	1.2e-10	26.4
WP_152477370.1\|73278_73710_+	hypothetical protein	NA	NA	NA	NA
WP_172977604.1\|74047_74368_-	H-NS histone family protein	NA	NA	NA	NA
WP_152477372.1\|74574_74886_-	hypothetical protein	NA	NA	NA	NA
WP_172977605.1\|75290_76301_+	hypothetical protein	NA	NA	NA	NA
WP_152477374.1\|76686_78038_-\|transposase	IS3 family transposase	A0A077SLK2	Escherichia_phage	6.8e-10	24.8
79320:79335	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045404

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045406

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection