CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045649	Nocardioides sp. dk884 chromosome, complete genome	2 crisprs	cas3,DEDDh,csa3,WYL,cas4,DinG	0	1	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045649_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045649_1

1211844-1211965

Orphan

Consensus_repeat	Method
TCTCGACAAGCTCGACCAACGGG	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP045649_1

>merge|NZ_CP045649|1|1211844-1211965|CRISPRCasFinder
TCTCGACGGGCTCGACCGGCGGAGGGGCGTCGTACCCCTGCCGCTGGTCTCGACAAGCTCGACCAACGGGACAGCGCTCGACCGACGGGGTGGCCGTGATCTCGACAAGCTCGACCGACGGG

>NZ_CP045649|1|1|1211844-1211965|CRISPRCasFinder
TCTCGACGGGCTCGACCGGCGGA	GGGGCGTCGTACCCCTGCCGCTGG
TCTCGACAAGCTCGACCAACGGG	ACAGCGCTCGACCGACGGGGTGGCCGTGA
TCTCGACAAGCTCGACCGACGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045649.1\|WP_153325653.1\|1212130_1213474_-\|M24-family-metallopeptidase	unknown	unknown	gnl\|CDD\|238520
NZ_CP045649.1\|WP_153322482.1\|1204787_1206335_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173853
NZ_CP045649.1\|WP_153325655.1\|1222752_1223607_+\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP045649.1\|WP_153322484.1\|1208367_1209594_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP045649.1\|WP_153322490.1\|1218428_1218884_+\|single-stranded-DNA-binding-protein	unknown	unknown	gnl\|CDD\|236092
NZ_CP045649.1\|WP_153322491.1\|1219009_1220692_+\|energy-dependent-translational-throttle-protein-EttA	unknown	unknown	gnl\|CDD\|236992
NZ_CP045649.1\|WP_153322492.1\|1221357_1222572_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181146
NZ_CP045649.1\|WP_153322481.1\|1203810_1204791_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223674
NZ_CP045649.1\|WP_153322489.1\|1216591_1218259_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|206743
NZ_CP045649.1\|WP_153322480.1\|1202974_1203814_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224094
NZ_CP045649.1\|WP_153322488.1\|1214801_1216484_+\|ABC-transporter	unknown	unknown	gnl\|CDD\|366045
NZ_CP045649.1\|WP_153322493.1\|1223640_1224024_-\|globin	unknown	unknown	gnl\|CDD\|381280
NZ_CP045649.1\|WP_153322479.1\|1200948_1202115_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226967
NZ_CP045649.1\|WP_153322486.1\|1210306_1211617_-\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|367155
NZ_CP045649.1\|WP_153322483.1\|1206502_1208371_+\|glycoside-hydrolase-family-2	unknown	unknown	gnl\|CDD\|236657
NZ_CP045649.1\|WP_153325654.1\|1220789_1221263_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP045649.1\|WP_153322477.1\|1199276_1199948_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|224647
NZ_CP045649.1\|WP_153322487.1\|1213626_1214748_+\|PrsW-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|379143
NZ_CP045649.1\|WP_153322478.1\|1200116_1200941_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225136
NZ_CP045649.1\|WP_153322485.1\|1209762_1210116_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|380097

Protein	Function_ID	Function_description	E-value
NZ_CP045649.1\|WP_153325653.1\|1212130_1213474_-\|M24-family-metallopeptidase	gnl\|CDD\|238520	cd01087, Prolidase, Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on Pro-Pro.	2.22353e-95
NZ_CP045649.1\|WP_153322482.1\|1204787_1206335_-\|hypothetical-protein	gnl\|CDD\|173853	cd00995, PBP2_NikA_DppA_OppA_like, The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Similar to the ABC-type dipeptide and oligopeptide import systems, nickel transporter is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, which is the initial nickel receptor that controls the chemotactic response away from nickel. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand binding domains of ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	4.38911e-108
NZ_CP045649.1\|WP_153325655.1\|1222752_1223607_+\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	4.87533e-28
NZ_CP045649.1\|WP_153322484.1\|1208367_1209594_-\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.14124e-50
NZ_CP045649.1\|WP_153322490.1\|1218428_1218884_+\|single-stranded-DNA-binding-protein	gnl\|CDD\|236092	PRK07772, PRK07772, single-stranded DNA-binding protein; Provisional.	7.70471e-27
NZ_CP045649.1\|WP_153322491.1\|1219009_1220692_+\|energy-dependent-translational-throttle-protein-EttA	gnl\|CDD\|236992	PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed.	0
NZ_CP045649.1\|WP_153322492.1\|1221357_1222572_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181146	PRK07851, PRK07851, acetyl-CoA C-acetyltransferase.	0
NZ_CP045649.1\|WP_153322481.1\|1203810_1204791_-\|ABC-transporter-permease-subunit	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.14861e-96
NZ_CP045649.1\|WP_153322489.1\|1216591_1218259_+\|ABC-transporter	gnl\|CDD\|206743	cd11383, YfjP, YfjP GTPase. The Era (E. coli Ras-like protein)-like YfjP subfamily includes several uncharacterized bacterial GTPases that are similar to Era. They generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.	3.26447e-33
NZ_CP045649.1\|WP_153322480.1\|1202974_1203814_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	1.24968e-87
NZ_CP045649.1\|WP_153322488.1\|1214801_1216484_+\|ABC-transporter	gnl\|CDD\|366045	pfam00350, Dynamin_N, Dynamin family.	7.1384e-10
NZ_CP045649.1\|WP_153322493.1\|1223640_1224024_-\|globin	gnl\|CDD\|381280	cd14771, TrHb2_Mt-trHbO-like_O, Truncated hemoglobins, group 2 (O); Mycobacterium tuberculosis hemoglobin O like. The M- and S families exhibit the canonical secondary structure of hemoglobins, a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments. Truncated hemoglobins (TrHbs, 2/2Hb, or 2/2 globins) or the T family globins adopt a 2-on-2 alpha-helical sandwich structure, resulting from extensive and complex modifications of the canonical 3-on-3 alpha-helical sandwich that are distributed throughout the whole protein molecule. TrHbs are classified into three main groups based on their structural properties and named after Mycobacterium sp. genes glbN, glbO, and glbP: TrHb1s (N), TrHb2s (O) and TrHb3s (P). This group includes a Mycobacterium tuberculosis TrHb2, Mt-trHbO, encoded by the Mycobacterium tuberculosis glbO gene, which is expressed throughout the Mycobacterium growth phase. It also includes a TrHb2 from the thermophilic Thermobifida fusca ( Tf-trHb) which has a high thermostability and at the optimal growth temperature for Thermobifida fusca (between 55 and 60 degrees C ), it is capable of efficient O2 binding and release. Tf-trHb shares a relatively slow rate of oxygen binding with Mt-trHbO.	7.04671e-63
NZ_CP045649.1\|WP_153322479.1\|1200948_1202115_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226967	COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism].	6.00053e-124
NZ_CP045649.1\|WP_153322486.1\|1210306_1211617_-\|HNH-endonuclease	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	3.29003e-06
NZ_CP045649.1\|WP_153322483.1\|1206502_1208371_+\|glycoside-hydrolase-family-2	gnl\|CDD\|236657	PRK10150, PRK10150, beta-D-glucuronidase; Provisional.	8.66121e-29
NZ_CP045649.1\|WP_153325654.1\|1220789_1221263_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	4.13293e-12
NZ_CP045649.1\|WP_153322477.1\|1199276_1199948_-\|transcriptional-regulator	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	1.21812e-28
NZ_CP045649.1\|WP_153322487.1\|1213626_1214748_+\|PrsW-family-intramembrane-metalloprotease	gnl\|CDD\|379143	pfam13367, PrsW-protease, Protease prsW family. This is a family of putative peptidases, possibly belonging to the MEROPS M79 family. PrsW, appears to be a member of a widespread family of membrane proteins that includes at least one previously known protease. PrsW appears to be responsible for Site-1 cleavage of the RsiW anti-sigma factor, the cognate anti-sigma factor, and it senses antimicrobial peptides that damage the cell membrane and other agents that cause cell envelope stress, The three acidic residues, E75, E76 and E95 in Aflv_1074, appear to be crucial since their mutation to alanine renders the protein inactive. Based on predictions of the bioinformatics programme TMHMM it is likely that these residues are located on the extracytoplasmic face of PrsW placing them in a position to act as a sensor for cell envelope stress.	1.25641e-42
NZ_CP045649.1\|WP_153322478.1\|1200116_1200941_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|225136	COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism].	1.26985e-22
NZ_CP045649.1\|WP_153322485.1\|1209762_1210116_+\|hypothetical-protein	gnl\|CDD\|380097	pfam18050, Cyclophil_like2, Cyclophilin-like family. This entry represents a family of cyclophilin-like proteins found in a range of bacterial species.	1.30974e-41

>NZ_CP045649.1|WP_153322486.1|1210306_1211617_-|HNH-endonuclease
MASPELPDCDTPAAVLAFAQRRRAAAQRAEIDVLEAALVWAAMHPEQSVADATPATGLVFGELAVPLAGEGAPLVAEFAPMEFGAAIGMSTDASRSLVGDALELAHRLKRTWKLVRAGKVPLWKARRLAQLTTTLPMDGAEFVDRQLAGFVGKISWAGIERLVDQARVAFDPEGAEKERLAAAEGRRFDVHTDKAIHDGTVHVEGVLDLADAMDLDTAIRQGAEDLAALGSTESLDVRRSMAAGELARRQLAFDLRVEAGGGTASVVKPRQVVIHVHLSQAAVSRDEAGIAHVEETRSIVSTEQVRQWCGAETQVVVKPVIDLEAHHHTDAYAVPDKLAEQTRLAQPVCAFPWCERPARRCDTDHVIAHGAGPSGGPTCSCNLAPLCRRHHRAKTHTGWSYDKTDTATYLWRSPHGLHLVKDHGTTHLLTAHPPDE
>NZ_CP045649.1|WP_153322485.1|1209762_1210116_+|hypothetical-protein
MQIQIIVRGQIFTATLQDSSAATDLVAQLPVTLEMTDHQGVEKTGPLPAPLSLEGQPEGADPDIGDLGYYAPGNDLVLYYGDQSYYPGIVVLGRLDGDAAERIASMGGAITATIETR
>NZ_CP045649.1|WP_153322484.1|1208367_1209594_-|MFS-transporter
MPSLGRDFRWLWTGNAAGNMADGVAFVAIPLVATSITTNPTVIAGLALVYSAVRMLLVVPVGVVVDRVDRRLLIWLPNVLRGLILVALSLAFTAGIESLLLLYLAFALVGVMEIAADNAALSVLPALVEPDDLDRANGRITTAQLVADEFVGPPLGGFLFAIAVAAPLAATGALYAAAGLVFLAIPRQPRPARTDEVPGKRPTMWRDAAAGARWIRGQQLLLGLAITGGLASVAYMMTFSIIVLYATDTLDVGPTGYGVILAVSSLGGLLASISTARMRRAVGYRILVPGALALGAITMLGLSVTTSPYVAGLLLAAYIFHATVWNICVVSLRQRLVPDDLRGRQNSLFKLSGLMGLVIGAAIAGPIASAAGLAAPFGIAGLIFAGCTAYTSRLLKHEPETVGRTAIP
>NZ_CP045649.1|WP_153322483.1|1206502_1208371_+|glycoside-hydrolase-family-2
MSPLTSLPTVPLLTRWGRELDRDHPLPEHPRPQLVRPRWHNLNGRWSHAIVPTPLEGPVPDAWDGEIVVPFSPEAPLSGAARGPGADEALWYDRTVTLPAAVRPGSGERVLLHLGAVDQECRVLAGPPGAEPVEVGAHVGGYLPFSCDVTDALAADGSVRLLVAVRDRTEAVPLTRGKQRTERGGIWYTPHSGIWQTVWAETVPATHVTRLDLVPHLVAADPAASAVEVTVHAAGPEFDAPAEVELLAEGAVVARGVARPGVPLRLGVPDARHWSPEDPFLYDVRVRLGSGDLADEVTSYVGMRSVGVGPGPDGRPRLLLNGAPYFHAGVLDQGYWPDGLCTPPSDAAMVHDITEMKRLGFTMLRKHIKVEPMRWYAHCDRIGMLVWQDAVNGGGAYRGKVVTAPAVAPFVHYRDTGARAHARFAREDAAGRAGFEAELRAMVEHLRSVPSIVAWVPFNEGWGQFDAVRIAAEVRLLDPTRIIDHASGWHDQGAGDLRSLHVYFRHFRTPRSVRLRREERVLALTEYGGYALPVPGHVWGEGSFGYRKMRTASDLLAAFERLHDDQLVPAVRQGLAAIVYTQVSDVEDELNGLLTYDREVTKLPAERVRAVLDRLRAAAEAH
>NZ_CP045649.1|WP_153322482.1|1204787_1206335_-|hypothetical-protein
MPDITPALTRRGLMGLGLGAVAAWTLASCSTDEGGAGTGGGGSALPAAAITLGSTAITSAIDPHAATSNVGRTYAINVFDSLVDFDGEGEIVASLATDWTRVDDTTLELTLREGVTFHNGGTFDAKAVKANVERILSGDPAYSLLVGRLGPISKVEVIDARTVRVITSAPDPILLNRLTMIDIVDPATIGKEVTVETISGTGPFRVVGYKPDQEVELERYDDAWQPSESIATATLVAISDPSSLAIAVRAGEVDTAFGLAPDQVAQLQGTLDLETPSAGSCAICSLIPDAEPALADPRVRRAINMAINHEEFVEVGLGGYGEVSTGQLLQPGYLGYDDSLEGFPYDPDGAKELLAEAGVKDLELPIVTTAFFKAQAEIVVGYLEAIGVKSRVELQDLSAFLGTLLSKSEFPLVYWQTDYFDLQDILSVTRFGPQQPGTQLHFENPRYAELYQQATVELDDDKRAATIQEMAQLLNEEAGVLFLGWPKLAYVHSRDVELNLDGESLINLQKVVRSA
>NZ_CP045649.1|WP_153322481.1|1203810_1204791_-|ABC-transporter-permease-subunit
MSDLATPEAAEVRAPAATGGVLRTIALWVLRLLVVTLGILTILFFLLRLSGDPAAVVAGAGATDEQVKQVRVSLGLDQPLLTQYAQFLADTARLDFGRSLLTDQPALALVLERMPATLLLAAITIVVSTLVGVPLGVLAAARHRRTTGRLLSLLAALFQAVPSFLLGILLLLVLGLQLGWLPTYGSGTPAHVVLPVATLAAFTIARIVRLTRSGVLQALGQEFTGAALARGATRRRVLWHHALRNALVPLTAFVTIEVAHLISGAVIVESLFAYDGVGRQLVDSIFRRDYPVVQATVFVIAVLVVLVSAAGDLVLHRLDPRMRREA
>NZ_CP045649.1|WP_153322480.1|1202974_1203814_-|ABC-transporter-permease-subunit
MSRLLRRPAVAVGLGGLLVVLVLVTFPGLLTEHDPNTQTLSQRLVPPAWMAGGSNDHLLGTDHLGRDIVARTLHGGRVSLLVGFVAATAASVLGILLGLLAGYRGGWVDRVVTEAGNVWLAFPFLVLAIATVAVVGSDLTVLVVLLAVAAWVTPTAITRAATASLRGEDYVHAAIGMGASDTWILRRHVLRTVLAPNLVVWTLTVGTLVVIEGALSFLGLGVRPPTASWGSMLNDGRAYLETSWWLVVFPGAALTLTVVLTNLLGDGLRDALDVRTESR
>NZ_CP045649.1|WP_153322479.1|1200948_1202115_-|ATP-binding-cassette-domain-containing-protein
MRVPPALPAGPRRVPHPGAAAGAPGPRAPRRLPPPGPRRSPALSNPALSDPVLRVQRLRKTFPVTVGRRRTTLHAVEEVSLEIGRGETYALVGESGCGKSSVARCVTRLHEPTGGVVEVLGTDVTHLSRRALRPLRPGFQLVFQDPYSSLDPAYTVQALVSEPLRVQRRPHDRALVAGLLEEVGLGAELLDRRPHELSGGQRQRVVIARSLALGPDLLVLDEPVAALDASVQAQVVNVLRDLQRRRGLAYLFISHDLGVVANLADRIGVMYLGRIVEEGTVEEVLGSPQHPYTQALVSAIPVSDPAQRDSAARIRLQGEPPSPIDRPTGCAFAPRCWRAEDRCRTETPALVRRDGTDHPVACLLTGDPVDPVDPVDPVDPMDTAAAAR
>NZ_CP045649.1|WP_153322478.1|1200116_1200941_+|methyltransferase-domain-containing-protein
MTTEASTADQAVKAKHRAMWASGDYPRLVSDLITGLGPALVQAAGLAPGDRVLDVAAGTGNAALPAARAGAEVTASDLTPELLEAGRRVAEAEGLALAWEAGDAEHLPYDDGTFDAVVSCVGVMFAPHHQEAADELVRVCRRDGTIALLSWTPQGFIGQAFAAMRPFAPPPPPGAQAPPLWGDEAHLTDLLGAEVTDLRSTRQSLEVGGFSTGEEWRDYFKAVYGPTIATYRNVADDEERTAELDAELAELPRRFGVAEGPMRWEYLLTTARKA
>NZ_CP045649.1|WP_153322477.1|1199276_1199948_-|transcriptional-regulator
MSTYGQFCPVAKAMEVLDERWTLLIVRELLSGSSRFNEIRRGVPRMSPALLAKRLRTLERAGVVERREELGAVGYRLTTSGLELSEVVEALGRWGLRWIGELGVSDLDPHLLMWDMRRTVPVSAWPRERTVVAFDFTDVEPRQARWWMCVNGSDVDVCDADPGHEVAVWLRTTLRGLTEVWRGDRGWDDLLADPVTSLDGTDPARRDLPRWLGSSALAAVPRP
>NZ_CP045649.1|WP_153325653.1|1212130_1213474_-|M24-family-metallopeptidase
MRTGWGERELDLPPHPITPWAAARRARLTTMFPGERLVLPAGTYKVRANDTDYRFRADTAHTYLSGNQTSDAVLVLHDEEAVLYARPRSSRETDEFFRDRQYGELWAGRRPSVHEISSSLGIEVRHVDRLADDLTRGNAPKTRVHRGIDARVDKLVAGDAALDADLARVVSELRLVKDAWEIEELRAACDATTLGFEDCVREWPQVLEHGERWIEGTFFRRARTMGNDIGYDSIVGGGRHATTLHWIDNDGPIVPGELLLLDMGVEGRNLYTADVTRTLPVSGRFTPLQRDLYELVLAAQEAGIEAVRPGAPFQGTHQAAMSVLAHGLEDLGLLPVSAEEALSPDSRVYARWTLHGTSHMLGMDVHDCGAASTDVYPKGDLAEGMVLTVEPGLYFQEDDLLVPEELRGIGIRIEDDILVGADGPVNLSAALPRAADEVEAWMGQHQG
>NZ_CP045649.1|WP_153322487.1|1213626_1214748_+|PrsW-family-intramembrane-metalloprotease
MQGARRDSVAFTVLVAVLVAIGALAMLLLIAFSGAPGTLALATVLAALPVVPLVMCYLWLDRYEPEPRGLLVAALLWGGFVATAAAILLSGVGGLVGGLSEAENLAVLAPVTEEACKGLFLVLLLWWRRAELDGILDGIVYAGMVGIGFAFTENILYLAAAYNGTDGLGPGGTEALTATFVVRCLFSPFAHPLFTTFIGIGVGIAVGARTPALRVAAPLAGYVLAVLAHGLWNASTVFGIGPFMLVYVVLGVPALLGLAALAIWARSSERRMLAASLGDAAQRGLIPATDIGWVVDLGARRRARAYARAYGGPQVERAMRDYQQAAIELGFLHHRYLRGTPPPDFAQRGQHYVARIGAVRPFIAFPGQVVPTR
>NZ_CP045649.1|WP_153322488.1|1214801_1216484_+|ABC-transporter
MVTALVRLRGALQAAVLPLDLAGVEGPRAVRSELVDQLEDYVIPRMTTLEAPMLVVVGGSTGAGKSTLVNSLVGRRVSEPGVLRPTTRSAVLVHHPDDAEWFGQDRLLPDLRRVEAPTKDHGALQLVADASVPPGIAIIDAPDVDSIEKSNRELATQLLAAADMWLFVTSAARYADQVPWEHLKQAAARSIAVAIVLDRTAPDAVPTVSTHLARMLASRGLKDSPLFVVHEREVDEDGLLPAAAVADIRGWLDSLARDVDARGGVVRQTMEGTVRALTRQLHPVADAVAQQATAVAQLREAASTAYDQAAGELLAAAGDGTLLRGDLLARWEEFVGTGELLRTLEDKVGWLRERLVSTVKGKPQQAEQVSEAVESALESLVLAHAELAAGRAAQAWSAHPAGTGLLATEEGAALTRPSAELRRACERAVRDWQGEVTELVRAEGADKRTSARFLVYGVPGLSVALMVLTLDDGSTPSAGLGRRLLEAVFGAPTVATLERRSREGLTPRLRALLDAEGLRWQQHLDSLGVTTDAAEQLRHATRRVDDVRFGPAPRAGEVGD
>NZ_CP045649.1|WP_153322489.1|1216591_1218259_+|ABC-transporter
MTSSLDEPQDRAEERVASAPSIGSGTAARIAGLEAAATAAEGRLDPTLVADAHAVVAHAAERTRLSADHTVVAIAGATGSGKSSTFNALTGLELSAVGVRRPTTSWATACVWGSEGASELLSWLGIPERHQTTRDSMLDTRREDHSLDGVVLLDLPDHDSTEVSHHLEVDRLVSHADLLVWVLDPQKYADAAIHDRYLEPLRTHDEVMLVVLNHIDVVPEERRESLVADVRRLLDDDGLQRVPIVPVSARQGIGIDELRAEIRRRVEGKQATRSRIEADVAAMAQRLEAVSGDAEPAALPPSRVEAFEDALVEAAGVPTVVDAVERSTRLRAARATGWPVVSWVSALRPDPLTKLGLDLGEAGPALRGEQPGQPTTAPVQRTRVDTEVRALVDVASEGMSHAWAGAVRREPVANIPVLADRLDTALASTDLGADRLPGWVSAVRVLQWLLLLAAVGGGVWAVLAATGAVGDAPELLNVPVPLVVLVVGLVLGVVLALSCRGLVAGAARKRAAEAEERLRGAVSGVARELVVGPIETEQQACTKVHRGILAALGRA
>NZ_CP045649.1|WP_153322490.1|1218428_1218884_+|single-stranded-DNA-binding-protein
MHDTVITLRGRLGGDVTVRAAGEAQVATFRVACTPRRYHRRTDSWVDGDTQWYSVNAWRALGDNCARSLRRGDPVVVHGRLEIRTWTNQAGEEVTSLEVEATAVGHDLGRGTTRFARTPRAADTAALEPAELAADDRAGEETPARDRSPAA
>NZ_CP045649.1|WP_153322491.1|1219009_1220692_+|energy-dependent-translational-throttle-protein-EttA
MAEYVFTLRNVRKAHGDKVVLDNVTLSFLHGAKIGVVGPNGAGKSSLLKIMAGLDQPNNGDAIKDPDASVGMLQQEPPLTEGKTVLENVEEAVGEIKAKLDRYNAISEEMANPDADFDTLLAEMGDLQTDLDHASAWDLDSRLDQAMDALRCPPPDTLVDNLSGGERRRVALCKLLLQQPDLLLLDEPTNHLDAESVQWLEGHLKSYPGAVLAITHDRYFLDNVAEWIAEVDRGSIHGYEGNYSTYLETKKDRLKIEGQKDAKRAKMLEKELEWVRSNAKARQTKSRSRLARYEELAAEAEKARKIDTAEINIPAGPRLGDVVLEGRHLTKGFGDRVLWNDVSFTLPRAGIVGVVGPNGVGKTTLFRMITGNDEPDSGELVVGQTVKISYVDQSRGGIDPNKNVWEVVSDGLDFIKVANFEMNSRAYVASFGFKGPDQQKKAGVLSGGERNRLNLALTLKMGGNMLLLDEPTNDLDVETLSSLEDALLDFPGCAVVTSHDRWFLDRVATHILAWEGDEEDGGKWFWFEGNFASYEQNKIERLGPDAARPHRVTHRRLTRD
>NZ_CP045649.1|WP_153325654.1|1220789_1221263_-|MarR-family-transcriptional-regulator
MRWLDDSEQRSWRALLMGVTLLLDRLDDDLQESFDLSMVEYEILVRLSESDGRMRMARLADGLAHSRSRVTHTIKRMEKAHLVRREASTEDGRGIVAVMTPAGRELLVRAAPVHVQGVRDHLVDLVSAEDFAAVGRVMNTVADHLVGAHPEREMREI
>NZ_CP045649.1|WP_153322492.1|1221357_1222572_-|acetyl-CoA-C-acetyltransferase
MPEAVIVSATRSPIGRANKGSLKDLRPDDLAATIVRAALDQVPALDKATVDDVYLGCGLPGGEMGFNMARVVNVLNDMDGVPGATLTRYCASSLQTTRMAFHAIRAGEGDVFVSAGVETVSRFRNGTSDHLPNTQNPLFVDAEARTQEYAAGGRDWHDPREDTELPDIYIAMGQTAENVARMRGLSRRELDEFGVRSQNLAEKAIADGFWEREITPVTTPDGTVVTTDDGPRAGVTYESIAQLQPVFRPDGVVTAGNCCALNDGAAAVVVMSDTRAAELGLTPLARIVATGVSALSPEIMGLGPVEATQKALASAGMSIGDIDLVEINEAFAAQVVPSYQDLGIDLDRLNVNGGAIAVGHPFGMSGARLQATMLNSLDWHDKTTGLITMCVGGGQGMALILERV
>NZ_CP045649.1|WP_153325655.1|1222752_1223607_+|acyl-CoA-thioesterase
MRWADLDLLGHVNNVTYVDYLQEARVDMLRTHELRSRTAGLVEGIVVARHEVSYVAPLMFGFRPVSIECWVTEIRAASFTMAYEVFHPGEDGTRTVYLRATTVLSPYVFAEERPRRLTAEEKAVLERFREDPLPASAPIAPVPHTESGHYPVRVRFSDVDVYGHVNNVLYFEYLQEARIWLVDQMMRDAGVDTSGVSVVVAQTDVDYKVPILFRPEAYDVWSTIAHLGNKSMVIESEICDGDVVLARARVVMVFFDVAQQRSAAPPEEYRAVIEKYAARTRVGG
>NZ_CP045649.1|WP_153322493.1|1223640_1224024_-|globin
MDRVSTFYDDIGGYDTITKIVAKFYEGVAGDEVLRPMYPEEDLGPAEVRFRDFLVQYWGGPSTYSERRGHPRLRMRHAPFRVDPVSRDHWLQHFRAALDEADLTPEQDAQFWDYVTHAAQFMVNTVE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045649_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045649_2

3502154-3502242

Orphan

Consensus_repeat	Method
CGCTCGTTCCTCGCTGCGGTCACTCCCACTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045649_2

>merge|NZ_CP045649|2|3502154-3502242|CRISPRCasFinder
CGCTCGTTCCTCGCTGCGGTCACTCCCACTCTCCCCTTAACGAGTGGGAGCTGACCTTCGCTCGTTCCTCGCTGCGGTCACTCCCACTC

>NZ_CP045649|2|2|3502154-3502242|CRISPRCasFinder
CGCTCGTTCCTCGCTGCGGTCACTCCCACTC	TCCCCTTAACGAGTGGGAGCTGACCTT
CGCTCGTTCCTCGCTGCGGTCACTCCCACTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045649.1\|WP_153324921.1\|3514054_3515161_-\|GuaB3-family-IMP-dehydrogenase-related-protein	unknown	unknown	gnl\|CDD\|236322
NZ_CP045649.1\|WP_153324912.1\|3501178_3502045_+\|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase	unknown	unknown	gnl\|CDD\|274680
NZ_CP045649.1\|WP_153324904.1\|3492209_3494795_+\|7,8-didemethyl-8-hydroxy-5-deazariboflavin-synthase	unknown	unknown	gnl\|CDD\|236422
NZ_CP045649.1\|WP_153324916.1\|3507547_3509017_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143457
NZ_CP045649.1\|WP_153324907.1\|3498183_3499359_+\|ROK-family-protein	unknown	unknown	gnl\|CDD\|224851
NZ_CP045649.1\|WP_153325861.1\|3494813_3496058_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226669
NZ_CP045649.1\|WP_153324905.1\|3496066_3496894_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP045649.1\|WP_153324918.1\|3510167_3511346_-\|phosphotransferase	unknown	unknown	gnl\|CDD\|270703
NZ_CP045649.1\|WP_153324909.1\|3499925_3500222_-\|antibiotic-biosynthesis-monooxygenase	unknown	unknown	gnl\|CDD\|225209
NZ_CP045649.1\|WP_153324914.1\|3504052_3505807_-\|FAD-binding-protein	unknown	unknown	gnl\|CDD\|225186
NZ_CP045649.1\|WP_153324915.1\|3505839_3507459_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|236501
NZ_CP045649.1\|WP_153324922.1\|3515195_3516698_-\|IMP-dehydrogenase	unknown	unknown	gnl\|CDD\|376340
NZ_CP045649.1\|WP_153324919.1\|3511400_3513113_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223651
NZ_CP045649.1\|WP_153324923.1\|3516727_3517639_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP045649.1\|WP_153324910.1\|3500300_3500711_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378276
NZ_CP045649.1\|WP_153324908.1\|3499441_3499921_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045649.1\|WP_153324911.1\|3500720_3501119_-\|glyoxalase	unknown	unknown	gnl\|CDD\|319906
NZ_CP045649.1\|WP_153324917.1\|3509049_3510171_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045649.1\|WP_153324920.1\|3513266_3514058_-\|carbon-nitrogen-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|143587
NZ_CP045649.1\|WP_153324906.1\|3496893_3498015_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380650

Protein	Function_ID	Function_description	E-value
NZ_CP045649.1\|WP_153324921.1\|3514054_3515161_-\|GuaB3-family-IMP-dehydrogenase-related-protein	gnl\|CDD\|236322	PRK08649, PRK08649, GuaB3 family IMP dehydrogenase-related protein.	0
NZ_CP045649.1\|WP_153324912.1\|3501178_3502045_+\|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase	gnl\|CDD\|274680	TIGR03619, F420_Rv2161c, probable F420-dependent oxidoreductase, Rv2161c family. Coenzyme F420 has a limited phylogenetic distribution, including methanogenic archaea, Mycobacterium tuberculosis and related species, Colwellia psychrerythraea 34H, Rhodopseudomonas palustris HaA2, and others. Partial phylogenetic profiling identifies protein subfamilies, within the larger family called luciferase-like monooxygenanases (pfam00296), that appear only in F420-positive genomes and are likely to be F420-dependent. This model describes a domain found in a distinctive subset of bacterial luciferase homologs, found only in F420-biosynthesizing members of the Actinobacteria. [Unknown function, Enzymes of unknown specificity].	4.65522e-58
NZ_CP045649.1\|WP_153324904.1\|3492209_3494795_+\|7,8-didemethyl-8-hydroxy-5-deazariboflavin-synthase	gnl\|CDD\|236422	PRK09234, fbiC, FO synthase; Reviewed.	0
NZ_CP045649.1\|WP_153324916.1\|3507547_3509017_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143457	cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like. The Mycobacterium tuberculosis NAD+-dependent, aldehyde dehydrogenase PDB structure, 3B4W, and the Mycobacterium tuberculosis H37Rv aldehyde dehydrogenase AldA (locus Rv0768) sequence, as well as the Rhodococcus rhodochrous ALDH involved in haloalkane catabolism, and other similar sequences, are included in this CD.	0
NZ_CP045649.1\|WP_153324907.1\|3498183_3499359_+\|ROK-family-protein	gnl\|CDD\|224851	COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism].	1.13106e-56
NZ_CP045649.1\|WP_153325861.1\|3494813_3496058_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226669	COG4214, XylH, ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism].	4.23161e-85
NZ_CP045649.1\|WP_153324905.1\|3496066_3496894_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	4.98483e-102
NZ_CP045649.1\|WP_153324918.1\|3510167_3511346_-\|phosphotransferase	gnl\|CDD\|270703	cd05154, ACAD10_11_N-like, N-terminal domain of Acyl-CoA dehydrogenase (ACAD) 10 and 11, and similar proteins. This subfamily is composed of the N-terminal domains of vertebrate ACAD10 and ACAD11, and similar uncharacterized bacterial and eukaryotic proteins. ACADs are a family of flavoproteins that are involved in the beta-oxidation of fatty acyl-CoA derivatives. ACAD deficiency can cause metabolic disorders including muscle fatigue, hypoglycemia, and hepatic lipidosis. There are at least 11 distinct ACADs, some of which show distinct substrate specificities to either straight-chain or branched-chain fatty acids. ACAD10 is widely expressed in human tissues and highly expressed in liver, kidney, pancreas, and spleen. ACAD10 and ACAD11 are both significantly expressed in human brain tissues. They contain a long N-terminal domain with similarity to phosphotransferases with a Protein Kinase fold, which is absent in other ACADs. They may exhibit multiple functions in acyl-CoA oxidation pathways. ACAD11 utilizes substrates with carbon chain lengths of 20 to 26, with optimal activity towards C22CoA. ACAD10 may be associated with an increased risk in type II diabetes. The ACAD10/11-like subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K).	2.98567e-69
NZ_CP045649.1\|WP_153324909.1\|3499925_3500222_-\|antibiotic-biosynthesis-monooxygenase	gnl\|CDD\|225209	COG2329, COG2329, Uncharacterized enzyme involved in biosynthesis of extracellular polysaccharides [General function prediction only].	6.99636e-17
NZ_CP045649.1\|WP_153324914.1\|3504052_3505807_-\|FAD-binding-protein	gnl\|CDD\|225186	COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism].	1.02874e-57
NZ_CP045649.1\|WP_153324915.1\|3505839_3507459_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|236501	PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed.	0
NZ_CP045649.1\|WP_153324922.1\|3515195_3516698_-\|IMP-dehydrogenase	gnl\|CDD\|376340	pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain. This family is involved in biosynthesis of guanosine nucleotide. Members of this family contain a TIM barrel structure. In the inosine monophosphate dehydrogenases 2 CBS domains pfam00571 are inserted in the TIM barrel. This family is a member of the common phosphate binding site TIM barrel family.	0
NZ_CP045649.1\|WP_153324919.1\|3511400_3513113_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|223651	COG0578, GlpA, Glycerol-3-phosphate dehydrogenase [Energy production and conversion].	1.04976e-158
NZ_CP045649.1\|WP_153324923.1\|3516727_3517639_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	1.65469e-07
NZ_CP045649.1\|WP_153324910.1\|3500300_3500711_+\|hypothetical-protein	gnl\|CDD\|378276	pfam09851, SHOCT, Short C-terminal domain.	0.000145872
NZ_CP045649.1\|WP_153324911.1\|3500720_3501119_-\|glyoxalase	gnl\|CDD\|319906	cd07242, VOC_BsYqjT, vicinal oxygen chelate (VOC) family protein similar to Bacillus subtilis YqjT. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.18149e-22
NZ_CP045649.1\|WP_153324920.1\|3513266_3514058_-\|carbon-nitrogen-hydrolase-family-protein	gnl\|CDD\|143587	cd07197, nitrilase, Nitrilase superfamily, including nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes. This superfamily (also known as the C-N hydrolase superfamily) contains hydrolases that break carbon-nitrogen bonds; it includes nitrilases, cyanide dihydratases, aliphatic amidases, N-terminal amidases, beta-ureidopropionases, biotinidases, pantotheinase, N-carbamyl-D-amino acid amidohydrolases, the glutaminase domain of glutamine-dependent NAD+ synthetase, apolipoprotein N-acyltransferases, and N-carbamoylputrescine amidohydrolases, among others. These enzymes depend on a Glu-Lys-Cys catalytic triad, and work through a thiol acylenzyme intermediate. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer. These oligomers include dimers, tetramers, hexamers, octamers, tetradecamers, octadecamers, as well as variable length helical arrangements and homo-oligomeric spirals. These proteins have roles in vitamin and co-enzyme metabolism, in detoxifying small molecules, in the synthesis of signaling molecules, and in the post-translational modification of proteins. They are used industrially, as biocatalysts in the fine chemical and pharmaceutical industry, in cyanide remediation, and in the treatment of toxic effluent. This superfamily has been classified previously in the literature, based on global and structure-based sequence analysis, into thirteen different enzyme classes (referred to as 1-13). This hierarchy includes those thirteen classes and a few additional subfamilies. A putative distant relative, the plasmid-borne TraB family, has not been included in the hierarchy.	1.88876e-69
NZ_CP045649.1\|WP_153324906.1\|3496893_3498015_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380650	cd19995, PBP1_ABC_xylose_binding-like, periplasmic xylose-like sugar-binding component of the ABC-type transport systems. Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type 1 periplasmic binding protein (PBP1) superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes a transition from an open to a closed conformational state upon ligand binding. Moreover, the periplasmic xylose-binding protein is homologous to the ligand-binding domain of eukaryotic receptors such as glutamate receptor (GluR) and DNA-binding transcriptional repressors such as LacI and GalR.	4.67928e-111

>NZ_CP045649.1|WP_153324912.1|3501178_3502045_+|TIGR03619-family-F420-dependent-LLM-class-oxidoreductase
MRFSINTAFLPTEQLVEIARAADQLGYHGIAVPEHVVDLETLRTPYPYTPDGQRRWSLDAPWPDPWVLIGALAAVTTRLRFVTTVYVPALRHPLTVAKAVGTAAVLSGNRVALGVGIGWCEEEFELLDQDFRTRGRRTDEALALCRAMWTPGMKSFEGEFHSVPPLAMEPTPTEQPAIYVGGLSELAFRRAARHDGWVGDMYRTDAAIGHAARLAEVRREQGRTGDFEVLVALTDAYLPEHFRRADEGGITECMTMPWAYYHGMDATLGQKIESMERFAADVLTPLAA
>NZ_CP045649.1|WP_153324911.1|3500720_3501119_-|glyoxalase
MERAVHHLDLWVSDPDLAADEWGWLLGELGWEIDIEGSSWVHPDGTYLFLERSPDQLDVPHDRMRPGLNHLALLMPEDADRAALDRLRAESSGHGWHELFADRFPHAGGEQHTALYLANSEGFEVEVVLAER
>NZ_CP045649.1|WP_153324910.1|3500300_3500711_+|hypothetical-protein
MPVVAHLVLGNLAFEEDPGFGDTVPAAVPVGFGIFFVLIVLIGIASTVWRVSTARRMARDAGLDERDASRMALLSDEGLSTTYLVSSLRAQQQPSPQPRAVRPVAEWLRELTALRDDGLLTAEEYAERRRAILDEV
>NZ_CP045649.1|WP_153324909.1|3499925_3500222_-|antibiotic-biosynthesis-monooxygenase
MILEHALLPVRPGTAEEFLAAFAEARSIISASPGFGRLELSRCVERPDTFLLLVEWERLEDHTEGFRGSAAYAEWRRLLHRFYDPFPVVEHFERVLQA
>NZ_CP045649.1|WP_153324908.1|3499441_3499921_+|hypothetical-protein
MTSDDINPDPGDRETYGDYSVDDEDQPGAEDMLLDDDDVVDEADRGYSPPEKYSPAQGYGNTPWEEAHRETIDQRERQEIPEPDPYVLAETEDIETIEGTAESSEVGDQRAGRLVDPDEGSGEDTESDLVGRDVGIDGAAASAEEAAVHVVPDDELGQP
>NZ_CP045649.1|WP_153324907.1|3498183_3499359_+|ROK-family-protein
MSTVRAAPGSTSSLRVANQQRVLDVLRGAVADAPADGTPSTAYTQAELARTTGLAPATVSNIVRELSAAGLAETTPGAGRRGSAVRLSAAAGTVAGIDFGHSHVAVAVGDLVGRVRRERRVRLEDPADHRGALALAAGLLEELLEGEGPARHVALGLPAPVTDDVIRSAAIFPGWEGVDARAAAAEVLDAPVHVENDANLGALAEHRVGVARGHRSSVFVKISSGVGAGIVIDDQLFHGAGGSAGEIGHLTLDDQGPLCRCGSRGCLEAYTSIGTVLSMMAGQLPGACFDDIVAAARADNVSARRALEDAGLHLGWGLASIVNLLNPAVVVVGGDMARAGSLILDSARIGLRRHALDAVALTPVVASELGERASLVGAVLLAAERTVLSVD
>NZ_CP045649.1|WP_153324906.1|3496893_3498015_-|substrate-binding-domain-containing-protein
MTIHLHRVAALGAALILGAGSFAACGANDDNSDNDTGDGGGGGGDSASGGTIALLLPESKTTRYEAFDKPLFEAKVAELCPDCEVDYYNADQDEQKQAQQVTSALTAGADVMVLDPVNGDGATGMVQEAQGQDVPVIAYDRFIEGADYYMSFDNQTVGQMQAEALVEAVGDTGSILMLNGDPKDPNAGQFKAGAHSVLDESGVEVLAEYDNPDWSPENAQQWTTDQLSKFEPSEIVGVYAANDGQAGGVVAAMTGAGVARNQLPPITGQDAEVAAIQRILAGEQAMTIYKPIAIEAETAAEVAVQLANGEEPGATSDTGIDQSDFEGVTSYIFDPIVVTSDNVADTVIADGFYTAEDICTGDYAKACAEAGIS
>NZ_CP045649.1|WP_153324905.1|3496066_3496894_-|ATP-binding-cassette-domain-containing-protein
MSTTTERASSGPAQGEVVLSLAGVHKRFGAVQALTDVHLEVAAGEVVALVGDNGAGKSTLVKVISGVYSPDDGEIVFGGRIITVGGPAAAQALGIATVFQDLALCDNLDVVANLFLGQEVHRGPVLDEVTMERESWRLLRTLSAKIPSVRIPVASLSGGQRQTVAIARALVGDPRVVLLDEPTAALGVAQTAEVLNLIERLRDTGLGVILVSHNMADVQAVADRIVVLRLGRNAAEFRTEDVTTEQLVAAITGASDNVVATRAGRARPTHPEAEQ
>NZ_CP045649.1|WP_153325861.1|3494813_3496058_-|sugar-ABC-transporter-permease
MDPTSSPVAADVADERLIQGRGLGGLVSAGWSRLRGGELGALPVVFGLAIISLVFYSQEATFLSSRNLVSITQFAAPVGVISLGIVLVLLLGEIDLSVGSVSGFAAASMAVLVVDKSQSLVVGMLVGVLIGTAIGSFYALLYTRIGVPSFVFSLAGLLAFQGALLYVLGDQGTIVLPIDSGLREFARDRFLSDVQAYALLAIVVAVYVGSQLLAARRRRAAGLTPPNLLLVAVKGVLLLGGLGFLTYYLGIDRGWGYLFVLFAALVVAMDLVLRKTRWGRHVYAVGGNEEAARRSGIKVGRVYFSVFAAASTFAALGGILLAGQLTSVSQSSGTTDTNLTAIAAAVIGGTSLFGGRGTAYSALLGIMVLQAIQNGLNLMNVDSSVRFMVTGAVLLLAVAIDSVSRRVRSSSGRG
>NZ_CP045649.1|WP_153324904.1|3492209_3494795_+|7,8-didemethyl-8-hydroxy-5-deazariboflavin-synthase
MTRVSQTTDRPTPQQVRRALARAERGAALDVAEAGALLAASGADLDRLCAAAAKVRDAGLVAAGRPGLVTYSPKVFIPVTRLCRDRCHYCTFVETPGQAAREDRAPYLSPDEILDIARQGAELGCLEALFTLGDRPEDRWPEAQAWLDEQGYDSTLAYVRAMAVRVLEETGLLPHLNPGVMSWEEMNRLKAVSPSMGMMLETTSRRLFETKGEAHFGSPDKDPELRLRVLEDAGRLAVPFTTGLLVGIGETLTERAETIFALRATARAYGAVQEVIVQNFRAKPDTAMRHTDDLGLEEYRAAIAVTRLVLGPKARVQAPPNLVDLAECRALLDAGVDDWGGVSPLTPDHVNPERPWPSLERLRAITAECGFELAPRLTVHPEYVVPSLTGGTPWVDPRLHRHVAALAILEGPRAGLARPGVRPVGLPWQEPDGGFASAGRTDLHAAVDTEGRSADRRGDFESVYGDWDAVRAAAVTTSAGIATGSIDGAPAVLTAEGREALAAAEADPGNLSDAHALTLMTAEGELLDEVCRLADHLRREAVGETVTYVVNRNINFTNVCYVGCRFCAFAQRRTDSDAFSLSLDEVADRAAEAWDLGATEVCMQGGIDPELPATAYFDLVAAVKARVPEMHVHAFSPMEVVNGTARTGLSIEDFLIKAREAGLGSLPGTAAEILDDEVRWVLTKGKLPARTWIEIVSTAHRLGIPTTSTMMYGHVDNPRHWVGHLRVLSRIQDESLEAGRRGFTEFVPLPFVHTSAPIYLAGVARPGPTLRDNLAVHALARILLHGRIDNIQTSWVKLGVEGTRAMLRAGANDLGGTLMEETISRMAGSEHGSAKTIEELVEIGSGIGRPVAERTTTYERR
>NZ_CP045649.1|WP_153324914.1|3504052_3505807_-|FAD-binding-protein
MSSSGSAGGADDGGAELDFDVLVVGSGFGGSVTALRLSEKGYRVGVLEAGARFRDEDLPKHSFEVEKYLFRPEVGCYGIQRIDAIRDCMIVSGAGVGGGSLVYANTLYEPLPAFFNDPQWSHITDWQSELAPYYDQAKRMLGVVQNPLRTPADEVMEKVATEMGVADTFTPAPVGVFFGGPGTQPGDVVADPYFGGVGPDRKTCIGCGGCMTGCPHNAKNTLVKNYLYLAEQRGVKVLPLTTVTRLAPRAGGGYDVHVRFTKAKTGRRSARRVLTAQQVVLAASALGTQRLLHRMRDEGHLPQISERLGYLSRTNSESILGAIAPDTKVDYSQGIAITSSFHPDADTHIEPVRYGKGSNFMSLLQTVLTEGDGPAPRWRTWLRETWKQRRHVRDLYDLRHWSERTVIALVMQSLDNSITTYTKRIPGTRKRYLTSRQGHGVPNPTWIPAANTAVKAMARIINGTPGGNIGEQFNRPLTAHFIGGCAIGESPETGVIDPYQRVYGHPGLHVADGSAVTANLGVNPSLTITAQAERAMSLWPNKGEADPRPELGAEYVRLDPVAPHDPAVPPTAPAALRLPVVGVS
>NZ_CP045649.1|WP_153324915.1|3505839_3507459_-|aldehyde-dehydrogenase-family-protein
MSASNPTPGGPLVEGPHDPEHDPTAAYALEPAYVSALTRRIAATSGRTHEVRSPLNGAPLAHVPQSSTTDVTEAFARARRAQESWARVPVAERAAALLRLHDLVLDRQDEIVDLIVWESGKARKHAFDEPLHIALTARYYGRTAAEHLGTQRKLGVIPGLTRVEVNRVPKGVVGIISPWNYPFTMALCDGLPALAAGNAVVIKPDAQTMLSAALGAQLLEEAGFPAGLWQVVAGPGVEIGTAVIEHADYLCFTGSTATGRVVARGCADRLIGCSLELGGKNPLLVLRDADVERAAEGAVRASFSNSGQLCVSTERIFVADQVYDRFVERFVARTQAMTLGATLEWGNDMGPLISQAQLDTVTAHVEDAVAKGARVLAGGKARPDLGPYFFEPTILEHVTPDMTCFGQETFGPVVSIYRFHDEADAIARANDGEYGLNGSVFTRDGSRGRAVAAQIRCGTVNVNEAFGAVFASLDSPMGGMRQSGMGRRQGAEGILRYTEPQSVATQRLIRIAPMLGMSDRTYGKVMTANLRLLKKLGRP
>NZ_CP045649.1|WP_153324916.1|3507547_3509017_-|aldehyde-dehydrogenase-family-protein
MTLDRSLDRDAFFIDGTWAAPATSATLQVVSPHSQEVVARVPEGSAADIDAAVAAARRAFDEGPWPRLSPQERIAVLEVFSGLYAARMQEMAQLITTEMGSPISFSQLAQAPAPWMQIEAFLAIARDFAWEETRPGALGADVVVRREPVGVVAAIPPWNVPQFTTLSKVVPALLAGNTVVLKPAPETPLDAYLMAELLAEAGVPAGVVNIVAAGREVGEHLVAHPGVDKVAFTGSTAAGRRIAAVCGEQLKRVSLELGGKSAAIVLDDADLEATMAGLRFVALMNSGQACVAQTRILAPRNLYEEVVEALAETVSSMPVGDPDDPATEVGPMVARRQQERVEKYIALGQEEGARLVTGGNGMPAGLDRGWYVRPTVFADVDNRMRIAQEEIFGPVLSVIGYDGVDEAVRIANDSDYGLAGTVWTADAEAGLGVARRVRAGTYGVNTYTMDFAAPFGGFKDSGVGREFGPEGLGEYTELKSIYTAAPELA
>NZ_CP045649.1|WP_153324917.1|3509049_3510171_-|hypothetical-protein
MIGPLDEYPLHQAPLPIGWPASSDRNFYDRSYFNAHDRSGEIFVITGLGYYPNLGTKDAFLLVAREGRQTAVHLSDLCDGDRLHQRVGGYRLDVVEPLQRLHLELEETDGIAADLTWTGSFPVLQELPHVLRSGARVTLDAQRFAQVGTWEGHLSVDGERIEVTPDRWVGTRDRSWGVRPVGEAEPAGAPSDPPFEGMWWLYVPMRFEDFAVVVILQEDPDGYRTLNDCHRIHPDGRVEQLGWPQVRIHYAPGGRTPTGATIRCTTPAGEALELEVTSLLAAPLHVGGGYGGDPDWLHGTWKGEKFTERVTYDLTDPAVQGRVMFGCTDHVGRAVLTEGGRTHEGWGLFEHFCIGRHDPSGFTDFLQVAPTGA
>NZ_CP045649.1|WP_153324918.1|3510167_3511346_-|phosphotransferase
MLAPRDVSHNQEGLVTQAPPPADMTLQRSSRDAHGVPARLAAWLTTLLPPAADPRVTLLSGSEANGMSSETMLLDVEWTEAGEPRAGRYVARVAPAPEDFPVFPAYALAEQYDAIRLVGELTDVPVPQVRWLEPTGDVLGTPFFVMDRLEGVVPQDVLPYNFGDNWLYDATPEQQRRLQDATVEVLARLHAIPDPATTFGFLDPGRHGHEGATPLARALARTRAWYDFAIPDVGRSPMVERGLAWLAEHLPDTDEAVLCWGDSRIGNVLYDDFRPVGVLDWEMATLGPRELDVSWMLFAHQVFESITGLLELPGMPDLLVEADVRETYERLTGVPLGDLRWYDVFNGVQWCIVFMRTGARQIHFGEIERPDDVESLFHCKPLVERLLEEVGA
>NZ_CP045649.1|WP_153324919.1|3511400_3513113_-|FAD-dependent-oxidoreductase
MSRPIALSPGSRTAALEVMGAAELDVLVVGGGVVGAGAALDAVTRGLSVGLVEQRDLASGTSSRSSKLVHGGLRYLEMLDFALVREALTERGLLLTRLAPHLVRPVAFLYPLHHAWERPYVGAGVALYDAMAMSGRQDMGLPRHKHLFRKQVARMAPDLRTEDLHGAIRYYDCQVDDARLVMTLARTAAANGAHVATRTQVTGFLREGERVVGVTARDLENGVDLQIRARTVINAAGVWTDEVQELLGGDARLDVDASKGVHLVVPRDRIRSECGFITKTEKSVLFVIPWGLYWIIGTTDTAWDLDLAHPAASRADIDYLLAHVNTLLRDPLDHEDVVGVYAGLRPLLKPVVREGDLGETTKLSREHTVAAPVPGLVLVAGGKLTTYRVMAKDAVDHALREVERVPASITERVPLVGATGYEARTNQRVALSRAAGLEVGRIDHLLGRYGGLIDEVLDLVGTRPELAEPLVGAPHHLAAEVVYAVTHEGARHLDDVLTRRTRVSIETFDRGVEAARPAAVLMAGELGWDAATVEREVEHYRRRVEAERRSQLMATDQEADEARVQVADIV
>NZ_CP045649.1|WP_153324920.1|3513266_3514058_-|carbon-nitrogen-hydrolase-family-protein
MIVAAGQEVAVAGDLPANAATAARLTAQAGAAGARLLVLPEAFLTGYDEAVFAGPLPDEDDLAGPLLDGLRAAATAAGTTVVLGTALQRGPRRTLSSVVVRPDGRTLAAYDKQHLSGYENDHFTPGDHGASLTVDGWELGLSICYDGCFPEHARAAADDGALGYLNSAAYFPGGEHRRDTYYPARALDNGFFVVFAGLTGGCGRESFIGGSAVYDPEGRPLARLGTEPGLAVATLSRDLVAATRATHPMHADHRPALGPRLRF
>NZ_CP045649.1|WP_153324921.1|3514054_3515161_-|GuaB3-family-IMP-dehydrogenase-related-protein
MTEIEIGRAKRGRRAYAFDDIAIVPSRRTRDPEEVSVAWQIDAYRFEIPVLGAPMDSVMSPATAIAFGHHGGLGVLNLEGLWTRYEDPEPLLEEVSRLQGTDATRRMQEIYQEPVKAELITARLREVRDAGVTVAGSLSPQRTKEFAKAVVDAGVDMFVIRGTTVSAEHVSSQAEPLNLKEFIYELDVPVIVGGCATHQAALHLMRTGAAGVLVGFGGGAAHTTRTVLGIAVPMASAVADVAAARRDYLDESGGRYVHVIADGSIGTSGDLAKAIACGADAVMVGSPLARATDAPGRGFHWGTEAHHAELPRGQRVGFEPVGTMEEILFGPSRVADGTMNLVGALRRSMATTGYTELKEFQRVEVVLG
>NZ_CP045649.1|WP_153324922.1|3515195_3516698_-|IMP-dehydrogenase
MELPDKFANLGLTYDDVLLLPGHSDLAPSDIDTTTRLTREISLKVPLVSAAMDTVTESRMAIAMARQGGLGVLHRNLSIQDQAYQVDLVKRTQTGIITNPITIGPDATLEQLDQLAGEYRVSGFPVVDADQRLLGIITNRDLRFTPVAEWAGTKVAEVMTPMPLITGPVGISRDDATLLLRQHKRERLPLVDDQGRLAGLITVKDFVKSEQFPKASNDAQGRLMVGAAIGYFGDAWERATTLVEAGVDVLVADTAHGNVRLLLEMVQRLKNDPATRHVQVIGGNVATRDGAQAFVDAGADAVKVGVGPGSICTTRVVTGVGVPQITAVYEASLACKPAGVPVIADGGMKYSGEIAKALVAGADAVMLGSLLAGCEESPGELVFVNGKQFKAYRGMGSLGAMSSRGKKSYSKDRYFQAEVTSDDQIVPEGIEGQVAYRGPLSAVAHQLLGGLTQSMFYVGARTVPELQEKGRFVRITQASLTESHPHGVQMTVEAPNYSGR
>NZ_CP045649.1|WP_153324923.1|3516727_3517639_-|GNAT-family-N-acetyltransferase
MLWRVRTRLPDRPGALAALARACGDAEVNILSLQIFPDLGSVTDELVLRTPQGWGPARVAGLLEGAGGTMLSCAACGEAALVDQPTRYVQAARTVLAEPASFPEVVARLFDAEPDTGADADSADARHQDLLEVSVGGVQVQLRRTAPFTATEHARAASMADLVSDVLQHTHAPGDRTGLPARRLGGGRGPRYVVQADAVSAVRDGLVVGLATLGPASPGQPDARPVSLRVDPAWQRCGIGTRLLVESARLARAQGAAAIVFSTRSDNRAVLPMVLAAGLRGRIRMTADVLTVRVPVRDLTPLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP029356	Azospirillum sp. CFH 70021 plasmid unnamed1	70222-70250	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP021918	Sagittula sp. P11 plasmid unnamed6, complete sequence	33476-33504	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP011275	Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence	16319-16347	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NC_047905	Streptomyces phage Attoomi, complete genome	35943-35971	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP041043	Paracoccus sp. AK26 plasmid pAK3, complete sequence	46762-46790	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_KY000043	Agrobacterium rhizogenes strain CFBP1905 plasmid pTi_CFBP1905, complete sequence	3544-3572	7	0.759
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NC_017585	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence	855701-855729	8	0.724
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP015441	Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence	166690-166718	8	0.724
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP019604	Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence	278641-278669	8	0.724
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NC_016113	Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence	957426-957454	8	0.724
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP038636	Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence	1116962-1116990	8	0.724
NZ_CP045649_1	1.2\|1211914\|29\|NZ_CP045649\|CRISPRCasFinder	1211914-1211942	29	NZ_CP025513	Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence	28278-28306	8	0.724

1. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP029356 (Azospirillum sp. CFH 70021 plasmid unnamed1) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
ggcgttgtcgaccgacgggatggccgtga	Protospacer
.  *.  ************.*********

2. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP021918 (Sagittula sp. P11 plasmid unnamed6, complete sequence) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
caagccctcgaccgacgggctggccacgg	Protospacer
  *** ************* *****..*.

3. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP011275 (Planctomyces sp. SH-PL62 plasmid pPL62-2, complete sequence) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
cgagcgctcgaccgacggcgtgaccttcg	Protospacer
  **************** ***.** * .

4. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NC_047905 (Streptomyces phage Attoomi, complete genome) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
cttgggcttggccgacggggtggccgtgg	Protospacer
 . * ***.*.*****************.

5. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP041043 (Paracoccus sp. AK26 plasmid pAK3, complete sequence) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
tcccggcgcgaccgacggcgtggccgtgg	Protospacer
 *   ** ********** *********.

6. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_KY000043 (Agrobacterium rhizogenes strain CFBP1905 plasmid pTi_CFBP1905, complete sequence) position: , mismatch: 7, identity: 0.759

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
cgatccctcgaccgtcggggtggccgttt	Protospacer
  * * ******** ************

7. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NC_017585 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCATT, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
gttcttctcggccgacggggtggccgaga	Protospacer
..  . ****.*************** **

8. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP015441 (Erythrobacter atlanticus strain s21-N3 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
gatgcgctcgatcgacggcgtggccggcg	Protospacer
.  ********.****** *******  .

9. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP019604 (Croceicoccus marinus strain E4A9 plasmid pCME4A9II, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
gatgcgctcgatcgacggcgtggccggcg	Protospacer
.  ********.****** *******  .

10. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NC_016113 (Streptomyces cattleya NRRL 8057 = DSM 46488 plasmid pSCAT, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
gttcttctcggccgacggggtggccgaga	Protospacer
..  . ****.*************** **

11. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP038636 (Cupriavidus oxalaticus strain X32 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
ccgccgctcgaccgaaggggtggccaaat	Protospacer
 *. *********** *********. .

12. spacer 1.2|1211914|29|NZ_CP045649|CRISPRCasFinder matches to NZ_CP025513 (Neorhizobium sp. SOG26 plasmid unnamed2, complete sequence) position: , mismatch: 8, identity: 0.724

acagcgctcgaccgacggggtggccgtga	CRISPR spacer
ggcccgctcgaccgaggtggtggccgtct	Protospacer
.   *********** * *********

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

83158 : 128191

Gordonia_phage(25.0%)

tRNA,integrase,transposase

attL 111577:111621|attR 131700:131744

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153321539.1\|83158_83902_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_153321540.1\|84825_85224_+	hypothetical protein	NA	NA	NA	NA
WP_153321541.1\|85344_85557_+	hypothetical protein	NA	NA	NA	NA
WP_153321542.1\|85749_86121_-	rhodanese-like domain-containing protein	NA	NA	NA	NA
WP_153325547.1\|86293_86908_+	DUF4396 domain-containing protein	NA	NA	NA	NA
WP_153321543.1\|86900_87767_-	Fpg/Nei family DNA glycosylase	NA	NA	NA	NA
WP_153321544.1\|87946_89140_+	AAA family ATPase	NA	NA	NA	NA
WP_153321545.1\|89164_89944_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_153321546.1\|89955_90888_+	topoisomerase II	NA	NA	NA	NA
WP_153321547.1\|91050_92307_-	arginine deiminase	NA	NA	NA	NA
WP_153321548.1\|92356_93595_-	nickel pincer cofactor biosynthesis protein LarC	NA	NA	NA	NA
WP_153321549.1\|93591_94275_-	nickel pincer cofactor biosynthesis protein LarB	A0A096XTB6	Enterococcus_phage	2.6e-18	44.0
WP_153321550.1\|94308_95148_-	prephenate dehydratase	NA	NA	NA	NA
WP_153321551.1\|95171_95582_+	DUF4446 family protein	NA	NA	NA	NA
WP_153321552.1\|95744_96527_-	hypothetical protein	NA	NA	NA	NA
WP_153325548.1\|96624_98301_-	YegS/Rv2252/BmrU family lipid kinase	A0A1V0SBJ0	Catovirus	1.8e-07	27.5
WP_153321553.1\|98299_99595_+\|tRNA	serine--tRNA ligase	A0A2K9L088	Tupanvirus	6.4e-58	33.3
WP_153325549.1\|99648_100455_+	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_153321554.1\|100451_100937_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_153321555.1\|100933_101785_+	HAD-IIB family hydrolase	NA	NA	NA	NA
WP_153321556.1\|101802_102435_+	hypothetical protein	NA	NA	NA	NA
WP_153321557.1\|102458_103103_-	DUF2587 domain-containing protein	NA	NA	NA	NA
WP_153321558.1\|103351_104329_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_153321559.1\|104358_104685_-	hypothetical protein	NA	NA	NA	NA
WP_153325550.1\|104732_105302_-	NTP transferase domain-containing protein	NA	NA	NA	NA
WP_153325551.1\|105399_106179_+	hydrolase	NA	NA	NA	NA
WP_153321560.1\|106190_107315_+	hypothetical protein	NA	NA	NA	NA
WP_153321561.1\|107354_107582_+	biotin/lipoyl-binding carrier protein	NA	NA	NA	NA
WP_153321562.1\|107808_108282_+	hypothetical protein	NA	NA	NA	NA
WP_153321563.1\|108662_108809_+	hypothetical protein	NA	NA	NA	NA
WP_153321564.1\|109038_110286_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.5e-30	30.5
WP_153321565.1\|110391_111411_-	LuxR family transcriptional regulator	NA	NA	NA	NA
111577:111621	attL	NA	NA	NA	NA
WP_153321566.1\|111635_112070_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_153321567.1\|112062_113307_+\|integrase	tyrosine-type recombinase/integrase	A0A142K956	Gordonia_phage	6.4e-31	30.1
WP_153321568.1\|115061_116138_-	hypothetical protein	NA	NA	NA	NA
WP_153321569.1\|116555_117398_+	hypothetical protein	NA	NA	NA	NA
WP_153321570.1\|117467_118247_+	hypothetical protein	NA	NA	NA	NA
WP_153321571.1\|118411_118879_-	hypothetical protein	NA	NA	NA	NA
WP_153321572.1\|121266_121665_+	hypothetical protein	NA	NA	NA	NA
WP_153321573.1\|121904_122471_+	hypothetical protein	NA	NA	NA	NA
WP_153325552.1\|124465_125730_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	2.0e-24	33.6
WP_153321574.1\|125763_126075_+\|transposase	transposase	NA	NA	NA	NA
WP_153321575.1\|126077_126926_+\|transposase	IS3 family transposase	A0A1B3AZE5	Gordonia_phage	2.5e-42	41.5
WP_153325553.1\|126859_128191_-\|transposase	ISL3 family transposase	A0A2H4PDF8	Mycobacterium_phage	1.4e-193	75.8
131700:131744	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045649

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection