CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP045533	Bacillaceae bacterium C02 chromosome, complete genome	2 crisprs	cas3,csa3,WYL,DinG,RT,DEDDh,c2c9_V-U4	2	7	6
NZ_CP045535	Bacillaceae bacterium C02 plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	0
NZ_CP045534	Bacillaceae bacterium C02 plasmid unnamed1, complete sequence	0 crisprs	RT,cas14j,csa3	0	0	12
NZ_CP045536	Bacillaceae bacterium C02 plasmid unnamed3, complete sequence	0 crisprs	NA	0	0	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045533_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045533_1

1243915-1244149

Orphan

Consensus_repeat	Method
TGTATGATTACCTTCCGCATGAGAA	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP045533_1

>merge|NZ_CP045533|1|1243915-1244149|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAAGAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGATTGTATGTTTACCTTCCGCATGAGAATAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTTTGTTTTTGATCCTTCTGCATGAGAGAAAGAACCTTTTGCATGTGTCAGAAGTCCTTCTGCATGTGAA

>NZ_CP045533|1|1|1243915-1244149|CRISPRCasFinder
TGTATGATTACCTTCCGCATGAGAA	GAGAATCCGTTAGCGATAGTCGCGGTTCCTTCTGCATGTGCTGCTTCGCCTAAAGCGAT
TGTATGTTTACCTTCCGCATGAGAA	TAGGAGCCACCTGCTGTCGTTTCACTTCCTTCACTATGGGAACTATGTCCAGTTGCTTT
TGTTTTTGATCCTTCTGCATGAGAG	AAAGAACCTTTTGCATG
TGTCAGAAGTCCTTCTGCATGTGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045533.1\|WP_000932900.1\|1250829_1251930_+\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|133005
NZ_CP045533.1\|WP_000069694.1\|1249776_1250664_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|375999
NZ_CP045533.1\|WP_000655329.1\|1245668_1246829_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP045533.1\|WP_000673184.1\|1241512_1242310_+\|NAD-kinase	unknown	unknown	gnl\|CDD\|235317
NZ_CP045533.1\|WP_000003390.1\|1235909_1237736_+\|oligoendopeptidase-F	unknown	unknown	gnl\|CDD\|341071
NZ_CP045533.1\|WP_000612264.1\|1234614_1235859_+\|competence-protein	unknown	unknown	gnl\|CDD\|226875
NZ_CP045533.1\|WP_001081482.1\|1240855_1241494_+\|GTP-pyrophosphokinase-family-protein	unknown	unknown	gnl\|CDD\|225232
NZ_CP045533.1\|WP_001079095.1\|1242325_1243219_+\|RluA-family-pseudouridine-synthase	unknown	unknown	gnl\|CDD\|223638
NZ_CP045533.1\|WP_000799204.1\|1232989_1234534_+\|cardiolipin-synthase	unknown	unknown	gnl\|CDD\|234967
NZ_CP045533.1\|WP_000043379.1\|1239149_1239548_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|381281
NZ_CP045533.1\|WP_000872720.1\|1244853_1245594_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	unknown	unknown	gnl\|CDD\|184187
NZ_CP045533.1\|WP_001272381.1\|1252767_1253454_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345
NZ_CP045533.1\|WP_001004740.1\|1247913_1248672_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP045533.1\|WP_000360652.1\|1238256_1239150_-\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|372699
NZ_CP045533.1\|WP_001087862.1\|1252081_1252771_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|372616
NZ_CP045533.1\|WP_000427737.1\|1246971_1247907_-\|glycosyltransferase-family-2-protein	unknown	unknown	gnl\|CDD\|366154
NZ_CP045533.1\|WP_000191110.1\|1239728_1240307_-\|CYTH-domain-containing-protein	unknown	unknown	gnl\|CDD\|143627
NZ_CP045533.1\|WP_001180003.1\|1240453_1240825_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000428846.1\|1248808_1249654_-\|macrocin-O-methyltransferase	unknown	unknown	gnl\|CDD\|377550
NZ_CP045533.1\|WP_000654997.1\|1253466_1254147_+\|streptomycin-biosynthesis-protein-StrF	unknown	unknown	gnl\|CDD\|379345

Protein	Function_ID	Function_description	E-value
NZ_CP045533.1\|WP_000932900.1\|1250829_1251930_+\|glycosyltransferase-family-2-protein	gnl\|CDD\|133005	cd02511, Beta4Glucosyltransferase, UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.	6.83297e-53
NZ_CP045533.1\|WP_001081482.1\|1240855_1241494_+\|GTP-pyrophosphokinase-family-protein	gnl\|CDD\|225232	COG2357, COG2357, PpGpp synthetase catalytic domain [General function prediction only].	1.66713e-95
NZ_CP045533.1\|WP_000427737.1\|1246971_1247907_-\|glycosyltransferase-family-2-protein	gnl\|CDD\|366154	pfam00535, Glycos_transf_2, Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.	1.2148e-22
NZ_CP045533.1\|WP_000673184.1\|1241512_1242310_+\|NAD-kinase	gnl\|CDD\|235317	PRK04885, ppnK, inorganic polyphosphate/ATP-NAD kinase; Provisional.	0
NZ_CP045533.1\|WP_000003390.1\|1235909_1237736_+\|oligoendopeptidase-F	gnl\|CDD\|341071	cd09608, M3B_PepF, Peptidase family M3B, oligopeptidase F (PepF). Peptidase family M3B oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the Bacillus amyloliquefaciens PepF oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over-expressed from a multicopy plasmid. This PepF family includes Streptococcus agalactiae PepB, a group B streptococcal oligopeptidase which has been shown to degrade a variety of bioactive peptides as well as the synthetic collagen-like substrate N-(3-[2-furyl]acryloyl)-Leu-Gly- Pro-Ala in vitro.	0
NZ_CP045533.1\|WP_000612264.1\|1234614_1235859_+\|competence-protein	gnl\|CDD\|226875	COG4469, CoiA, Competence protein CoiA-like family, contains a predicted nuclease domain [General function prediction only].	8.19935e-58
NZ_CP045533.1\|WP_000654997.1\|1253466_1254147_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	7.49705e-107
NZ_CP045533.1\|WP_000043379.1\|1239149_1239548_-\|hypothetical-protein	gnl\|CDD\|381281	cd14772, TrHb2_Bs-trHb-like_O, Truncated hemoglobins, group 2 (O); Bacillus subtilis TrHb like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). TrHb2's belonging to this group include monomeric Bacillus subtilis trHb (Bs-trHb), which exhibits an extremely high oxygen affinity, and a dimeric TrHb2 from the thermophilic aerobic spore forming bacterium Geobacillus stearothermophilus(Gs-trHb).	2.09549e-70
NZ_CP045533.1\|WP_001079095.1\|1242325_1243219_+\|RluA-family-pseudouridine-synthase	gnl\|CDD\|223638	COG0564, RluA, Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis].	6.99204e-99
NZ_CP045533.1\|WP_000799204.1\|1232989_1234534_+\|cardiolipin-synthase	gnl\|CDD\|234967	PRK01642, cls, cardiolipin synthetase; Reviewed.	0
NZ_CP045533.1\|WP_001087862.1\|1252081_1252771_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|372616	pfam13489, Methyltransf_23, Methyltransferase domain. This family appears to be a methyltransferase domain.	3.95233e-18
NZ_CP045533.1\|WP_000872720.1\|1244853_1245594_-\|bis(5'-nucleosyl)-tetraphosphatase-PrpE	gnl\|CDD\|184187	PRK13625, PRK13625, bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional.	0
NZ_CP045533.1\|WP_001272381.1\|1252767_1253454_+\|streptomycin-biosynthesis-protein-StrF	gnl\|CDD\|379345	pfam13712, Glyco_tranf_2_5, Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.	4.7405e-109
NZ_CP045533.1\|WP_001004740.1\|1247913_1248672_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	4.45158e-20
NZ_CP045533.1\|WP_000360652.1\|1238256_1239150_-\|DsbA-family-protein	gnl\|CDD\|372699	pfam13743, Thioredoxin_5, Thioredoxin.	2.84958e-93
NZ_CP045533.1\|WP_000428846.1\|1248808_1249654_-\|macrocin-O-methyltransferase	gnl\|CDD\|377550	pfam05711, TylF, Macrocin-O-methyltransferase (TylF). This family consists of bacterial macrocin O-methyltransferase (TylF) proteins. TylF is responsible for the methylation of macrocin to produce tylosin. Tylosin is a macrolide antibiotic used in veterinary medicine to treat infections caused by Gram-positive bacteria and as an animal growth promoter in the swine industry. It is produced by several Streptomyces species. As with other macrolides, the antibiotic activity of tylosin is due to the inhibition of protein biosynthesis by a mechanism that involves the binding of tylosin to the ribosome, preventing the formation of the mRNA-aminoacyl-tRNA-ribosome complex. The structure of one representative sequence from this family, NovP, shows it to be an S-adenosyl-l-methionine-dependent O-methyltransferase that catalyzes the penultimate step in the biosynthesis of the aminocoumarin antibiotic novobiocin. Specifically, it methylates at 4-OH of the noviose moiety, and the resultant methoxy group is important for the potency of the mature antibiotic. It is likely that the key structural features of NovP are common to the rest of the family and include: a helical 'lid' region that gates access to the co-substrate binding pocket and an active centre that contains a 3-Asp putative metal binding site. A further conserved Asp probably acts as the general base that initiates the reaction by de-protonating the 4-OH group of the noviose unit.	2.61854e-149
NZ_CP045533.1\|WP_000655329.1\|1245668_1246829_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	1.11727e-100
NZ_CP045533.1\|WP_000069694.1\|1249776_1250664_-\|hypothetical-protein	gnl\|CDD\|375999	pfam18573, BclA_C, BclA C-terminal domain. This is the C-terminal domain of BclA (Bacillus collagen-like protein of anthracis) which is expressed on spores of Bacillus species. Trimers of the C-terminal domain (CTD) form the tips of the spore's hair-like nap and are the immunodominant target of vertebrate antibodies and drive trimerization. Structure analysis indicate the C-terminal region of the peptide folding into an all-beta structure with a jelly-fold topology, similar to the first human complement C1q, a member of the tumor necrosis factor (TNF)-like family. The C-terminal globular domain has been shown to be located on the exterior of the exosporium, and therefore is critical in determining the immunogenicity of the spore in a mammalian host.	1.15219e-17
NZ_CP045533.1\|WP_000191110.1\|1239728_1240307_-\|CYTH-domain-containing-protein	gnl\|CDD\|143627	cd07762, CYTH-like_Pase_1, Uncharacterized subgroup 1 of the CYTH-like superfamily. Enzymes belonging to the CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) superfamily hydrolyze triphosphate-containing substrates, require metal cations as cofactors, and have a unique active site located at the center of an eight-stranded antiparallel beta barrel tunnel (the triphosphate tunnel). The name CYTH originated from the gene designation for bacterial class IV adenylyl cyclases (CyaB) and from thiamine triphosphatase. Class IV adenylate cyclases catalyze the conversion of ATP to 3',5'-cyclic AMP (cAMP) and PPi. Thiamine triphosphatase is a soluble cytosolic enzyme which converts thiamine triphosphate to thiamine diphosphate. This domain superfamily also contains RNA triphosphatases, membrane-associated polyphosphate polymerases, tripolyphosphatases, nucleoside triphosphatases, nucleoside tetraphosphatases and other proteins with unknown functions. Proteins of this subgroup are of bacterial origin and have not been characterized.	1.78128e-83

>NZ_CP045533.1|WP_001079095.1|1242325_1243219_+|RluA-family-pseudouridine-synthase
MNRFTLKWDIDSAEEGTLVREFLKTKGISKAALTDIKFHGGSIEVNGQHASVRHQLQAGEELRVFFPVEERSEGMIAEDIPLCIVYEDDAVLVINKEANMSTIPSREHPAGSVANALLSHYDKRHLTSTVHIVTRLDRDTSGLMLIAKNRFVHHLLSKQHQQKAVKRTYEAIVHGEMVEREGTIDAPIGRKSDSIIERTVCEEGQRAVTHFRVIDSVNHKTHVSLELDTGRTHQIRVHMAYIGHPLLGDNLYGGKRDEMKRQALHSTSLTFYHPILEKEMSFTTPIPSDMQAVLRHT
>NZ_CP045533.1|WP_000673184.1|1241512_1242310_+|NAD-kinase
MKFTIMSKGDQSSDALASTMKEYLLDFGFIMDEKEPDIVISVGGDGTLLYAFHRYYNRLDETAFVGVHTGHLGFYADWLPTEVEKLVIAIAKTPFQVVEYPLLEVIIRYVNGSKESQYLAMNEATVKSAEGTLVTEVEIRGEYFETFRGDGLCISTPSGSTAYNKALGGAIIHPSIEAIQIAEMASINNRVFRTVGSPLVLPKHHTCVLKPTAGMNLQITVDHLTMVHQDVKSIQYRVANEKVRFVRFRPFPFWKRVRDSFVADK
>NZ_CP045533.1|WP_001081482.1|1240855_1241494_+|GTP-pyrophosphokinase-family-protein
MNRNWEEFLAPYHQAVAELKVKLKGMRTQFAMLTEHSPIEFVTGRVKSVASIIDKAEKRNVPLDRLREDMQDIAGLRMMCQFVDEIKPVVEYLRKRNDFEIVEERDYVTQKKDSGYRSYHVVISYPVQTIQGEQKVLVEIQIRTLAMNFWATIEHSLNYKYSGRFPEDIKIRLQRAAEAAFLLDEEMSSIRLEIQEAQKAFSRKQETKDSES
>NZ_CP045533.1|WP_001180003.1|1240453_1240825_+|hypothetical-protein
MQNKIQVKSVEKRENALIFCAENSEIEVKELSARNHVLVDSDNLSFLYILENESSFIYVSIPHTCWEAMHEAMNNDVVMFVRVNDIEMELEGLKEEVEYLVENIEGNANYGEELVTAVEKVFL
>NZ_CP045533.1|WP_000191110.1|1239728_1240307_-|CYTH-domain-containing-protein
MTQEIEIEFKNIVTEEEFNTLCKSFSIEGFTKQVNHYFETPSFSLKEAGSALRIRHKGETYTLTLKQPAEVGLLETHQVITADEARLMMETNTIIQGAVVDQLHTLQIPVSALTYMGSLTTERAETLFEGGTLVFDHSFYYNHDDYEIEFEVQDEEAGKAAFIHLLKQHDIPIRHTNNKVKRFFLAKQNKAR
>NZ_CP045533.1|WP_000043379.1|1239149_1239548_-|hypothetical-protein
MSKQPMTPFEAIGGEQCIAILVDTFYSYVSKHPDLSPIFPDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVDGHIREFVFERLALTAQHMVNTPDETGEI
>NZ_CP045533.1|WP_000360652.1|1238256_1239150_-|DsbA-family-protein
MDKQEAKHINMPSPSACEHKSVEAYLFIDPLCKDCWEIEPFIIKLWLEYGKYFSIRHIVTGKVDGTNASSHKWNKPANIRFVWEKTTSLQGFSCDGKVHMQEASSTPYLVSMAIKAAELQGRKAGSKFLRKLQEYIFLENVSNPDCELLLACAKDSNIDVEEFKKDLYSASAKKAFQCDLKFTNEMHITEIPSLVFFHANSDEEGIKIAGTYSYDVYVQLLKELVKCEIEPEPLPPLEVLLEATQFISSKEVAFIYDCSKQEIERELKKLQLKRKVQMIDVKCERYWKWIAKEKDLV
>NZ_CP045533.1|WP_000003390.1|1235909_1237736_+|oligoendopeptidase-F
MSEQNTAKTLPDRNEIEESSTWRLEDIFQTDAEWEQEFQAIKELLPKLTEFKGKLGDSANNLLEALQYEDEISMRLGKLYTYAHMRYDQDTTNSVYQALNDRATNLYSQVSSSTAYIVPEILSISEDTLQTFLKENRDLSVYEHALEEITRQRPHVLSEAEEALLAEASEVMSASSNTFGMLNNADLKFPSIKGEDGEEVEITHGRYIQFLESDDRRVREDAFKAVYETYGKYKNTFASTLSGAVKRNNFNARVRKYDSARQAALSNNNIPEAVYDQLVQSVNDNLHLLHRYIDIRKRALGLDELHMYDLYTPLVPEVKMNVKYEEAQDMLLKSLHVLGDEYVDILKEAYENRWVDVYENKGKRSGAYSSGAYGTNPYILMNWHDNVNNLFTLAHEFGHSVHSYYTRKTQPHVYGDYSIFVAEVASTCNEALLNDYLLKTTEDKKERLYLLNHYLEGFRGTVFRQTMFAEFEHIIHKKVQEGHAVTPDMLTEIYYDLNKKYFGDALVIDEEIGLEWSRIPHFYYNYYVYQYATGFSAATALSKQILEEGQPAVERYINEFLKAGSSDYPIEVLKKAGVDMASPEPVKEALQVFEEKLNELEALLFEEK
>NZ_CP045533.1|WP_000612264.1|1234614_1235859_+|competence-protein
MIPIFIAKRENGEKIHLLDHHDEELLHHMRKRESFFCIACGKEVLMRLGKQKRWHFAHKKVDSCLAFYEAESTYHMYGKELLYRWFKRQKVHVEIEHYLPEIQQRPDIFIERAGRKIAIEYQCANLSIEQLCKRTYSYWKAGIQVIWIIGGNQLKKHSAYWMKFSSIMAFSLQSYPQPLLIFFCSKQKSFMKCTFITSFSTSVAFSHIIYLPIETTTFEMLFSPVPFQREVLNREWKKRKDYFRQNALPILNYNDKSLLRLLYQCKCTPANFPSEIGVPLPSSFAFQTNSFIWQAFLYMKCIGELAVGDCISLKYVCSYIKKYTKRRMLPYFSQHIWKVAVTEYMTFLCYVGVLQRVGTYKYRKIRGISMLKTEEEVMKYDERSLAYALSLFEAKYNMREGKADIIKTDREGIT
>NZ_CP045533.1|WP_000799204.1|1232989_1234534_+|cardiolipin-synthase
MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVIFLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHEDYEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHMEYYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPVRFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQSLQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIASARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAGVKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKDDLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL
>NZ_CP045533.1|WP_000872720.1|1244853_1245594_-|bis(5'-nucleosyl)-tetraphosphatase-PrpE
MKYDIIGDIHGCLQEFQNLTEKLGYNWSSGLPVHPDQRKLAFVGDITDRGPHSLRMIEIVWELVIHKKVAYYAPGNHCNKLYRFFLGRNVTIAHGLETTVAEYEALPSHKQNMIKEKFITLYEQSPLYHVLDEKRLLVCHAGIRQDYIGRQDKKVQTFVLYGDITGEKHADGSPVRRDWAKEYKGTTWIVYGHTPVKEPRFVNHTVNIDTGAVFGGKLTGLRYPEMEIVSVPSSLPFVPEKFRPIS
>NZ_CP045533.1|WP_000655329.1|1245668_1246829_-|rod-shape-determining-protein-RodA
MKDSNSQYQIDYVLLFILFAIGIVSCFAIASAQASLPSFLQHVNFVLKQIQWYFIGFIAIGIIMIIDFDRYQKIAWYLYSFALVLLIGLEFQVPGAVTIKGATAWYRLPGIGNFQPSEIMKLFLIIVIGRIIANHNEKYFYRTIQDDFLLLGKICATSLPPLLLIAKEPDLGNTMVISAMLAAMILVSGIRWRFIFGLASGIFAAGVTLTYIFFTHTKFFKAHILQEYQLNRFYGWLAPYKYDAQGYQLRQAFLATGSGEMQGKGWENGQVYFPEPHTDFIFTNVAEQFGFLGASVIIALFFLLIFRMIHIAIESNDPFGSYICAGTIGMFTFQVFQNIGMTIGLLPITGITLPLMSYGGSSLLTYMIAIGFVLNVRSRTKIFMFN
>NZ_CP045533.1|WP_000427737.1|1246971_1247907_-|glycosyltransferase-family-2-protein
MENIKNVPLVSILIPTYNRPHYFKIALESALAQTYSNIEIIVGDDSTNNETEKLIYRDYLHKHKHITYIRNPSTLGQFHNALMLLEQSNGEYINFLMDDDIFYNNKIEKMMFYFQKDLDQNLALITSYRTWINDDGEIIEQHPSMNRLYDEDTLLNGKDLGNHMLILGQNIIGEPTTVLFRKRLLTEPFGTLNGRNYNCSVDMASWISLLSKGDAIYITEPLSSFRLHTGQQVHHKYLEGCEDFSHLVLHSKKYGFLQETDYYKTSLLKACEWYKNATTFYQLYPELIPTTDTHTRLSHCLNIVTKELHAI
>NZ_CP045533.1|WP_001004740.1|1247913_1248672_-|class-I-SAM-dependent-methyltransferase
MNENEKKITLIPPPELVQYVGGHFEEVGKEFMQYFIEIGNLKSNETVLDVGCGIGRMAVPLMNYFSDDGNYYGFDLFNKGITWCKNNISTRRNNFHFEHVDIYNQFYNPDGKEDASQYKFPYEDESFDFIFLTSVFTHLLPKELEHYVREIARVLKKDGRCFITFFLINPESSYYLNAGLSPLGFYHQIDNCYVLNKDIPNFAVAYLEEDIRTLLNKYGLEMQTPPHYGSWCGRTEHTSYQDIILTQKISER
>NZ_CP045533.1|WP_000428846.1|1248808_1249654_-|macrocin-O-methyltransferase
MENKSAVQLYLELLKKTILFEIWLEYEPYLPASLHISKELSYEPVTVPLPLFLKQYIENHNLKIVNPNVSNNERQGGKDWPRAAHSMVGRKRMNQLQEAMETVVKENIEGDFIETGVWRGGSCIFMNGFLQANNIKDRTVWVADSFEGLPAPNLEQYPKDYGDYLHTFDYLRVSLETVQENFRKYDLLNDQVKFLKGWFKDTLPSAPIEKIAIARLDGDMYESTMDSLVNLYDKVSIGGFIIIDDYGLITCAEAVTDFRSERNIKTPMTQIDDFGIFWRKE
>NZ_CP045533.1|WP_000069694.1|1249776_1250664_-|hypothetical-protein
MSNNNYSDGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTVPTGPTGPTGPTGPTGPTGPTVPTGPTGSTGPTGPTGSTGPTGPTGPTGDTGATGPTGPTGTTGPTGPTGDTGTTGPTGPTGDTGATGPTGPTGPTGPTGPTGPSGLGLPAGLYAFNSAGISLDLGLNAPVPFNTVGSQFGTAISQLDADTFVISETGFYKITVIVYTAALSVLGGLTIQVNGVSVPGTGATLISVGAPIVVQAITQITTTPSLVEVIVTGLGLSLALGTSASIIIEKIA
>NZ_CP045533.1|WP_000932900.1|1250829_1251930_+|glycosyltransferase-family-2-protein
MLNKQGITISLCMIVRDEEDTIGRCLDAVEKIVDEIIIVDTGSIDRTKEIVAQYTSNIYDFPWINDFAAARNFSFSKATQEYILWLDADDVLLEDAQEALKLLKRELDPKIDAVSMPYHLALDSSGKPLYCTKRNRLVKREKQFQWFGKVHEYLAISGETFSSNVAITHKKEKKVTNRNLKIFQNAVAAGEELSPRDLFYYANESMDNQKYDDAVMLYETFLNQDEGWYEEKIYACGKLGDCYAKLGSWEKAIESCVKSFRYDVPRGENCTRIGYIYMEQQKYNEAIFWFKLATEVPMATESPFHSPASYTWLPYLQMCICYSKLGDQDKAYYYNELAAAYVPNNAAIEYNRKYFRSVFDKQYKSL
>NZ_CP045533.1|WP_001087862.1|1252081_1252771_+|class-I-SAM-dependent-methyltransferase
MNSPKNSLYEEKSGHYYNAVNPNLLKHIKKEWKEVLDIGCSSGALGAAIKENGTRVSGIEAFPEAAEQAKEKLDHVVLGDIETMDMPYEEEQFDCVIFGDVLEHLFDPWAVIEKVKPYIKENGVILASIPNVAHISVLAPLLAGNWTYTEYGLLDKTHIRFFTFNEMLRMFLKAGYSISKVDRVYIDHKVYEPLIEELYGICKKYRLGSGFMAETVVFQYIIEAEKSQL
>NZ_CP045533.1|WP_001272381.1|1252767_1253454_+|streptomycin-biosynthesis-protein-StrF
MSAGEKTILFVTCINDRKMYAQCVRHILRLAVPPGYIVQFMPIRNAKSMTSGYNQAISHPAKYKVYIHQDVFIMNVAFLYGLLQLFNEHEHLGMIGMIGAQYVPPNGIWNEGKGVVGKVIGYMNDLFYMATQEQPYHESKTFMPVECIDGLLMATQYDIPWREDLFDGFDYYDVSQSFEFRKAGYTVGVPVQRDAWCIHYHIDVNMTNYDKYRKIFVENYMSDVNQDE
>NZ_CP045533.1|WP_000654997.1|1253466_1254147_+|streptomycin-biosynthesis-protein-StrF
MKDRTILVVVCVNNEELFEQCERQIRNLFVPPDYVVQIFPIRDAKSMASAYNRALSYPAKYKVYIHQDTYLINREMFYTLISLFKDNEKLGLIGVAGAQFLPSNGIWWEGKNLVGKVIEYRRRNYQLLNLDQGFYGSQSFMSVQAIDGLFMATQYDIPWREDLFQGFHFYDVSQSLEFQRAGYLIGIPNQSNLWCIHYNGDEFDADTYEKDRKVFVEQYKDILSPS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045533_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045533_2

1464787-1465713

Orphan

Consensus_repeat	Method
CNCCTNNAGGTCCTTGAG	CRT

17 spacers

The CRISPR arrays of NZ_CP045533_2

>merge|NZ_CP045533|2|1464787-1465713|CRT
CGCCTGCCGGTCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGCCCAGTAGCACCGGTAGCCCCTGCTGGTCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGCAGGCCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCACCAGTAGCGCCAGTAGCCCCTGCCGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCCCCCGCTGGCCCTTGAACGCCTTGAGGTCCTTGAGCACCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAGCACCTGCAGGCCCTTGAACGCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACGCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCTGGTCCTTGAACACCTTGAGCACCAGTAGCACCGGTAGCCCCTGCAGGTCCTTGAATACCTTGAGGCCCTTGAGGTCCAGTAGCGCCTTGAACACCTGCAGGTCCTTGAGCGCCTTGAGGTCCTTGAGGTCCAGTGGCACCTTGAGCGCCCGCTGGTCCTTGAGGCCCAGTAGCACCCGTAGCCCCCGCCGGTCCTTGAG

>NZ_CP045533|2|1|1464787-1465713|CRT
CGCCTGCCGGTCCTTGAG	CACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAACACCTTGAGGCCCAGTAGCACCGGTAGCCCCTGCTGGTCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGTTGCGCCTGCTGGTCCTTGAGGCCCAGTAGCCCCCGCTGGCCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGCAGGCCCTTGAGCACCAGTAGCGCCAGTAGCCCCTGCAGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCACCAGTAGCGCCAGTAGCCCCTGCCGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCCCCCGCTGGCCCTTGAA
CGCCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGCAGGCCCTTGAA
CACCTTGAGGTCCTTGAG	GCCCAGTAGCCCCCGCTGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCCCCTGTTG
CGCCTGCTGGTCCTTGAG	GCCCAGTAGCCCCCGCTGGCCCTTGAA
CACCTTGAGGTCCTTGAG	CACCAGTAGCGCCAGTAG
CACCTGCAGGCCCTTGAA	CGCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCAGGCCCTTGAA	CACCTTGAGGTCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCAGGCCCTTGAA	CGCCTTGAGCACCAGTAGCGCCAGTAG
CCCCTGCTGGTCCTTGAA	CACCTTGAGCACCAGTAGCACCGGTAG
CCCCTGCAGGTCCTTGAA	TACCTTGAGGCCCTTGAGGTCCAGTAGCGCCTTGAA
CACCTGCAGGTCCTTGAG	CGCCTTGAGGTCCTTGAGGTCCAGTGGCACCTTGAG
CGCCCGCTGGTCCTTGAG	GCCCAGTAGCACCCGTAG
CCCCCGCCGGTCCTTGAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045533.1\|WP_001094859.1\|1469162_1469357_-\|DUF3924-domain-containing-protein	unknown	unknown	gnl\|CDD\|289807
NZ_CP045533.1\|WP_000110707.1\|1472082_1472790_-\|purine-nucleoside-phosphorylase	unknown	unknown	gnl\|CDD\|180275
NZ_CP045533.1\|WP_000897343.1\|1467884_1468730_+\|DUF72-domain-containing-protein	unknown	unknown	gnl\|CDD\|224714
NZ_CP045533.1\|WP_000797491.1\|1470114_1471926_-\|HAMP-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|274368
NZ_CP045533.1\|WP_000806236.1\|1469476_1470007_-\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271192
NZ_CP045533.1\|WP_000231448.1\|1460654_1461275_-\|DUF47-domain-containing-protein	unknown	unknown	gnl\|CDD\|224310
NZ_CP045533.1\|WP_000882907.1\|1458204_1458432_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000232625.1\|1472966_1473755_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000769281.1\|1461587_1463630_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP045533.1\|WP_000455755.1\|1458726_1459527_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP045533.1\|WP_000583786.1\|1476531_1476921_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000735215.1\|1455599_1456118_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000067567.1\|1476942_1477434_+\|DUF3907-family-protein	unknown	unknown	gnl\|CDD\|379028
NZ_CP045533.1\|WP_000794508.1\|1454387_1455485_+\|site-2-protease-family-protein	unknown	unknown	gnl\|CDD\|100081
NZ_CP045533.1\|WP_000937008.1\|1466452_1467724_-\|PAS-domain-containing-sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|236901
NZ_CP045533.1\|WP_001265566.1\|1463725_1464154_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045533.1\|WP_000600590.1\|1457522_1458035_-\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP045533.1\|WP_000010861.1\|1473759_1476345_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	unknown	unknown	gnl\|CDD\|225451
NZ_CP045533.1\|WP_000947712.1\|1456281_1457490_+\|NO-inducible-flavohemoprotein	unknown	unknown	gnl\|CDD\|237337
NZ_CP045533.1\|WP_000380271.1\|1459644_1460643_-\|inorganic-phosphate-transporter	unknown	unknown	gnl\|CDD\|376541

Protein	Function_ID	Function_description	E-value
NZ_CP045533.1\|WP_001094859.1\|1469162_1469357_-\|DUF3924-domain-containing-protein	gnl\|CDD\|289807	pfam13062, DUF3924, Protein of unknown function (DUF3924). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 60 amino acids in length.	3.38461e-24
NZ_CP045533.1\|WP_000110707.1\|1472082_1472790_-\|purine-nucleoside-phosphorylase	gnl\|CDD\|180275	PRK05819, deoD, DeoD-type purine-nucleoside phosphorylase.	1.77954e-168
NZ_CP045533.1\|WP_000897343.1\|1467884_1468730_+\|DUF72-domain-containing-protein	gnl\|CDD\|224714	COG1801, COG1801, Uncharacterized conserved protein [Function unknown].	5.12551e-75
NZ_CP045533.1\|WP_000797491.1\|1470114_1471926_-\|HAMP-domain-containing-sensor-histidine-kinase	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.68677e-61
NZ_CP045533.1\|WP_000806236.1\|1469476_1470007_-\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271192	cd01192, INT_C_like_3, Uncharacterized site-specific tyrosine recombinase, C-terminal catalytic domain. Tyrosine recombinase (integrase) belongs to a DNA breaking-rejoining enzyme superfamily. The catalytic domain contains six conserved active site residues. The recombination reaction involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.9028e-41
NZ_CP045533.1\|WP_000231448.1\|1460654_1461275_-\|DUF47-domain-containing-protein	gnl\|CDD\|224310	COG1392, COG1392, Phosphate transport regulator (distant homolog of PhoU) [Inorganic ion transport and metabolism].	6.30259e-51
NZ_CP045533.1\|WP_000769281.1\|1461587_1463630_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP045533.1\|WP_000455755.1\|1458726_1459527_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	1.39624e-36
NZ_CP045533.1\|WP_000600590.1\|1457522_1458035_-\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	1.19355e-21
NZ_CP045533.1\|WP_000794508.1\|1454387_1455485_+\|site-2-protease-family-protein	gnl\|CDD\|100081	cd06160, S2P-M50_like_2, Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.	4.91946e-42
NZ_CP045533.1\|WP_000937008.1\|1466452_1467724_-\|PAS-domain-containing-sensor-histidine-kinase	gnl\|CDD\|236901	PRK11360, PRK11360, two-component system sensor histidine kinase AtoS.	1.11213e-65
NZ_CP045533.1\|WP_000067567.1\|1476942_1477434_+\|DUF3907-family-protein	gnl\|CDD\|379028	pfam13047, DUF3907, Protein of unknown function (DUF3907). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 160 amino acids in length. There is a conserved AYTG sequence motif.	5.90717e-78
NZ_CP045533.1\|WP_000010861.1\|1473759_1476345_-\|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF	gnl\|CDD\|225451	COG2898, COG2898, Uncharacterized conserved protein [Function unknown].	2.53664e-138
NZ_CP045533.1\|WP_000947712.1\|1456281_1457490_+\|NO-inducible-flavohemoprotein	gnl\|CDD\|237337	PRK13289, PRK13289, NO-inducible flavohemoprotein.	0
NZ_CP045533.1\|WP_000380271.1\|1459644_1460643_-\|inorganic-phosphate-transporter	gnl\|CDD\|376541	pfam01384, PHO4, Phosphate transporter family. This family includes PHO-4 from Neurospora crassa which is a is a Na(+)-phosphate symporter. This family also contains the leukaemia virus receptor.	1.59802e-105

>NZ_CP045533.1|WP_001265566.1|1463725_1464154_-|hypothetical-protein
MRVMSLIRIWFALMVCIILCVGFFLTLKYSTISKAERKTAPYKLLYTKQSNIPYSNSTNNEKRVIKGMLITKASSSEALLQIAETIKNQYTNKKIDEITLSIHNENNGNYEEELPYEPISKGRISVTYDSESYGSTNIILNE
>NZ_CP045533.1|WP_000769281.1|1461587_1463630_+|PBP1A-family-penicillin-binding-protein
MKLKNTHLKKMQEWFNKRKKLRNSLIVLGSLLATLFIAINIIISIQDISELKQAVPQPTLIYDANNEVATKLASSKTEGVKKKDIPDIMVQAIVAVEDKEFFNHHGIYYSGIISAVFKNITAGEVVAGGSTITQQLAKNVFLTQDRTYSRKIKEYFLTKKIERTYTKDEIIEMYMNQIYFGEGAWGIKRAAKSYFDKDVKDLTISEAATIAGLIKAPSAYSPYKNFNKSIERRNVVLSLMKEQGYISDEQYNKEKESGLVLKRGVDDKYKGKYSQYVDYIVREAMDKYELTQNEILAGGYRIYTELDPKKQQAVEDVVNNDSYFKDSGSDQLMQTGVVLMNPKTGGIPALVGGRGPYQFLQFNHATQLKRQPGSTLKPLAVYVPALEQGYEVYDILKDEPFNIKEYKPQNSDHTFHGDVTMYEAVAKSYNVSAVWLLEQIGLDKGLKSLERFGIPLVPEDRTYPIALGGMHVGTSPFVMAQAYSTFANDGVQVEAHAIREIQNAEGETLGKWYKKETRVTSEKVSQKMTYLLKGVVEKGTGEKAKVNNVDTAGKTGTTQIVNGPSTGAKDSWFVGYTPDLVGAIWVGYDKTDSDHYVPGGSQITTTMFRDIMKKANANPAQKAFQLSLISEADYKKQLTTIEEEKRRKEEEKRRKEEEQQRKQEQQEWLDKVKEWIPSFW
>NZ_CP045533.1|WP_000231448.1|1460654_1461275_-|DUF47-domain-containing-protein
MVFKSKKDKFSEMLMNVSENLKEGAQFFVEYKIKNASDLKEFSMRMKEYESKGDSFIHEIIMELNKAFITPIEREDILQLAMSMDDVLDGLDHSAGLFEMYSITEADEYMIKFVEAINQCAIEIANSVELMSNKKLVDIRTNAIKIKDYESQCDDIRRHAIKHLFSREKDPIKIIQYKEIYEELEEVADSCQSVANVLETIIMKNA
>NZ_CP045533.1|WP_000380271.1|1459644_1460643_-|inorganic-phosphate-transporter
MDTLLILTVLVVICALAFDFINGFHDTANAIATAVSTKALKPRHAIIMAAIMNFLGAMTFTGVAKTITKDIVDPFALQNGSLVILAALLAAIAWNLITWYYGIPSSSSHAIIGSIAGAAIAAAGFSSLNFKGFIKIIEALIISPIIAFVIGYIVYSIFKVVFKNFNLTKTNKNFRIFQIFTAALQAYTHGTNDAQKAMGIITMALMANSYHTSSDIPFWVQLSCAIAMGLGTSVGGWKIIKTVGGQIMKIRPVNGVAADLSSSLVIFGATFIHLPVSTTHVISSSILGVGASHRVKGVKWGTAKRMLITWVITLPISASLAALFYSLLHLIF
>NZ_CP045533.1|WP_000455755.1|1458726_1459527_-|sulfite-exporter-TauE/SafE-family-protein
MEYIMLLFIGLIAGTVGSLVGLGGGIIIVPLLIGLHSLSPQLAVGTSMVTVVFTGLSSTLTYMKHKRVDYKSGLILFIGSGPGGIIGSWANKFLKQDTFSLYFGIFLIFVSILLMLRDKLKPLSLSNMTVIKRSFTDNEGNTVHYQFPPLLAIFIAFIVGFISGLFGIGGGALLVPAMMLLFAFPAHIAVATSMFIVFLSAIVSSATHISLGNVSWIYALILIPGAWIGGKIGAYINTKLSGNAVINLLRITLIILGTRLIITSFL
>NZ_CP045533.1|WP_000882907.1|1458204_1458432_+|hypothetical-protein
MLDAIKMTDMRIPANAIIHVEEMKGGVVLSVEVDGQIIYTMAYDEETDSYAELYDRNDKRACQVHEDFMGWSLLH
>NZ_CP045533.1|WP_000600590.1|1457522_1458035_-|Crp/Fnr-family-transcriptional-regulator
MILHKGDVLFRQGEDGPLYFIKTGLLKVVRLEENGTPFLFNIIVPGETIPHHSLISPKEYHGTAIALMKTEVEPIMSNEWYDQLQADPASYANIAMQLQSKLRMMQQRIDQLTTVSPKERLHRLQEWFTLYLGDIPIYEILTQTEIGQLIGIRRETVNRLLREQIKNEVK
>NZ_CP045533.1|WP_000947712.1|1456281_1457490_+|NO-inducible-flavohemoprotein
MLSEKTIEIVKSTVPLLQEKGVEITTRFYEILFSEHPELLNIFNHTNQKKGRQQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLGIKAEHYPIVGTCLLRAIKEVAGAPDEVLNAWGEAYGVIADAFISIEAEMYEEAAHKEGGWKDFRNFVVVKKVKESDVITSFYLKPEDGGKVSSFIPGQYVTVQINIEGETYTHNRQYSLSDAPGKEYYRISVKKEKGVDTPDGKVSNYLHEHVKEGDMLPVSAPAGDFVLNMDSTLPVVLISGGVGITPMMSMLNTLIEQDSKRNVCFVHAAINSNTHAMKEHVEAVDNEYEQVKAYTCYSAPTEKDLEMKNFDKEGFVEREWLQTIIPTTEAEFYFCGPIPFMKHINAVLTDLGVKQEHIHYEFFGPAASLQ
>NZ_CP045533.1|WP_000735215.1|1455599_1456118_+|hypothetical-protein
MKKLLNVFVIIIVMIIASYSLMKVLLHYANKPAEISTTAEIEDVQEETKVLDFIRMTHESYNNFLNYGKAENYTEGDWNQFKQWFQQQESSLKNIHTDIKNEKIKRDVNRSYEIVKKGVELQNIEYVVYAHRVYHDLDIIVNKYRGETNIWGYTEVGDGKDIRVIEQAIQSK
>NZ_CP045533.1|WP_000794508.1|1454387_1455485_+|site-2-protease-family-protein
MKNNKKGLWGILVAIGLFLLSKLKWVFAIFKLAKFSTVFSMFLSLGAYAVIYGWKFGVALIYLLFIHEMGHLWAAKRKGIPTSPAIFIPFMGALIGMKEMPKNAKDEAYIAYMGPLFGLLSFLPAIPLYMITKEPFWALIILLGSMINFFNLIPVSPLDGGRIISVVSTKIWGAGLVLLLGYSIYFKSILGGFIVIIGCMELYRVIKRDEPIKELGYKIDGMKEYVARLEEELKETGAVHRNIYMMQHEINVLRQKEREKELKTGEFQKIEVLEYLLPKFEPLDYVPYEDEKETHTIHIREAFEMSERKLEEWDAEKRQQENYYKVDTKTKWTVFACYIGLMAILGYVAYEGYIVLQEHLPTRNV
>NZ_CP045533.1|WP_000937008.1|1466452_1467724_-|PAS-domain-containing-sensor-histidine-kinase
MLPKDDIVSHEKRIDELENKVRFYEELVNQLPHHFTYKNPQIGLQIKKTRSTHSIQNIQKENKEADFQLTCDSLFLFKQLETYFVHIFDAFSHHVTFVDNKGNITLCNQAAADDFGVVRNDIIGKPIQQLLKLPEEKIKALETLRTGTEIYNEEVLDKNYGILNNRIIRDYNGEIFRVISVFHYLNTERDAEKFSLAGRIAAGIAHEVRNPLTTVRGYLQFLQETVSPSNKELFKNLLIPELDRANSIITKFLSISKTREFTREPFPINTFLREYIQQLLASEVFLHNISINYNFSTELDDILVHIDRHELVQVFLNLFQNAVDAQGEKKLSIQITSYRLDNFVRITFTDNGTGIPSAIQEYIFDPFFSTKDSGTGLGLAVTKKIIQNHNGTLKMTSNEDGTTFTISIPILPKTALERLNQDK
>NZ_CP045533.1|WP_000897343.1|1467884_1468730_+|DUF72-domain-containing-protein
MLFIGVTGWGDHDSLYIDPYENRNKLRTYSEYFPIVEVDSSFYAMQPARNYTKWAMETPKDFSFIVKAYQGMTGHMKGEVPFSTFDEMFDVYKQSILPLIEAGKLKTILFQYPPWFDCKKKNVDFLRYTKEKMEGLPCAIEFRNQTWFYPEMRDKTLQFLEQEKWIHTICDEPQAGMGSVPLVLEVTNAEMVLIRFHGRNVHGWLDKGENWRAVRCLYRYNNKELEEWVERLEQLKKQTKDIYVLFNNNSGGDAADNAKQLMKMMNITYGEPKPEQLNLFE
>NZ_CP045533.1|WP_001094859.1|1469162_1469357_-|DUF3924-domain-containing-protein
MNTLTIELPKETAEKLDLLKQAYEKKTGASISESTLVQTLISKEFIQAITPFDLQQFITSKEQH
>NZ_CP045533.1|WP_000806236.1|1469476_1470007_-|tyrosine-type-recombinase/integrase
MKQAGQPIQNEKQLETIKNILLQSSKRDGLLFVLAVNSGLKVSEILQLKVSDVIDENENVRHSILFYNEKVKKHKWFAVNEDLQHAIEDYMKERKTWKRNEPLLKSQKGTKSITRQHAWYILNKAAKEVGLEGISSHTLRKTWGYCAYKSGVDIAFLQHFFDHSTPSKTLKYIGIA
>NZ_CP045533.1|WP_000797491.1|1470114_1471926_-|HAMP-domain-containing-sensor-histidine-kinase
MKNRSIVFKLFLLTSTLFTIIFLLFFLGQSLFLEKFYINKKVKTVQTAFEDFVDTYEKSGKSYEEIRKLKQEFHDKTNADMQFLSPEGIIKSDNNYYIDVINPKNSEAYSIPLNNLLTPEEYKKFENLGLKKDDMINVVGWVRGKIITPLELTTSYNRWQNERINSDFSSINGNPSKNRITSRYKPVTQIEFTGIVSKLQLPSKADVRLANDFETLQAVQYFADIIRNGTANSHQLSYFLLDSEENIKNSIFVKPIMENGKITEYAFAIASLQPVNEAMLVLKDYYVYALIIVFLVIILLSFYYSKIIVKPLIKMNRVTKKMANFDFSEKLPVTADDEIGGLSGSINTLSVNLKDRIDRLNVANTKLQQDIERERQLEKTRKEFISGVSHELKTPLSVIRSFAEGIKDGVSKDTTYYTDVILEETENMNRLIVEMLELAKLESGTYKLDMTTFSIGELIQQVYTKLLFSMEEKHLQVNIDVDPSIFVKANRSRIEQVVVNLLSNAIRYTPDGEKIQVSVIEMEDTVKVEIENTGNPIPEDSLEKIWDRFYRLDASRSRHTGGTGLGLSIVKNILDLHHAEYGVYNTTNSVVFYFNLQKVKEVK
>NZ_CP045533.1|WP_000110707.1|1472082_1472790_-|purine-nucleoside-phosphorylase
MSVHIEAKQGEIAESILLPGDPLRAKYIAETFLEDVTCYNNVRGMLGFTGTYKGKRVSVQGTGMGVPSISIYVNELIQSYGVKNLIRVGTCGAIQKDVKVRDVIIAMTACTDSNMNRLTFPGFDFAPAANFDLLKKAYDAGTEKGLHVRVGNVLTADVFYRESMDMVKKLGDYGVLAVEMETTALYTLAAKYGVNALSVLTVSDHIFTGEETTSEERQTTFNEMIEIALDAAIQQ
>NZ_CP045533.1|WP_000232625.1|1472966_1473755_+|hypothetical-protein
MVGDVLKNLVIGLVALLFVVVGGFYIKKYQETTETVGDVQEVKWDVSNGKGNEKADILFQLLNNKNSEVRGVNDQIRAVIVDGQLKHVQQMKPAFAGNGSYKVSSKIAKDEGYTIFLYEDKNKSVQSFAKKDFGKEIEEKNKKKVKFPIDSVLTKKIGEYEVSLLFGALHPNEPVTLTFQFQAKKGEKLKLHAERGEVEALYIVDETRENFLYAIPVDTEGQLQYRITFPVEGTYKIWGDFYINGKKYEKEFIVQVQKRKNS
>NZ_CP045533.1|WP_000010861.1|1473759_1476345_-|bifunctional-lysylphosphatidylglycerol-flippase/synthetase-MprF
MSFSWKRFLQIGKIIFPFVVLTIVFFQAKKELAGISFLEAINTIKNIPTGGVFLAITLGAFAVSTMFFYDYVMLRYLKADIPVQKIFRISWIANTLNGFIGFGGLVGAGVRTMLYRPYIKENGKLIKSIAWMTTAFINGLAILSFLGLIGILDTSFILHEKPWLWPVLIFFALFVPIYIGFSKLKNRKPKQTEGQDEREEEKNPTVLYSLVSLVEWVSAGIVMYVILILFGIDIEFQKFLGVYVIAALAGVVSLVPGGLGSFDLVFLTGLGQYGIDTGVLLPAMLLYRLVYYILPFCLGLIFAAFEMTGVAIKKFEDKPFIAPALETTGVIWTLQRDFLGKLGSWASAALTVFAGLMVILSTILPTSINRAHALHILAPKHLIQFSFSLSLTFGILLLILSRGIYYGTKRSYYMTIISLIGAAIFNTLKGIDIEETFILLIVLAVLYMLRKRFVREKMEVSLSDIVKVFIFLLITLYLYKNLGILFAGAKEAFKPDFVVRNITQVKRSALAAAFFVPTFLLIGSLIANRYRNEFPGQPANDKRLQNFLDEHGGNVLSHLGFLGDKQFFFSSDGKALLLFSITGKRLVVLGDPIGDPSSYRTVLQEFLAEADRFGYICVFYQIESKWMSLYHDFGYNFFKLGEEAVVDLNTFTITGKKRAGMRATFNRFEREGYTFSIHQPPFSDELFEELKKVSDAWLGGKKEKSFSLGYFDREYISRAPIATLSDTDGKIIAFTTFMPVYQDGSLSVDLMRYYPDAPSGIMDAIFIHLFQWAKENEYHSFNIGMAPLSNVGLSTQSFWSERVAAAIFNNVRYTYSFSGLRHFKEKYKPTWSGKYLAFRKNHSLPITMLSVTKLIGKRKNS
>NZ_CP045533.1|WP_000583786.1|1476531_1476921_+|hypothetical-protein
MIIIGYAGYELEKAKPNTSEDFFNRSEVTYILNDKERTFSVLYVRYFEEVVQEITPFEGNPVCKVENQDIYLRDIVAICCLLKENELRMQKRLYLNNIEEFQQYFDEEIVVKVQEILAELHKNKRVEIE
>NZ_CP045533.1|WP_000067567.1|1476942_1477434_+|DUF3907-family-protein
MSNLMVENQTEQVSMFLEDVIHLITNYVNYHTLPSLLEETPAGNEQYYKGLLASIRRLLVFCEEGHDACFVLLNSQPFRKTAAEKILYKIYHQVIAEFFSPKSDHWYENSRSAYTGKNSIVFQQTPPASVEEVMKSLEGKFQLMREELEYYETDYQTKMLHKY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP045533_1	1.3\|1244108\|17\|NZ_CP045533\|CRISPRCasFinder	1244108-1244124	17	NZ_CP045533.1	2053693-2053709	1	0.941
NZ_CP045533_2	2.8\|1465264\|18\|NZ_CP045533\|CRT	1465264-1465281	18	NZ_CP045533.1	1464769-1464786	1	0.944

1. spacer 1.3|1244108|17|NZ_CP045533|CRISPRCasFinder matches to position: 2053693-2053709, mismatch: 1, identity: 0.941

aaagaaccttttgcatg	CRISPR spacer
aaaggaccttttgcatg	Protospacer
****.************

2. spacer 2.8|1465264|18|NZ_CP045533|CRT matches to position: 1464769-1464786, mismatch: 1, identity: 0.944

caccagtagcccctgttg	CRISPR spacer
caccagtagcacctgttg	Protospacer
********** *******

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	180959-180985	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181055-181081	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182060-182086	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182156-182182	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15069-15095	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	180959-180985	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181055-181081	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15072-15098	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15069-15095	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182060-182086	3	0.889
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182156-182182	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN163280	Klebsiella phage KpGranit, complete genome	86314-86340	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	81553-81579	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	86058-86084	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	3	0.889
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	3	0.889
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NZ_CP046295	Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence	154919-154945	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	14775-14801	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	16623-16649	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14778-14804	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14775-14801	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MK521907	Klebsiella phage vB_KpnS_FZ41, complete genome	71429-71455	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN163280	Klebsiella phage KpGranit, complete genome	86377-86403	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN497953	Mycobacterium phage GtownJaz, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH020238	Mycobacterium phage Lilith, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH077583	Mycobacterium phage PGHhamlin, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH727554	Mycobacterium phage MuchMore, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH338240	Mycobacterium phage Sabia, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KM233455	Mycobacterium phage Farber, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX664448	Mycobacterium phage Watson, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX507362	Mycobacterium phage Aglet, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH576949	Mycobacterium phage BreSam8, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN585969	Mycobacterium phage Dieselweasel, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH536813	Mycobacterium phage AugsMagnumOpus, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MF185733	Mycobacterium phage StepMih, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MF185732	Mycobacterium phage Stagni, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MK494096	Mycobacterium phage Mainiac, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU984914	Mycobacterium phage Malinsilva, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	JF704101	Mycobacterium virus Microwolf, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KT359365	Mycobacterium phage DaHudson, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MH651179	Mycobacterium phage MadMarie, complete genome	2466-2492	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN101228	Klebsiella phage KPN4, complete genome	25994-26020	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_028798	Mycobacterium phage MarQuardt, complete genome	2465-2491	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	17105-17131	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013564	Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, * SEQUENCING IN PROGRESS *, 4 ordered pieces	9397-9423	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	9227-9253	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013943	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, * SEQUENCING IN PROGRESS *	9999-10025	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	13197-13223	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	14705-14731	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	4696-4722	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	13200-13226	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	13197-13223	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MK448703	Streptococcus phage Javan207, complete genome	37479-37505	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_041891	Propionibacterium phage B22, complete genome	36818-36844	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_041894	Propionibacterium phage E6, complete genome	37666-37692	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX620754	Propionibacterium phage G4, complete genome	38154-38180	4	0.852
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX160207	Lactococcus phage 53801, complete genome	33293-33319	4	0.852
NZ_CP045533_2	2.6\|1465174\|27\|NZ_CP045533\|CRT	1465174-1465200	27	NC_019387	Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence	211293-211319	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18170-18196	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15770-15796	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	383807-383833	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8162-8188	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3631-3657	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21755-21781	5	0.815
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KX534340	Phage Wrath, partial genome	4431-4457	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KY984068	Erwinia phage vB_EamM_Y3, complete genome	74475-74501	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP014476	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, * SEQUENCING IN PROGRESS *, 2 ordered pieces	18170-18196	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013942	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, * SEQUENCING IN PROGRESS *	15770-15796	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	14826-14852	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	14823-14849	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NZ_CP032678	Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence	383807-383833	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013944	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, * SEQUENCING IN PROGRESS *	8162-8188	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	AP013945	Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, * SEQUENCING IN PROGRESS *	3631-3657	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MH884513	Bacillus phage vB_BpsS-36, complete genome	21755-21781	5	0.815
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KX534340	Phage Wrath, partial genome	4431-4457	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN101228	Klebsiella phage KPN4, complete genome	25940-25966	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	16167-16193	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	14254-14280	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	15099-15125	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MT586120	Synechococcus phage S-CAM7 isolate 0809CC03, complete genome	181142-181168	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP014301	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, * SEQUENCING IN PROGRESS *	708-734	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	15102-15128	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_031927	Synechococcus phage S-CAM7 isolate 0910CC49, complete genome	179824-179850	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	15099-15125	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU686213	Synechococcus phage S-CAM7 isolate 0910SB42, complete genome	182243-182269	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NZ_CP018231	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3	328506-328532	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NZ_CP016292	Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence	68233-68259	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MN434096	Klebsiella phage JIPh_Kp127, complete genome	86987-87013	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	AP013524	Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15	37226-37252	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	MG592476	Vibrio phage 1.104.O._10N.286.49.A12, partial genome	43336-43362	5	0.815
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	KU886222	Erwinia phage vB_EamM_Special G, complete genome	255604-255630	5	0.815
NZ_CP045533_2	2.6\|1465174\|27\|NZ_CP045533\|CRT	1465174-1465200	27	MF140397	Arthrobacter phage Abidatro, complete genome	33492-33518	6	0.778
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	6	0.778
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	6	0.778
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	MK496823	Capybara microvirus Cap3_SP_645, complete genome	1028-1054	6	0.778
NZ_CP045533_2	2.11\|1465381\|27\|NZ_CP045533\|CRT	1465381-1465407	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	6	0.778
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MT380195	Klebsiella phage KP_LZD_B01, complete genome	78592-78618	6	0.778
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	KX845404	Klebsiella phage vB_Kpn_IME260, complete genome	83097-83123	6	0.778
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	MK496823	Capybara microvirus Cap3_SP_645, complete genome	1028-1054	6	0.778
NZ_CP045533_2	2.13\|1465480\|27\|NZ_CP045533\|CRT	1465480-1465506	27	NC_028998	Phormidium phage MIS-PhV1B, complete genome	7240-7266	6	0.778
NZ_CP045533_2	2.14\|1465525\|27\|NZ_CP045533\|CRT	1465525-1465551	27	NZ_CP010864	Marinovum algicola DG 898 plasmid pMaD9, complete sequence	48125-48151	6	0.778
NZ_CP045533_2	2.16\|1465624\|36\|NZ_CP045533\|CRT	1465624-1465659	36	NZ_CP032531	Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence	110535-110570	6	0.833
NZ_CP045533_2	2.16\|1465624\|36\|NZ_CP045533\|CRT	1465624-1465659	36	MN693189	Marine virus AFVG_25M326, complete genome	18914-18949	6	0.833
NZ_CP045533_2	2.12\|1465426\|36\|NZ_CP045533\|CRT	1465426-1465461	36	AP014498	Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, * SEQUENCING IN PROGRESS *, 4 ordered pieces	16074-16109	8	0.778
NZ_CP045533_2	2.15\|1465570\|36\|NZ_CP045533\|CRT	1465570-1465605	36	MN693189	Marine virus AFVG_25M326, complete genome	18914-18949	8	0.778
NZ_CP045533_2	2.16\|1465624\|36\|NZ_CP045533\|CRT	1465624-1465659	36	NZ_CP032531	Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence	110661-110696	8	0.778

1. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 ******** *********.*******

2. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

3. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

4. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

5. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

6. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

7. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

8. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

9. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 ******** *********.*******

10. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

11. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

12. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

13. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

14. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgaggacctgtagcgccagtag	Protospacer
*.******* *** *************

15. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

16. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttggtcaccagtagcgccagtag	Protospacer
*.*****. ******************

17. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

18. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

19. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtat	Protospacer
 *************** *********

20. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 ******** ************.****

21. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

22. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

23. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

24. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 3, identity: 0.889

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
**********.***********.**.*

25. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
.. *********************.**

26. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

27. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

28. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

29. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

30. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

31. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

32. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

33. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

34. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

35. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 *************** **.******

36. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

37. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 .******* *********.*******

38. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NZ_CP046295 (Acinetobacter lwoffii strain FDAARGOS_552 plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
tagcttgagcaccagtagcgccagcag	Protospacer
.. *********************.**

39. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

40. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

41. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

42. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

43. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

44. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
caccttgagcgccagtagcaccagtgg	Protospacer
*.********.********.*****.*

45. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

46. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

47. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

48. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 *************** **.******

49. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  ********************.** *

50. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MK521907 (Klebsiella phage vB_KpnS_FZ41, complete genome) position: , mismatch: 4, identity: 0.852

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagcaccagtag	Protospacer
 .******* *********.*******

51. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN163280 (Klebsiella phage KpGranit, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagaaccagtagcaccagtag	Protospacer
 .******* ************.****

52. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN497953 (Mycobacterium phage GtownJaz, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

53. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH020238 (Mycobacterium phage Lilith, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

54. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH077583 (Mycobacterium phage PGHhamlin, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

55. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH727554 (Mycobacterium phage MuchMore, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

56. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH338240 (Mycobacterium phage Sabia, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

57. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KM233455 (Mycobacterium phage Farber, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

58. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX664448 (Mycobacterium phage Watson, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

59. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX507362 (Mycobacterium phage Aglet, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

60. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH576949 (Mycobacterium phage BreSam8, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

61. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN585969 (Mycobacterium phage Dieselweasel, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

62. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH536813 (Mycobacterium phage AugsMagnumOpus, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

63. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MF185733 (Mycobacterium phage StepMih, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

64. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MF185732 (Mycobacterium phage Stagni, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

65. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MK494096 (Mycobacterium phage Mainiac, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

66. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU984914 (Mycobacterium phage Malinsilva, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

67. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to JF704101 (Mycobacterium virus Microwolf, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

68. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KT359365 (Mycobacterium phage DaHudson, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

69. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MH651179 (Mycobacterium phage MadMarie, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

70. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagttgcaccggtgt	Protospacer
 *************** ********.

71. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_028798 (Mycobacterium phage MarQuardt, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagtggcaccggtat	Protospacer
 .**************.*********

72. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

73. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013564 (Uncultured Mediterranean phage uvMED isolate uvMED-CGR-C5-MedDCM-OCT-S33-C6, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

74. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

75. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013943 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S40-C165, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

76. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

77. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

78. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
gcccttgagcaccagtagcgccggttg	Protospacer
  *****************.***** *

79. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

80. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
.*******.*************.**.*

81. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccagtagcaccaccag	Protospacer
********* ************. .**

82. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
.*******.*************.**.*

83. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MK448703 (Streptococcus phage Javan207, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagtagcacctttat	Protospacer
.*********************  **

84. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_041891 (Propionibacterium phage B22, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

85. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_041894 (Propionibacterium phage E6, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

86. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX620754 (Propionibacterium phage G4, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccatgagcaccagtcgcaccggcac	Protospacer
**** *********** *******.*

87. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX160207 (Lactococcus phage 53801, complete genome) position: , mismatch: 4, identity: 0.852

caccttgagcaccagtagcaccggtag	CRISPR spacer
cacctttaggaccagtagcaccgttgg	Protospacer
****** ** ************* *.*

88. spacer 2.6|1465174|27|NZ_CP045533|CRT matches to NC_019387 (Thermus oshimai JL-2 plasmid pTHEOS01, complete sequence) position: , mismatch: 5, identity: 0.815

caccagtagcccctgcaggcccttgaa	CRISPR spacer
caccagaagccccttcaggccctcggt	Protospacer
****** ******* ********.*.

89. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
 **********************   .

90. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

91. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

92. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

93. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

94. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
cgccttgagcaccagtagccccaccca	Protospacer
******************* *** . .

95. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

96. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

97. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagctccagtat	Protospacer
 .******* ********* ******

98. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KX534340 (Phage Wrath, partial genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
agccttcagcaccagtatcgccagaac	Protospacer
 ***** ********** ****** *

99. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KY984068 (Erwinia phage vB_EamM_Y3, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
ggccttgagcaccagtagcgccacgca	Protospacer
 **********************   .

100. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP014476 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S42-C91, *** SEQUENCING IN PROGRESS ***, 2 ordered pieces) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

101. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013942 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S39-C99, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

102. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

103. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaacaccagtagcaccagtgg	Protospacer
..******.**********.*****.*

104. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NZ_CP032678 (Pseudomonas sp. Leaf58 plasmid pBASL58, complete sequence) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
cgccttgagcaccagtagccccaccca	Protospacer
******************* *** . .

105. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013944 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S41-C114, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

106. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to AP013945 (Uncultured Mediterranean phage uvMED isolate uvMED-CGF-C5C-MedDCM-OCT-S43-C137, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gtccttgaggaccagtagcgcctgttg	Protospacer
  ******* ************ ** *

107. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MH884513 (Bacillus phage vB_BpsS-36, complete genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
gaccttgaggaccagtagctccagtat	Protospacer
 .******* ********* ******

108. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KX534340 (Phage Wrath, partial genome) position: , mismatch: 5, identity: 0.815

cgccttgagcaccagtagcgccagtag	CRISPR spacer
agccttcagcaccagtatcgccagaac	Protospacer
 ***** ********** ****** *

109. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
.******** ************.**.

110. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
.******** ************.**.

111. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN101228 (Klebsiella phage KPN4, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccctgagcaccagtagcacccgtgc	Protospacer
 ***.***************** **.

112. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagtagcaccctgaa	Protospacer
.*********************   *.

113. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
aaccttgagcaccagtagaaccttgag	Protospacer
 ***************** ***   **

114. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

115. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MT586120 (Synechococcus phage S-CAM7 isolate 0809CC03, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

116. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP014301 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S28-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgagcaccagtagcaccttgtg	Protospacer
 *********************    *

117. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

118. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_031927 (Synechococcus phage S-CAM7 isolate 0910CC49, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

119. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
gaccttgaggaccagtagcaccaccag	Protospacer
 ******** ************. .**

120. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU686213 (Synechococcus phage S-CAM7 isolate 0910SB42, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgaggaccggtagcaccgatta	Protospacer
********* ***.*********.* .

121. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NZ_CP018231 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed3) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgatcaccagcagcaccggcct	Protospacer
******** ******.********.

122. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NZ_CP016292 (Rhizobium leguminosarum strain Vaf10 plasmid unnamed4, complete sequence) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
caccttgatcaccagcagcaccggcct	Protospacer
******** ******.********.

123. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MN434096 (Klebsiella phage JIPh_Kp127, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcaccagttgcaccagtat	Protospacer
 .************** *****.***

124. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
.*************** *****.** .

125. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to AP013524 (Uncultured Mediterranean phage uvMED DNA, complete genome, group G3, isolate: uvMED-CGR-C7-MedDCM-OCT-S39-C15) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
ggccttgagcgccagtagcacctgttg	Protospacer
 .********.*********** ** *

126. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to MG592476 (Vibrio phage 1.104.O._10N.286.49.A12, partial genome) position: , mismatch: 5, identity: 0.815

caccttga----gcaccagtagcaccggtag	CRISPR spacer
----tcgaagcggcaccagtagcaccggtag	Protospacer
    *.**    *******************

127. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to KU886222 (Erwinia phage vB_EamM_Special G, complete genome) position: , mismatch: 5, identity: 0.815

caccttgagcaccagtagcaccggtag	CRISPR spacer
cgccttttgcaccagtagcaccggtgt	Protospacer
*.****  *****************.

128. spacer 2.6|1465174|27|NZ_CP045533|CRT matches to MF140397 (Arthrobacter phage Abidatro, complete genome) position: , mismatch: 6, identity: 0.778

caccagtagcccctgcaggcccttgaa	CRISPR spacer
ggcccgttgcccctgcaggcccttgcg	Protospacer
 .** ** ***************** .

129. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

130. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

131. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to MK496823 (Capybara microvirus Cap3_SP_645, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagtacctccagttt	Protospacer
..*************** * *****

132. spacer 2.11|1465381|27|NZ_CP045533|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
..************** **.***** .

133. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MT380195 (Klebsiella phage KP_LZD_B01, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

134. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to KX845404 (Klebsiella phage vB_Kpn_IME260, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgaggaccagtagcaccagtgt	Protospacer
..******* *********.*****.

135. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to MK496823 (Capybara microvirus Cap3_SP_645, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagtacctccagttt	Protospacer
..*************** * *****

136. spacer 2.13|1465480|27|NZ_CP045533|CRT matches to NC_028998 (Phormidium phage MIS-PhV1B, complete genome) position: , mismatch: 6, identity: 0.778

cgccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagcaccagttgcaccagtta	Protospacer
..************** **.***** .

137. spacer 2.14|1465525|27|NZ_CP045533|CRT matches to NZ_CP010864 (Marinovum algicola DG 898 plasmid pMaD9, complete sequence) position: , mismatch: 6, identity: 0.778

caccttgagcaccagtagcaccggtag	CRISPR spacer
atccttgagcaccagcagcacccgtgc	Protospacer
  *************.****** **.

138. spacer 2.16|1465624|36|NZ_CP045533|CRT matches to NZ_CP032531 (Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence) position: , mismatch: 6, identity: 0.833

cgccttgagg-tccttgaggtccagtggcaccttgag	CRISPR spacer
-gtcctgtggctccttgaggtcctgtggctccttgag	Protospacer
 *.*.** ** ************ ***** *******

139. spacer 2.16|1465624|36|NZ_CP045533|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 6, identity: 0.833

cgccttgaggtccttgaggtccagtggcaccttgag	CRISPR spacer
ctcctgctggaccttgaggtccagtagcaccttgag	Protospacer
* ***   ** **************.**********

140. spacer 2.12|1465426|36|NZ_CP045533|CRT matches to AP014498 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-C73-MedDCM-OCT-S34-C64, *** SEQUENCING IN PROGRESS ***, 4 ordered pieces) position: , mismatch: 8, identity: 0.778

caccttgaggtccttgagcaccagtagcgccagtag	CRISPR spacer
taccttgagttccttgagtaccagtagaaccttgag	Protospacer
.******** ********.******** .**   **

141. spacer 2.15|1465570|36|NZ_CP045533|CRT matches to MN693189 (Marine virus AFVG_25M326, complete genome) position: , mismatch: 8, identity: 0.778

taccttgaggcccttgaggtccagtagcgccttgaa	CRISPR spacer
ctcctgctggaccttgaggtccagtagcaccttgag	Protospacer
. ***   ** *****************.******.

142. spacer 2.16|1465624|36|NZ_CP045533|CRT matches to NZ_CP032531 (Bacillus megaterium NCT-2 plasmid pNCT2_3, complete sequence) position: , mismatch: 8, identity: 0.778

cgccttgaggtccttgaggtccagtggcaccttgag	CRISPR spacer
gaagtggtggtccttgaggtcccgtggctccttgag	Protospacer
 .  * * ************** ***** *******

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

268123 : 276072

uncultured_virus(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|268123_268408_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001029999.1\|268446_270081_+	chaperonin GroEL	A0A219YK78	uncultured_virus	2.0e-157	58.2
WP_000743925.1\|270488_272027_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	6.8e-22	31.2
WP_000833093.1\|272411_273737_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	5.4e-44	29.5
WP_001262951.1\|273881_274583_+	response regulator transcription factor	W8CYM9	Bacillus_phage	7.3e-40	36.9
WP_000719191.1\|274566_276072_+	aminopeptidase AmpS	W8CYF6	Bacillus_phage	2.4e-32	31.3

DBSCAN-SWA_2

321491 : 329864

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625677.1\|321491_322799_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.5
WP_001170542.1\|322887_323607_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	5.2e-49	44.3
WP_000278826.1\|323599_323854_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_000666779.1\|323850_324534_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_000055586.1\|324517_326737_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.3e-162	41.2
WP_000879038.1\|326721_328137_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.3e-55	35.4
WP_001262449.1\|328239_329280_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	1.6e-67	45.9
WP_000088580.1\|329276_329864_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.5e-27	37.1

DBSCAN-SWA_3

1885474 : 1894804

Bacillus_phage(71.43%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000755553.1\|1885474_1886755_+	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	4.5e-11	31.5
WP_001194312.1\|1886852_1887617_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_000453859.1\|1887856_1889617_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.2e-270	96.7
WP_000937026.1\|1889705_1890383_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-119	94.7
WP_001254317.1\|1890379_1891453_+	sensor histidine kinase	W8CYF6	Bacillus_phage	1.3e-176	90.5
WP_000818985.1\|1892260_1892980_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_000061722.1\|1893127_1893799_+	O-methyltransferase	W8CYT3	Bacillus_phage	7.7e-63	89.8
WP_001258509.1\|1893931_1894804_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	6.5e-62	42.5

DBSCAN-SWA_4

2567257 : 2575600

Geobacillus_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_046952019.1\|2567257_2568625_-	chitin-binding protein	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.8e-19	38.6
WP_000124904.1\|2568982_2570176_-	glycosyl transferase family 1	Q0IKX4	Leucania_separata_nucleopolyhedrovirus	4.8e-07	26.8
WP_001058134.1\|2570261_2570942_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A075BUR2	Microcystis_phage	1.7e-30	38.2
WP_000720544.1\|2571088_2571592_-	DNA topology modulation protein	A0A097BYE2	Leuconostoc_phage	4.3e-42	45.5
WP_001093431.1\|2571613_2572000_-	DUF2809 domain-containing protein	NA	NA	NA	NA
WP_000655489.1\|2572065_2572773_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	2.0e-16	26.5
WP_000648514.1\|2572794_2573148_-	MmcQ/YjbR family DNA-binding protein	NA	NA	NA	NA
WP_000288952.1\|2573161_2573569_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000714650.1\|2573999_2575385_+	MBL fold metallo-hydrolase	Q0H255	Geobacillus_phage	2.7e-78	59.9
WP_000820162.1\|2575387_2575600_+	DUF3006 domain-containing protein	Q0H256	Geobacillus_phage	1.1e-12	54.4

DBSCAN-SWA_5

3604811 : 3680810

Bacillus_phage(70.37%)

tail,holin,protease,portal,terminase,tRNA,integrase,transposase,capsid,head

attL 3638447:3638461|attR 3680850:3680864

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000455936.1\|3604811_3607577_-\|tRNA	isoleucine--tRNA ligase	A0A2K9L9X8	Tupanvirus	7.0e-86	27.1
WP_001131612.1\|3607924_3608431_-	septum site-determining protein DivIVA	NA	NA	NA	NA
WP_000029725.1\|3608520_3609288_-	RNA-binding protein	NA	NA	NA	NA
WP_000450919.1\|3609303_3609567_-	YggT family protein	NA	NA	NA	NA
WP_000119138.1\|3609573_3610044_-	cell division protein SepF	NA	NA	NA	NA
WP_000218169.1\|3610063_3610738_-	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_001209000.1\|3610734_3611553_-	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_001993471.1\|3611671_3611956_-	YlmC/YmxH family sporulation protein	NA	NA	NA	NA
WP_000197753.1\|3612123_3612903_-	RNA polymerase sporulation sigma factor SigG	A0A0Y0AU18	Bacillus_phage	5.8e-46	43.5
WP_000976948.1\|3613060_3613780_-	RNA polymerase sporulation sigma factor SigE	A0A2H4JC68	uncultured_Caudovirales_phage	3.3e-19	42.9
WP_000261978.1\|3613799_3614717_-	sigma-E processing peptidase SpoIIGA	NA	NA	NA	NA
WP_000888991.1\|3616624_3617779_-	cell division protein FtsZ	NA	NA	NA	NA
WP_001087555.1\|3617818_3619126_-	cell division protein FtsA	NA	NA	NA	NA
WP_000798230.1\|3619526_3620297_-	cell division protein DivIB	NA	NA	NA	NA
WP_000437043.1\|3620395_3621301_-	UDP-N-acetylmuramate dehydrogenase	NA	NA	NA	NA
WP_001265415.1\|3621362_3622457_-	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_000753510.1\|3622561_3623653_-	stage V sporulation protein E	NA	NA	NA	NA
WP_000860123.1\|3623743_3625096_-	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_000893058.1\|3625096_3626071_-	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_000766298.1\|3626093_3627569_-	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_001266227.1\|3627777_3629694_-	stage V sporulation protein D	NA	NA	NA	NA
WP_000600097.1\|3629775_3631875_-	penicillin-binding protein	NA	NA	NA	NA
WP_000067081.1\|3631947_3632310_-	cell division protein FtsL	NA	NA	NA	NA
WP_000403053.1\|3633628_3635245_-	bacillithiol biosynthesis cysteine-adding enzyme BshC	NA	NA	NA	NA
WP_000782393.1\|3635324_3636215_-	2-dehydropantoate 2-reductase	NA	NA	NA	NA
WP_000506707.1\|3636508_3636982_+	N-acetyltransferase	NA	NA	NA	NA
WP_000246478.1\|3637016_3637523_-	RsfA family transcriptional regulator	G3MB11	Bacillus_virus	1.0e-11	35.5
WP_001984764.1\|3637652_3637826_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_000872145.1\|3637887_3638388_-	DUF177 domain-containing protein	NA	NA	NA	NA
3638447:3638461	attL	NA	NA	NA	NA
WP_000105686.1\|3638661_3639279_-	hypothetical protein	A0A288WFQ7	Bacillus_phage	4.7e-83	79.5
WP_048557647.1\|3639220_3640405_-	cell division protein FtsK	H0USY1	Bacillus_phage	1.4e-144	63.1
WP_048557646.1\|3640523_3640706_-	hypothetical protein	A0A288WGN6	Bacillus_phage	1.4e-19	80.0
WP_001267642.1\|3640702_3641005_-	hypothetical protein	H0USY0	Bacillus_phage	3.1e-24	54.6
WP_001237237.1\|3641189_3641411_+	helix-turn-helix transcriptional regulator	Q2I8E4	Bacillus_phage	1.0e-27	89.0
WP_048557645.1\|3641403_3641895_+	hypothetical protein	Q3HL01	Bacillus_phage	1.1e-71	89.0
WP_048557644.1\|3641932_3642718_-	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7T9	Bacillus_phage	6.1e-35	83.1
WP_000787573.1\|3642734_3642965_-\|holin	phage holin	A0A0S2MVE8	Bacillus_phage	1.4e-32	94.7
WP_001115042.1\|3643007_3643247_-	peptidase	A0A1B1P7E0	Bacillus_phage	7.4e-37	100.0
WP_000822837.1\|3643263_3644223_-\|integrase	tyrosine-type recombinase/integrase	D2XR30	Bacillus_phage	5.5e-171	93.1
WP_000626436.1\|3644459_3645653_-\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	4.3e-218	100.0
WP_155016821.1\|3645938_3649778_-	peptidase S74	Q2I8E8	Bacillus_phage	0.0e+00	82.7
WP_155016822.1\|3649774_3651265_-\|tail	phage tail family protein	A0A2H4JC38	uncultured_Caudovirales_phage	4.1e-274	91.7
WP_048557641.1\|3651279_3653898_-\|tail	phage tail tape measure protein	Q2I8F0	Bacillus_phage	9.0e-285	98.2
WP_155016823.1\|3654073_3655390_-\|tail	phage tail tape measure protein	A0A288WG36	Bacillus_phage	8.3e-162	95.8
WP_016718340.1\|3655611_3655929_-	hypothetical protein	A0A288WFU2	Bacillus_phage	7.5e-53	98.1
WP_048557639.1\|3655977_3656583_-\|tail	tail protein	W8CYT6	Bacillus_phage	1.2e-94	95.0
WP_048557638.1\|3656583_3656943_-	DUF3168 domain-containing protein	A0A2H4JAR3	uncultured_Caudovirales_phage	9.4e-60	96.6
WP_016718343.1\|3656939_3657374_-	HK97 gp10 family phage protein	H0USW9	Bacillus_phage	6.9e-73	93.1
WP_048557637.1\|3657366_3657690_-\|head	phage head closure protein	A0A2H4J374	uncultured_Caudovirales_phage	1.4e-54	96.3
WP_016718345.1\|3657686_3657965_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J6E5	uncultured_Caudovirales_phage	3.3e-44	100.0
WP_048557636.1\|3657985_3659158_-\|capsid	phage major capsid protein	A0A2H4J387	uncultured_Caudovirales_phage	5.1e-203	94.9
WP_048557635.1\|3659195_3659906_-\|protease	Clp protease ClpP	A0A2H4JC29	uncultured_Caudovirales_phage	1.0e-126	98.7
WP_154982026.1\|3659892_3661146_-\|portal	phage portal protein	A0A2H4J371	uncultured_Caudovirales_phage	2.7e-239	98.3
WP_048557633.1\|3661334_3663029_-\|terminase	terminase large subunit	A6M948	Geobacillus_virus	6.2e-210	64.6
WP_048557632.1\|3663025_3663526_-\|terminase	phage terminase small subunit P27 family	A0A0S2GLF2	Bacillus_phage	1.0e-64	74.1
WP_048557631.1\|3663664_3664042_-	HNH endonuclease	A0A2H4J3B4	uncultured_Caudovirales_phage	7.6e-68	97.6
WP_048557630.1\|3664031_3664286_-	hypothetical protein	A0A0S2GLL6	Bacillus_phage	1.7e-39	90.5
WP_048557629.1\|3664301_3664544_-	hypothetical protein	A0A288WG15	Bacillus_phage	3.9e-25	72.5
WP_155016824.1\|3664676_3664889_-	hypothetical protein	A0A1B1P8F3	Bacillus_phage	1.0e-29	98.6
WP_048557627.1\|3664875_3665139_-	hypothetical protein	A0A1B1P7X2	Bacillus_phage	7.2e-33	82.4
WP_048557626.1\|3665169_3665919_-	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	2.9e-79	58.9
WP_001012162.1\|3666503_3667046_-\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.9e-89	92.2
WP_000166202.1\|3667045_3667528_-	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	3.4e-73	83.1
WP_000645582.1\|3667842_3667965_-	DUF3983 domain-containing protein	NA	NA	NA	NA
WP_048557624.1\|3667982_3668312_-	hypothetical protein	NA	NA	NA	NA
WP_000389465.1\|3668720_3668996_-	hypothetical protein	A0A1B1P870	Bacillus_phage	1.2e-46	100.0
WP_000854065.1\|3669113_3669323_-	hypothetical protein	NA	NA	NA	NA
WP_155016825.1\|3670610_3671093_-	nucleotide pyrophosphohydrolase	A0A0U4IBD0	Bacillus_phage	1.5e-20	49.5
WP_016718367.1\|3671108_3671528_-	hypothetical protein	A0A1B1P8B9	Bacillus_phage	3.1e-14	41.9
WP_016718368.1\|3671540_3671795_-	hypothetical protein	A0A0U3SU43	Bacillus_phage	1.1e-38	92.9
WP_000805174.1\|3671809_3671983_-	DUF3954 domain-containing protein	A0A1B1P7U5	Bacillus_phage	1.2e-25	100.0
WP_154981999.1\|3672008_3672203_-	hypothetical protein	A0A1B1P7U7	Bacillus_phage	9.7e-27	89.1
WP_014297966.1\|3672217_3673021_-	ATP-binding protein	A0A1B1P7U2	Bacillus_phage	2.5e-145	98.9
WP_048557622.1\|3672989_3673862_-	DnaD domain protein	W8CYG5	Bacillus_phage	1.6e-57	45.5
WP_155016826.1\|3673858_3674044_-	hypothetical protein	A0A0U3SQC4	Bacillus_phage	5.4e-19	70.7
WP_000284331.1\|3674294_3674495_-	helix-turn-helix domain-containing protein	A0A0U4IIS1	Bacillus_phage	5.1e-07	48.0
WP_000935436.1\|3674604_3674799_-	helix-turn-helix transcriptional regulator	A0A0A7AQV9	Bacillus_phage	1.2e-05	45.2
WP_048548405.1\|3674967_3675324_+	helix-turn-helix transcriptional regulator	A0A0P0IZG9	Lactobacillus_phage	1.9e-12	39.6
WP_048548416.1\|3675320_3675503_-	hypothetical protein	NA	NA	NA	NA
WP_048548403.1\|3675644_3675779_-	hypothetical protein	NA	NA	NA	NA
WP_048548402.1\|3675780_3676926_-	hypothetical protein	H0UST6	Bacillus_phage	1.1e-58	33.2
WP_044821771.1\|3677362_3677707_+	helix-turn-helix transcriptional regulator	A8ASM2	Listeria_phage	1.3e-05	28.9
WP_048548400.1\|3677796_3677976_-	hypothetical protein	NA	NA	NA	NA
WP_000511407.1\|3678252_3678558_-	STAS-like domain-containing protein	J7KJ12	Streptococcus_phage	4.8e-12	45.2
WP_048548396.1\|3678548_3679451_-	sensor histidine kinase	NA	NA	NA	NA
WP_154982028.1\|3679679_3680810_+\|integrase	tyrosine-type recombinase/integrase	A0A0U4JNS1	Bacillus_phage	9.0e-64	38.6
3680850:3680864	attR	NA	NA	NA	NA

DBSCAN-SWA_6

4798949 : 4806918

Streptococcus_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001049162.1\|4798949_4799531_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	1.3e-55	56.5
WP_085962608.1\|4799871_4801028_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	3.4e-34	44.7
WP_000250307.1\|4801131_4801380_-	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_000006561.1\|4801403_4802354_-	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	6.6e-52	38.1
WP_000712175.1\|4802443_4803397_-	YvcK family protein	A1IMD5	Streptococcus_phage	1.3e-63	43.5
WP_000138457.1\|4803400_4804282_-	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	4.6e-07	28.9
WP_001190080.1\|4804302_4804761_-	8-oxo-dGTP diphosphatase	NA	NA	NA	NA
WP_000455203.1\|4804989_4805796_-	DUF368 domain-containing protein	NA	NA	NA	NA
WP_001288072.1\|4805961_4806918_-	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	1.4e-89	53.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045534

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 10697

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000827039.1\|980_1445_-	hypothetical protein	NA	NA	NA	NA
WP_000404315.1\|1603_2506_-	EamA family transporter	NA	NA	NA	NA
WP_000179385.1\|2608_3499_-	hypothetical protein	NA	NA	NA	NA
WP_076856000.1\|4271_4592_-	hypothetical protein	NA	NA	NA	NA
WP_076856010.1\|4866_6639_-	phosphoadenosine phosphosulfate reductase family protein	NA	NA	NA	NA
WP_076855999.1\|6763_7177_-	HEPN domain-containing protein	NA	NA	NA	NA
WP_000282368.1\|7163_7550_-	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_001267129.1\|7571_7943_-	hypothetical protein	NA	NA	NA	NA
WP_001040239.1\|8756_10697_-	maturase	A0A0U4J920	Pseudomonas_phage	1.0e-27	29.3

DBSCAN-SWA_2

18177 : 23322

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_076856009.1\|18177_20076_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	4.3e-26	28.7
WP_000181841.1\|20837_21194_-	hypothetical protein	Q0ILF6	Lactococcus_phage	3.8e-21	43.9
WP_001055070.1\|21216_21612_-	hypothetical protein	NA	NA	NA	NA
WP_002081521.1\|22011_22194_-	hypothetical protein	NA	NA	NA	NA
WP_076855993.1\|22261_22546_-	hypothetical protein	NA	NA	NA	NA
WP_076855992.1\|22806_23031_-	hypothetical protein	NA	NA	NA	NA
WP_000675279.1\|23049_23322_-	hypothetical protein	D2XR50	Bacillus_phage	9.8e-09	39.1

DBSCAN-SWA_3

37625 : 38738

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042512128.1\|37625_38738_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A286QQB7	Streptococcus_phage	2.0e-79	45.0

DBSCAN-SWA_4

50429 : 51790

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123805311.1\|50429_51790_-\|transposase	IS3-like element ISBce15 family transposase	A0A1B1P773	Bacillus_phage	2.5e-89	60.4

DBSCAN-SWA_5

67013 : 71883

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155016832.1\|67013_68744_+	hypothetical protein	Q08J70	Stx2-converting_phage	1.1e-23	39.5
WP_076856199.1\|68733_69264_+	hypothetical protein	NA	NA	NA	NA
WP_000830948.1\|69999_71883_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.3e-30	26.6

DBSCAN-SWA_6

85257 : 89047

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001043958.1\|85257_85530_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.4e-23	67.8
WP_000162599.1\|85641_85911_-	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_155016834.1\|86099_86402_+	hypothetical protein	NA	NA	NA	NA
WP_001058761.1\|86432_86642_+	hypothetical protein	NA	NA	NA	NA
WP_001193818.1\|86756_87167_+	hypothetical protein	NA	NA	NA	NA
WP_000894492.1\|87830_88271_+	hypothetical protein	NA	NA	NA	NA
WP_000021286.1\|88295_88523_+	hypothetical protein	A0A217ERD4	Bacillus_phage	3.4e-07	55.4
WP_001123650.1\|88550_88754_+	hypothetical protein	NA	NA	NA	NA
WP_000843050.1\|88768_89047_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	A0A2I7SC16	Paenibacillus_phage	2.7e-14	47.8

DBSCAN-SWA_7

94721 : 100604

Bacillus_phage(66.67%)

integrase

attL 91125:91139|attR 100691:100705

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
91125:91139	attL	NA	NA	NA	NA
WP_001021536.1\|94721_95765_-\|integrase	tyrosine-type recombinase/integrase	A0A0E3T6D9	Bacillus_phage	2.0e-09	22.9
WP_000202840.1\|95998_96349_+	zinc-finger domain-containing protein	NA	NA	NA	NA
WP_000386112.1\|96370_96883_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_000751950.1\|98055_98658_-	hypothetical protein	A0A1B0T6B1	Bacillus_phage	1.5e-12	41.3
WP_000491739.1\|98758_99001_+	hypothetical protein	NA	NA	NA	NA
WP_000107160.1\|99371_100604_+	WXG100 family type VII secretion target	A0A2H4J389	uncultured_Caudovirales_phage	3.0e-65	58.0
100691:100705	attR	NA	NA	NA	NA

DBSCAN-SWA_8

115975 : 119640

Clostridium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000668449.1\|115975_116536_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.3e-31	42.1
WP_000095762.1\|116679_119640_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.2e-211	40.0

DBSCAN-SWA_9

130163 : 132371

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155016836.1\|130163_131411_-	hypothetical protein	D0R0F9	Streptococcus_phage	1.5e-11	31.4
WP_113712782.1\|131465_132371_-\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.0e-38	37.5

DBSCAN-SWA_10

135695 : 136331

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000681161.1\|135695_136331_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	3.4e-12	32.7

DBSCAN-SWA_11

145272 : 145842

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001084317.1\|145272_145842_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	4.6e-24	40.3

DBSCAN-SWA_12

151346 : 156286

Paenibacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001069631.1\|151346_151760_-	NUDIX domain-containing protein	D0R7I2	Paenibacillus_phage	8.7e-09	34.4
WP_062821621.1\|151770_153255_-	hypothetical protein	A0A2H4UU67	Bodo_saltans_virus	8.0e-12	25.4
WP_000688769.1\|153817_155467_-	S8 family serine peptidase	Q2A0D0	Sodalis_phage	1.8e-20	24.6
WP_000237083.1\|155818_156286_+	RsfA family transcriptional regulator	A0A1D6X8E5	Bacillus_phage	5.1e-05	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045533

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045534

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection