CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045701	Pseudomonas brassicacearum strain S-1 chromosome, complete genome	3 crisprs	PD-DExK,DEDDh,RT,DinG,csa3,cas3,WYL	1	1	6	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045701_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045701_1

1626082-1626215

Orphan

Consensus_repeat	Method
GCTCGAGACTCAAGTGTCTGGGGAAAGATCGCAGCCTCGTTGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045701_1

>merge|NZ_CP045701|1|1626082-1626215|CRISPRCasFinder
GCTCGAGACTCAAGTGTCTGGGGAAAGATCGCAGCCTCGTTGCCCTGTAGGAGCTGGCGAAGCCTGCGATCTTTTGATCTTTTGATCTTTAGCTCGAGACTCAAGTGTCTGAGGAAAGATCGCAGCCTCGTTGC

>NZ_CP045701|1|1|1626082-1626215|CRISPRCasFinder
GCTCGAGACTCAAGTGTCTGGGGAAAGATCGCAGCCTCGTTGC	CCTGTAGGAGCTGGCGAAGCCTGCGATCTTTTGATCTTTTGATCTTTA
GCTCGAGACTCAAGTGTCTGAGGAAAGATCGCAGCCTCGTTGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045701.1\|WP_003198860.1\|1628842_1629220_-\|DUF2892-domain-containing-protein	unknown	unknown	gnl\|CDD\|378561
NZ_CP045701.1\|WP_058543833.1\|1616643_1617567_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176153
NZ_CP045701.1\|WP_116642974.1\|1622758_1623400_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP045701.1\|WP_058543831.1\|1618039_1618972_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP045701.1\|WP_058543827.1\|1623521_1624655_+\|ribonuclease-D	unknown	unknown	gnl\|CDD\|130455
NZ_CP045701.1\|WP_153387787.1\|1629900_1632033_-\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319783
NZ_CP045701.1\|WP_153387786.1\|1626253_1626847_-\|nitroreductase-family-protein	unknown	unknown	gnl\|CDD\|380315
NZ_CP045701.1\|WP_058543822.1\|1631995_1632205_-\|DUF2933-domain-containing-protein	unknown	unknown	gnl\|CDD\|378689
NZ_CP045701.1\|WP_153387788.1\|1633680_1633968_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045701.1\|WP_018607524.1\|1627007_1627457_+\|YcgN-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|235356
NZ_CP045701.1\|WP_064107057.1\|1632918_1633605_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223498
NZ_CP045701.1\|WP_003198862.1\|1629297_1629768_-\|RNA-methyltransferase	unknown	unknown	gnl\|CDD\|349971
NZ_CP045701.1\|WP_003198853.1\|1624651_1624945_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225642
NZ_CP045701.1\|WP_058543829.1\|1621042_1622692_+\|phosphoethanolamine--lipid-A-transferase	unknown	unknown	gnl\|CDD\|183224
NZ_CP045701.1\|WP_058543824.1\|1627488_1628718_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377499
NZ_CP045701.1\|WP_116642975.1\|1619493_1620876_+\|glutamine-synthetase	unknown	unknown	gnl\|CDD\|223252
NZ_CP045701.1\|WP_058543834.1\|1616167_1616359_-\|DUF1508-domain-containing-protein	unknown	unknown	gnl\|CDD\|225956
NZ_CP045701.1\|WP_003184246.1\|1632495_1632870_-\|HNH-nuclease-family-protein	unknown	unknown	gnl\|CDD\|236895
NZ_CP045701.1\|WP_058543832.1\|1617670_1618036_+\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	unknown	unknown	gnl\|CDD\|238324
NZ_CP045701.1\|WP_116642972.1\|1625073_1626006_+\|D-2-hydroxyacid-dehydrogenase	unknown	unknown	gnl\|CDD\|240625

Protein	Function_ID	Function_description	E-value
NZ_CP045701.1\|WP_003198860.1\|1628842_1629220_-\|DUF2892-domain-containing-protein	gnl\|CDD\|378561	pfam11127, DUF2892, Protein of unknown function (DUF2892). This family is conserved in bacteria. The function is not known.	1.48349e-06
NZ_CP045701.1\|WP_058543833.1\|1616643_1617567_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176153	cd08464, PBP2_DntR_like_2, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	8.04383e-67
NZ_CP045701.1\|WP_116642974.1\|1622758_1623400_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	5.03947e-14
NZ_CP045701.1\|WP_058543831.1\|1618039_1618972_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	3.31989e-52
NZ_CP045701.1\|WP_058543827.1\|1623521_1624655_+\|ribonuclease-D	gnl\|CDD\|130455	TIGR01388, Ribonuclease_D, ribonuclease D. This model describes ribonuclease D, a 3'-exonuclease shown to act on tRNA both in vitro and when overexpressed in vivo. Trusted members of this family are restricted to the Proteobacteria; Aquifex, Mycobacterial, and eukaryotic homologs are not full-length homologs. Ribonuclease D is not essential in E. coli and is deleterious when overexpressed. Its precise biological role is still unknown. [Transcription, RNA processing].	3.12998e-140
NZ_CP045701.1\|WP_153387787.1\|1629900_1632033_-\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319783	cd02094, P-type_ATPase_Cu-like, P-type heavy metal-transporting ATPase, similar to human copper-transporting ATPases, ATP7A and ATP7B. The mammalian copper-transporting P-type ATPases, ATP7A and ATP7B are key molecules required for the regulation and maintenance of copper homeostasis. Menkes and Wilson diseases are caused by mutation in ATP7A and ATP7B respectively. This subfamily includes other copper-transporting ATPases such as: Bacillus subtilis CopA , Archeaoglobus fulgidus CopA, and Saccharomyces cerevisiae Ccc2p. This subclass of P-type ATPase is also referred to as CPx-type ATPases because their amino acid sequences contain a characteristic CPC or CPH motif associated with a stretch of hydrophobic amino acids and N-terminal ion-binding sequences. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP045701.1\|WP_153387786.1\|1626253_1626847_-\|nitroreductase-family-protein	gnl\|CDD\|380315	cd02138, TdsD-like, nitroreductase similar to Burkholderia pseudomallei TdsD. A subfamily of the nitroreductase family containing uncharacterized proteins that are similar to Burkholderia pseudomallei TdsD, may be involved in the processing of organosulfur compounds. Nitroreductase catalyzes the reduction of nitroaromatic compounds such as nitrotoluenes, nitrofurans and nitroimidazoles. This process requires NAD(P)H as electron donor in an obligatory two-electron transfer and uses FMN as cofactor. The enzyme is typically a homodimer.	2.17375e-83
NZ_CP045701.1\|WP_058543822.1\|1631995_1632205_-\|DUF2933-domain-containing-protein	gnl\|CDD\|378689	pfam11666, DUF2933, Protein of unknown function (DUF2933). This bacterial family of proteins has no known function.	7.05588e-12
NZ_CP045701.1\|WP_018607524.1\|1627007_1627457_+\|YcgN-family-cysteine-cluster-protein	gnl\|CDD\|235356	PRK05170, PRK05170, YcgN family cysteine cluster protein.	2.37338e-84
NZ_CP045701.1\|WP_064107057.1\|1632918_1633605_-\|hypothetical-protein	gnl\|CDD\|223498	COG0421, SpeE, Spermidine synthase [Amino acid transport and metabolism].	4.60802e-27
NZ_CP045701.1\|WP_003198862.1\|1629297_1629768_-\|RNA-methyltransferase	gnl\|CDD\|349971	cd18098, SpoU-like, SAM-dependent rRNA or tRNA methylase related to SpoU. RNA 2'-O ribose methyltransferase catalyzes the methyltransfer from S-adenosyl-L-methionine (AdoMet) to the 2'-OH group of ribose in tRNA or rRNA. It is part of the SpoU family of MTases, a subfamily of the SPOUT methyltransferase superfamily. The SPOUT methyltransferase superfamily is a large class of S-adenosyl-L-methionine (AdoMet or SAM)-dependent RNA MTases which are structurally characterized by a deep trefoil knot.	7.16027e-65
NZ_CP045701.1\|WP_003198853.1\|1624651_1624945_+\|hypothetical-protein	gnl\|CDD\|225642	COG3100, COG3100, Uncharacterized protein conserved in bacteria [Function unknown].	6.54771e-39
NZ_CP045701.1\|WP_058543829.1\|1621042_1622692_+\|phosphoethanolamine--lipid-A-transferase	gnl\|CDD\|183224	PRK11598, PRK11598, putative metal dependent hydrolase; Provisional.	0
NZ_CP045701.1\|WP_058543824.1\|1627488_1628718_+\|hypothetical-protein	gnl\|CDD\|377499	pfam05299, Peptidase_M61, M61 glycyl aminopeptidase. Glycyl aminopeptidase is an unusual peptidase in that it has a preference for substrates with an N-terminal glycine or alanine. These proteins are found in Bacteria and in Archaea.	0.000270412
NZ_CP045701.1\|WP_116642975.1\|1619493_1620876_+\|glutamine-synthetase	gnl\|CDD\|223252	COG0174, GlnA, Glutamine synthetase [Amino acid transport and metabolism].	1.40358e-142
NZ_CP045701.1\|WP_058543834.1\|1616167_1616359_-\|DUF1508-domain-containing-protein	gnl\|CDD\|225956	COG3422, COG3422, Uncharacterized conserved protein [Function unknown].	2.11866e-15
NZ_CP045701.1\|WP_003184246.1\|1632495_1632870_-\|HNH-nuclease-family-protein	gnl\|CDD\|236895	PRK11295, PRK11295, HNH nuclease family protein.	1.21115e-70
NZ_CP045701.1\|WP_058543832.1\|1617670_1618036_+\|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase	gnl\|CDD\|238324	cd00580, CHMI, 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate. This is one step in the homoprotocatechuate pathway, one of the microbial meta-fission pathways that degrade aromatic carbon sources to citric acid cycle intermediates. Despite the structural similarity of CHMI with 4-oxalocrotonate tautomerase (4-OT) and macrophage migration inhibitory factor (MIF), there is no significant sequence similarity among these protein families, and therefore, they are not combined in one hierarchy.	1.0077e-36
NZ_CP045701.1\|WP_116642972.1\|1625073_1626006_+\|D-2-hydroxyacid-dehydrogenase	gnl\|CDD\|240625	cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase. 2-Hydroxyacid dehydrogenases catalyze the conversion of a wide variety of D-2-hydroxy acids to their corresponding keto acids. The general mechanism is (R)-lactate + acceptor to pyruvate + reduced acceptor. Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxyacid dehydrogenase superfamily include groups such as formate dehydrogenase, glycerate dehydrogenase, L-alanine dehydrogenase, and S-adenosylhomocysteine hydrolase. Despite often low sequence identity, these proteins typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann fold NAD+ binding form. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomains but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric. Formate dehydrogenase (FDH) catalyzes the NAD+-dependent oxidation of formate ion to carbon dioxide with the concomitant reduction of NAD+ to NADH. FDHs of this family contain no metal ions or prosthetic groups. Catalysis occurs though direct transfer of the hydride ion to NAD+ without the stages of acid-base catalysis typically found in related dehydrogenases. FDHs are found in all methylotrophic microorganisms in energy production and in the stress responses of plants.	2.64773e-108

>NZ_CP045701.1|WP_116642972.1|1625073_1626006_+|D-2-hydroxyacid-dehydrogenase
MRVLIAEHDHPVYAQLLRQAAPDIEVLTSGDSAELSRLATDCPVWLGQPDLLATLLRQGHRPNWLQSTWAGITPLLAEGLTRNYRLTRAVGIFGQVMAEYVLAYMLGHEREVLARLVSQVERKWDNRQGQSLAGRKVLIVGTGDIGQRVAQFLVPFGVQLYGVAREARALAPFIEVGALKDLPRLVGEVDYVINLLPNTPDTHDVYDAALFKQFKPTGLFINVGRGVAVVDADLVQALKDGHLAGAVIDVCRQEPLPQRHPFWTAWGLLLTGHSSAPTSPPMMVQLFLENLRAYQAGDALRGEVDFSRGY
>NZ_CP045701.1|WP_003198853.1|1624651_1624945_+|hypothetical-protein
MKRICSIYRSSKKNEMYLYVLKSDALERVPEPLMAAFGKAIHAFDLVLSPERALSREDINKVLENLDTQGYHLQMPPAEDEYIEHLPEELLRRNDPV
>NZ_CP045701.1|WP_058543827.1|1623521_1624655_+|ribonuclease-D
MAIDIHWIRDNDSLGQFCAEWQQLPFVALDTEFMRVDTFYPIAGLLQIGDGKRAYLIDPLTIDNWQPLAALLENPAVLKVLHACSEDLEVLLRLTGSLPAPLFDTQLAAAYLNLGFSMGYSRLVQEVLGIELPKGETRSDWLQRPLSETQISYAAEDAVHLAEVFVLLRPKLCDEKYRWVLEDGAELVANLRREVDPYEVYREAKLAWKLSRAQLAVLRELCAWREREARARDLPRNRIIREHSLWPLARTQPDNLGALAKIEDMHPRTVRQDGQFLLDLIQRAASVPPEQWPPAVAEPLPIEASALVKRLRALGQAEAERLEIAPELMLRKKTLEALIKSGFPEGPYQLPDSLRGWRRELMGQALLDSLATAGEQP
>NZ_CP045701.1|WP_116642974.1|1622758_1623400_+|class-I-SAM-dependent-methyltransferase
MSGLPPSTVELEFARQHDQEHAQVCCRPAPRRLRLAFWRDEHMVRNALKVAGEPGLVLDVACGAGRFWPVLAEHANRVILAADPSPDMLEHALTHHGGALLQRVKTFPSSAFTIGLSANAVDCICCLQLFRHVGASEHRLALLREFHRVSRDTVIVSVQIEGRLKIGQAPRRSLADKADVEAEFRQAGFSVLWYQDFLPGFALTRVYVLRKTG
>NZ_CP045701.1|WP_058543829.1|1621042_1622692_+|phosphoethanolamine--lipid-A-transferase
MLTIKAVRPEWVTLVASAFLLMGFNIVLWQHLLAITTADARGLLMCVAFGLMIICAFNLVLTLVAFRPLLKPVLMLLFLISAGVAYFMGQYGVLIDTGMLRNFAETNATEVRDLLSLKLFVYIGLLGVLPCWLLFKTPINYRRWPKELLSKLLVGVASVAVIGVVALANYQGLSSLFRNHHELRLMVVPSNYIGASFGYLREQVASAKQPFTKLGEDASRNPIWQTHGRKSLTVLVVGESARAENFGILGYNRDTTPTLNKEAGLIAFTDVQSCGTETAVSVPCMFSNMGRKNYDASIAKNEEGLLDVLKRAGLEVIWRDNQSGCKGTCDRVTVQDMSNLKDPALCASSECRDEILLQGLQHFIDTLDKDTVLVLHQMGSHGPEYFKRYPKEYEHFTPVCESNALNNCSRESIVNGYDNTLVYTDHVLSTLIDLLRANQDKVDTAMLYLSDHGESLGEYNLFLHGTPYMLAPEQQKHVAMLAWFSDSYQKAFSVDTHCLQLSREKPLSQDNLFHSMLGLLEVNSQVYNRDLDLFANCRGAVIDGVLARQ
>NZ_CP045701.1|WP_116642975.1|1619493_1620876_+|glutamine-synthetase
MSLAKFSFAPVQHAQAFLAQNPDIELFELFILDNNGVPRGKLLHREELLAVFESGRPLPSTILGLTINGDDVENSGLVWDVGDIDCRAYPLSGSLQRMPWRLIPTAAVQVSMHPQEGMPATIADPRYLLSQVIEALQADGYYPVMAAELEFYLLDAQRDSQGRPQPARDADGGRPRATQVYGLRELEQIEPFLADLYTACKLQGIAARTAISEYAPGQVEITLEHRSDALQAMDEAVRYKRLVKGVAHKHGMQACFMAKPFDHLAGSGMHMHVSLADRDGHNLFASEAADGTPLLRQAVGGMLDTLLDSLLMFCPNANSYRRFQSNSYAPLAATWGVDNRTVSLRVPGGPAFSRHIEHRICGADANPYLAAAAILAGIHRGLREQCDPGKPVEGNGYAQATELLPTDWLTTLRALEASAWAREAFGDEFLGVYLAVKRAEYRQFMGEVGEQDWRWYLNQA
>NZ_CP045701.1|WP_058543831.1|1618039_1618972_-|LysR-family-transcriptional-regulator
MLNSNSLRKLDMQDLMVFSAVYEQSSVTGVSEALCVSQSTVSYCLKKLRTCFEDELFINTRTGMRPTYKAEGMYDHVRAILQSINLCHAGTPTFDPTRQAITFNICAPEYFEQLILPQLLQGFDYANLPVVVNVHKLEADIPAEELRDGSLDLVICFGPNFHSNHADFKSRQLLEEDLVCVVDKRATPLEPQLSLQSFVRRRHVFPTPWSSATNMVDGWLSQQAHQRQIAARANSYSAALKMITGTDFILTLPRRIQKLLANEAIFNHHEVPQGLPGFTLNMQWSLAVDQDSANAWLREQIIKACAARDT
>NZ_CP045701.1|WP_058543832.1|1617670_1618036_+|5-carboxymethyl-2-hydroxymuconate-Delta-isomerase
MPHLHMEYTANLPELKADVALLRLNNALVASGQFAAELDIKSRAVKLETFRVGTGLGERGFVHVKLALLSGRSLEVKKQLADSLLAVIQELGPWPADVSVQLCVEILDIDRGPYAKALIGQ
>NZ_CP045701.1|WP_058543833.1|1616643_1617567_+|LysR-family-transcriptional-regulator
MNRNELRKADINLMVVFETLMLERNVTRVAEKLFLGQPTISSALNRLRKMFNDPLFIRVGHRMEPTARAEEIIRHLSPALDSLSVALSLTHDFDPTSSTMTFRIGLSDDVEFGLLPPLLSSLRQEAPQIVFVVQHVDYWRIPDLLASGDITVGISQTRGLPANAKRKLLRHIEPRVLRADVSDTPLTLDEYCARPHVLVSHTANVAGFADEWLAEIGRTRQVVLSVPQYSALPALLAGTDLIASLPDYTAAAMAASGQLFNEPFPFKTPTLDLSMVWLSHVDSDPAERWLRSRLEAFMGERVVSAQA
>NZ_CP045701.1|WP_058543834.1|1616167_1616359_-|DUF1508-domain-containing-protein
MYFEIYRQTRGTPNTGKGQWRWRLRAGNHETIASGESYVNKSDCLHVIGLIKNVQGETPVKEI
>NZ_CP045701.1|WP_153387786.1|1626253_1626847_-|nitroreductase-family-protein
MSANPRIADYAIHPQFIERWSPRAFNGQAIAEETLLGFFEAARWAPSAYNSQPWRFLYARRDTPNWERFLGLLNEFNRGWAQHASALVIIVSKTTFAVPGATEETPAQSHTFDTGAAWGHLALQASLSGWHTHGMAGFDHELTRKELKIPQGYALHAAVAIGKLGDKSTLAEYLQARETPSPRRPLSELVAEGDFSL
>NZ_CP045701.1|WP_018607524.1|1627007_1627457_+|YcgN-family-cysteine-cluster-protein
MAAKVEPFWKRKTLDQLDLQEWESLCDGCGLCCLQKLEDEDDNSVYYTRIACKLLDLKTCQCTDYPNRRDFVPDCIQLTPGKADEFKWLPPTCGYRLVSEGKDLPLWHHLVCGDRDAVHHERISQSGRMLAEGSVPEDDWEDHLIFRAG
>NZ_CP045701.1|WP_058543824.1|1627488_1628718_+|hypothetical-protein
MAAGLKRTLAAGLLAMGGPLWAAQKVDLDYHVHLLPQSDQAEVRLTLARGSAVRSLDFDLGDGSRYSDFKADGQWQLTPGKEVRGVWRPAANKASLSYRVRISHARKNATFETRMTPMWALLRGDDLVPSAKLDQQDGVELVARLDVELPAGWKSIETPWPRIGKQRFRIDNPSRLFDRPTGWMLAGKLGSRRTRLGETEVTVASPQRQGMRRMDVLTLLTFVWPQVQALVPRHPSKLLIVGGGDPLWRGAQAGHDSIYLHSRPPLVSERGSSPLLRELVQALARVNDQDRSDWISEGLTEYYAIELLRRAGGLSDERYQTLNDRLARDSKGVTTLRGEQISTAAVAKAVLLLQELDREIRLKTHNKRSLDDVLQGAMRLETVDTQEFVQLSESVLGGGSSVLDTQLLQ
>NZ_CP045701.1|WP_003198860.1|1628842_1629220_-|DUF2892-domain-containing-protein
MSDNNPFEPIETTPFQSHPPQNVHGWERIGSLAGGVLMMGKGLRRGGVLGLAQLAIGGMALARGITGHCSAKALLEKNRQNLSNARARIEQAGDELSRLKANAEAATGTATVTGNDSLDSPKVGL
>NZ_CP045701.1|WP_003198862.1|1629297_1629768_-|RNA-methyltransferase
MANKRYSCIGLFNPKSPENVGSVMRAAGCYGVASVFYTGKRYERAADFVTDTKKVHYDIPLIGIDDLKKILPLGCVPVAVELVEGARPLPEYTHPDRALYIFGPEDGSLDKDIRDWCEDVVYIPTTGCMNLAATVNVVLYDRMAKGNNTRSGPQFR
>NZ_CP045701.1|WP_153387787.1|1629900_1632033_-|heavy-metal-translocating-P-type-ATPase
MSSGTDTDDMATEYTCPMHPEIRQPGPGTCPKCGMTLEPVMPALEEEDNPELKDFTRRFWWSLPLTVIVTVLAMAGHALSLFHGEMQNFVEFFLATPVVLWAGWPFFVRAVVSVRQRSPNMWTLIGLGTAAAYLYSVAATFWPGGFPATFLQEGRIGVYFEAAAVIISLTLLGQMLELKARSQTSAAIKSLLGLSPKTARRINADGQEQDIPLAHVHQGDRLRIRPGEKVPVDGAVLEGESAVDESMLTGEPVSVIKRAGDSLIGATINTHGSLVMTAQKVGAETVLAQIVQMVARAQRSKAPMQRMADVIAGYFVMGVIAIAVLTFFGWGLLGPEPGWVFGLINAVAVLIIACPCALGLATPMSIMVSTGKAASLGVLFRDASAIENLCKIDTLIVDKTGTLTEGRPAFHSVEATQGFDDRQVLLLATSLDQGSEHPLAHAIVDHARSEQLELIKPASFESGSGIGVSGQVDGKQVHLGNTALMNAAHISVSPLQQQAEQLRAQGISIIYMAVDGVLAGLLAVSDPIKPTSREAVNRLKAHDIKIIMATGDGLTTARAVAREMGIEEVHGEVKPEDKERLVADLQRDGRQVAMAGDGINDAPALARADVGIAMGTGTDVAMNSAQLTLVKGDLMGILRARTLSVATVRNMRQNLGFAFLYNSMGIPLAAGLLYPLTGHLLSPMIAAIAMSVSSASVVFNALRLRNASVE
>NZ_CP045701.1|WP_058543822.1|1631995_1632205_-|DUF2933-domain-containing-protein
MNTHQPPVAGATSFWRGKTGIVLIMLLVIGLFYLVREHFSHITANWPYLILLICPLMHVFGHGHGRHGD
>NZ_CP045701.1|WP_003184246.1|1632495_1632870_-|HNH-nuclease-family-protein
MSSSTPPSNTAKLDRILADAQRDREMGYRDKALKMYPHVCGRCAREFSGKRLSELTVHHRDHNHDNNPQDGSNWELLCLYCHDNEHSRYTDQQYFGDGSLSTPKIAKATHNPFAALAGLMKKDE
>NZ_CP045701.1|WP_064107057.1|1632918_1633605_-|hypothetical-protein
MKRFVLLDTTPIPDNGGALCLFEYGDDFVIKIQGGDGGQLMNTRMHGSEDALAEIPCRKVAGRPGSRVLIGGLGMGFTLASALKHLGKTAEVVVAELVPGVVEWNRGPLGEKAGRPLSDPRTVIRMEDVAKVLQAEPQGFDAIMLDVDNGPEGLTQKANSWLYSAGGLAACAKALRPKGVLAVWSASADRQFSDKLKKAGFKAEEVQVFAHGNKGTRHTIWIAEKLKG
>NZ_CP045701.1|WP_153387788.1|1633680_1633968_+|hypothetical-protein
MKCLILTAIGLAALSLSCAQAQQPTIPVNPPSIPGSPGTATPMPYPPVTPNSVPKAGPGSGGPPLLPPIEMPKPPKDQPIPGMEPKPVKAKSPGG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045701_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045701_2

2021698-2021808

Orphan

Consensus_repeat	Method
GCGAGGCGGCCTAACAGCCGGCCTGGCTCTCCCGGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045701_2

>merge|NZ_CP045701|2|2021698-2021808|CRISPRCasFinder
GCGAGGCGGCCTAACAGCCGGCCTGGCTCTCCCGGTCGTACACCCATCCGATCTGTGGGAGCAAAGCTTGCTCGCGAGGCGGCCTAACAGCCGGCCTGGTTCTCCCGGTCG

>NZ_CP045701|2|2|2021698-2021808|CRISPRCasFinder
GCGAGGCGGCCTAACAGCCGGCCTGGCTCTCCCGGTCG	TACACCCATCCGATCTGTGGGAGCAAAGCTTGCTC
GCGAGGCGGCCTAACAGCCGGCCTGGTTCTCCCGGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045701.1\|WP_153387891.1\|2033838_2034858_+\|quinone-dependent-dihydroorotate-dehydrogenase	unknown	unknown	gnl\|CDD\|235388
NZ_CP045701.1\|WP_003223300.1\|2035185_2035401_-\|ribosome-modulation-factor	unknown	unknown	gnl\|CDD\|377425
NZ_CP045701.1\|WP_014337331.1\|2018431_2018677_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045701.1\|WP_153387887.1\|2022694_2025412_-\|molybdopterin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|239155
NZ_CP045701.1\|WP_153387889.1\|2028661_2030332_-\|protein-kinase	unknown	unknown	gnl\|CDD\|270916
NZ_CP045701.1\|WP_153387888.1\|2025725_2028179_-\|nitrite-reductase-large-subunit	unknown	unknown	gnl\|CDD\|224171
NZ_CP045701.1\|WP_153387890.1\|2030341_2031553_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|225133
NZ_CP045701.1\|WP_058544719.1\|2032394_2033606_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|372585
NZ_CP045701.1\|WP_003199517.1\|2016855_2017347_+\|putative-4-hydroxy-4-methyl-2-oxoglutarate-aldolase	unknown	unknown	gnl\|CDD\|236487
NZ_CP045701.1\|WP_058542368.1\|2021928_2022684_-\|uroporphyrinogen-III-C-methyltransferase	unknown	unknown	gnl\|CDD\|235711
NZ_CP045701.1\|WP_064106901.1\|2013195_2015571_+\|phosphoenolpyruvate-synthase	unknown	unknown	gnl\|CDD\|235809
NZ_CP045701.1\|WP_042729583.1\|2019595_2020186_+\|RNA-polymerase-sigma-factor-SigX	unknown	unknown	gnl\|CDD\|236603
NZ_CP045701.1\|WP_058542371.1\|2017372_2018368_+\|zinc-transporter-ZntB	unknown	unknown	gnl\|CDD\|213367
NZ_CP045701.1\|WP_153387886.1\|2015739_2016729_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|378820
NZ_CP045701.1\|WP_058542369.1\|2020293_2021328_+\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|368587
NZ_CP045701.1\|WP_058544713.1\|2025411_2025729_-\|nitrite-reductase-small-subunit-NirD	unknown	unknown	gnl\|CDD\|239606
NZ_CP045701.1\|WP_058544718.1\|2031803_2032379_-\|ANTAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|226230
NZ_CP045701.1\|WP_014337326.1\|2012192_2013011_-\|kinase/pyrophosphorylase	unknown	unknown	gnl\|CDD\|235419
NZ_CP045701.1\|WP_028237696.1\|2011778_2012006_+\|MbtH-family-protein	unknown	unknown	gnl\|CDD\|225790
NZ_CP045701.1\|WP_058542370.1\|2018679_2019504_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|377524

Protein	Function_ID	Function_description	E-value
NZ_CP045701.1\|WP_153387891.1\|2033838_2034858_+\|quinone-dependent-dihydroorotate-dehydrogenase	gnl\|CDD\|235388	PRK05286, PRK05286, quinone-dependent dihydroorotate dehydrogenase.	0
NZ_CP045701.1\|WP_003223300.1\|2035185_2035401_-\|ribosome-modulation-factor	gnl\|CDD\|377425	pfam04957, RMF, Ribosome modulation factor. This protein associates with 70s ribosomes and converts them to a dimeric form (100S ribosomes) which appear during the transition from the exponential growth phase to the stationary phase of Escherichia coli cells.	6.49519e-24
NZ_CP045701.1\|WP_058544718.1\|2031803_2032379_-\|ANTAR-domain-containing-protein	gnl\|CDD\|226230	COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms].	7.557e-63
NZ_CP045701.1\|WP_153387887.1\|2022694_2025412_-\|molybdopterin-dependent-oxidoreductase	gnl\|CDD\|239155	cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite. Monomeric Nas is located in the cytoplasm and participates in nitrogen assimilation. Dimeric Nap is located in the periplasm and is coupled to quinol oxidation via a membrane-anchored tetraheme cytochrome. Members of the MopB_Nitrate-R-NapA CD belong to the molybdopterin_binding (MopB) superfamily of proteins.	0
NZ_CP045701.1\|WP_153387889.1\|2028661_2030332_-\|protein-kinase	gnl\|CDD\|270916	cd14014, STKc_PknB_like, Catalytic domain of bacterial Serine/Threonine kinases, PknB and similar proteins. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This subfamily includes many bacterial eukaryotic-type STKs including Staphylococcus aureus PknB (also called PrkC or Stk1), Bacillus subtilis PrkC, and Mycobacterium tuberculosis Pkn proteins (PknB, PknD, PknE, PknF, PknL, and PknH), among others. S. aureus PknB is the only eukaryotic-type STK present in this species, although many microorganisms encode for several such proteins. It is important for the survival and pathogenesis of S. aureus as it is involved in the regulation of purine and pyrimidine biosynthesis, cell wall metabolism, autolysis, virulence, and antibiotic resistance. M. tuberculosis PknB is essential for growth and it acts on diverse substrates including proteins involved in peptidoglycan synthesis, cell division, transcription, stress responses, and metabolic regulation. B. subtilis PrkC is located at the inner membrane of endospores and functions to trigger spore germination. Bacterial STKs in this subfamily show varied domain architectures. The well-characterized members such as S. aureus and M. tuberculosis PknB, and B. subtilis PrkC, contain an N-terminal cytosolic kinase domain, a transmembrane (TM) segment, and mutliple C-terminal extracellular PASTA domains. The PknB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	6.96371e-53
NZ_CP045701.1\|WP_153387888.1\|2025725_2028179_-\|nitrite-reductase-large-subunit	gnl\|CDD\|224171	COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion].	0
NZ_CP045701.1\|WP_153387890.1\|2030341_2031553_-\|MFS-transporter	gnl\|CDD\|225133	COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism].	6.52809e-118
NZ_CP045701.1\|WP_058544719.1\|2032394_2033606_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|372585	pfam13379, NMT1_2, NMT1-like family. This family is closely related to the pfam09084 family.	5.80281e-123
NZ_CP045701.1\|WP_058542370.1\|2018679_2019504_+\|mechanosensitive-ion-channel	gnl\|CDD\|377524	pfam05552, TM_helix, Conserved TM helix. This alignment represents a conserved transmembrane helix as well as some flanking sequence. It is often found in association with pfam00924.	3.15151e-08
NZ_CP045701.1\|WP_058542368.1\|2021928_2022684_-\|uroporphyrinogen-III-C-methyltransferase	gnl\|CDD\|235711	PRK06136, PRK06136, uroporphyrinogen-III C-methyltransferase.	1.21148e-134
NZ_CP045701.1\|WP_064106901.1\|2013195_2015571_+\|phosphoenolpyruvate-synthase	gnl\|CDD\|235809	PRK06464, PRK06464, phosphoenolpyruvate synthase; Validated.	0
NZ_CP045701.1\|WP_042729583.1\|2019595_2020186_+\|RNA-polymerase-sigma-factor-SigX	gnl\|CDD\|236603	PRK09640, PRK09640, RNA polymerase sigma factor SigX; Reviewed.	1.87273e-120
NZ_CP045701.1\|WP_058542371.1\|2017372_2018368_+\|zinc-transporter-ZntB	gnl\|CDD\|213367	cd12833, ZntB-like_1, Salmonella typhimurium Zn2+ transporter ZntB-like subgroup. A bacterial subgroup belonging to the Escherichia coli CorA-Salmonella typhimurium ZntB_like family (EcCorA_ZntB-like) of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes. This subgroup includes the Zn2+ transporter Salmonella typhimurium ZntB which mediates the efflux of Zn2+ (and Cd2+). Structures of the intracellular domain of Vibrio parahaemolyticus and Salmonella typhimurium ZntB form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA, and Mrs2p. Natural variants such as GVN and GIN, which occur in proteins belonging to this subfamily, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	2.74624e-116
NZ_CP045701.1\|WP_153387886.1\|2015739_2016729_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|378820	pfam12146, Hydrolase_4, Serine aminopeptidase, S33. This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. It is found in association with pfam00561. The majority of the members in this family carry the exopeptidase active-site residues of Ser-122, Asp-239 and His-269 as in UniProtKB:Q7ZWC2.	1.47984e-13
NZ_CP045701.1\|WP_058542369.1\|2020293_2021328_+\|OmpA-family-protein	gnl\|CDD\|368587	pfam05736, OprF, OprF membrane domain. This domain represents the presumed membrane spanning region of the OprF proteins. This region is involved in channel formation and is thought to form an 8-stranded beta-barrel.	5.86714e-98
NZ_CP045701.1\|WP_058544713.1\|2025411_2025729_-\|nitrite-reductase-small-subunit-NirD	gnl\|CDD\|239606	cd03530, Rieske_NirD_small_Bacillus, Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain. The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer. Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium.	1.36337e-55
NZ_CP045701.1\|WP_014337326.1\|2012192_2013011_-\|kinase/pyrophosphorylase	gnl\|CDD\|235419	PRK05339, PRK05339, pyruvate, phosphate dikinase/phosphoenolpyruvate synthase regulator.	2.05461e-131
NZ_CP045701.1\|WP_028237696.1\|2011778_2012006_+\|MbtH-family-protein	gnl\|CDD\|225790	COG3251, COG3251, Uncharacterized protein conserved in bacteria [Function unknown].	2.33475e-33
NZ_CP045701.1\|WP_003199517.1\|2016855_2017347_+\|putative-4-hydroxy-4-methyl-2-oxoglutarate-aldolase	gnl\|CDD\|236487	PRK09372, PRK09372, ribonuclease E inhibitor RraA.	9.33748e-110

>NZ_CP045701.1|WP_058542369.1|2020293_2021328_+|OmpA-family-protein
MKLKNTLGFAIGSLIAATSFGALAQGQGAVEIEGFAKKEMFDSARDFKNNGNLFGGSVGYFLTDDVELRLAYDEVHNARTDDGTNVKGANTALDALYHFNNPGDMLRPYVSAGFSDQSIDQNGSNGRNRSTFANVGGGAKLYFTDNFYARAGVEAQYNIDQGDTEWAPSVGIGVNFGGGSKPAAAPVPAPAEVCSDSDNDGVCDNVDKCPDTPANVTVDADGCPAVAEVVRVELDVKFDFDKSVVKENSYGDIKNLADFMKQYPSTSTTVEGHTDSVGPDAYNQKLSERRANAVKQVLTNQYGVESSRVQSVGYGESRPVADNATEAGRAVNRRVEAQVEAQAK
>NZ_CP045701.1|WP_042729583.1|2019595_2020186_+|RNA-polymerase-sigma-factor-SigX
MNKPQSLSTRYDPRDLSDEELVARAHTELFHVTRAYEELMRRYQRTLFNVCARYLGNDRDADDVCQEVMLKVLYGLKNFEGKSKFKTWLYSITYNECITQYRKERRKRRLMDALSLDPLEEASEEKAPKPEEKGGLDRWLVHVNPIDREILVLRFVAELEFQEIADIMHMGLSATKMRYKRALDKLREKFAGIAET
>NZ_CP045701.1|WP_058542370.1|2018679_2019504_+|mechanosensitive-ion-channel
MELDLWTQSLVTAMTALWTKIANFIPNLFGALVVLLLGFVVAKLLDTLLSKLLAKLGLDRLMGGTGLTKLLSRGGIQVPISTLVGKIVYWFVLLIFLVSAAESLGLERVSATLDMLALYLPKVFGAALVLLVGVLLAQLANGLVRGAAEGVGLEYAAGVGRIAQGLVIIISISVAISQLEVKTDLLNHVIVIVLITVGLAVALAMGLGSREIAGQILAGIYVRELYEVGQQVRVGEVEGQIEEIGTVKTTLLTEEGELVSLSNRILLEQHVSSR
>NZ_CP045701.1|WP_014337331.1|2018431_2018677_+|hypothetical-protein
MHDPFEQSLRDMLKASPSSRDDDACLGRVLKTANRQVGAGDLFSLLGRWLPALMIALNNGSAHVSPVSRRKPVTRTADKAD
>NZ_CP045701.1|WP_058542371.1|2017372_2018368_+|zinc-transporter-ZntB
MFEEENAQWGLVHALVLDGKGGARSIARTELDDLQLQAHESLWLHWDRSHPQTHTWLRKSSGLSEFNCDLLLEENTRPRLLPLPNAELLLFLRGINLNPGAEPEDMVSVRIFASAQRVISLRLRPLRATDELLAQLAEGKGPKTASELILYMAQYLTNKVQDLVTCLCEIVDDEEEKLDTDERYTPEHDAILHIRRRAAGLKRFLAPQRDIFGQMTRLKLPWFCDDDGDYWNELNNSLTRYLEELELTRERVGLVLEAEDRRLSVRMNRTMYRFGIVTGIFLPMSFLTGLLGINVGGIPFSASPYGFMVACLLMICVALGQWWLFRRLRWV
>NZ_CP045701.1|WP_003199517.1|2016855_2017347_+|putative-4-hydroxy-4-methyl-2-oxoglutarate-aldolase
MNHYLTPDLCDAYPELVQVLEPMFSNFGGRDSFGGEIVTIKCFEDNSRVKEQVELKGNGKVLVVDGGGSLRRALLGDMLAEKAAKNGWEGLVVYGCIRDVDIIAQTDLGVQALASHPMKTDRRGVGELNVPVTFAGVTFRPGEYVYADNNGVIVSPSPLKMPE
>NZ_CP045701.1|WP_153387886.1|2015739_2016729_+|alpha/beta-fold-hydrolase
MQSSSNLFPVALISAELRGDLSEDVYRLKPGNSPDYSVELAVTRLGMADACETRGVPVILLHGSFSNRRFWYSPKGMGLGAYLARLGFDVWIPEMRGHGLSQRNQAYRNNRVADYARYDLPAIGAFVREQSGQVPHWIGHSLGGITLAAALGGHYLGEPAVASAAFFGTQVSRTYWPLKIPPVEWSGRFILKRFAQLSGSRLKRGPEDEPIGLALESMRWYGLFGRFGDAEKNWWAGLADVQLPVLAVSAAGDHQDPTWACRKLFEQIGSEHKQFVCLGRGQGFTNDFGHVEMLVSKAAHLEVWPLVARWLKDQQAPLLAERSPLAEAV
>NZ_CP045701.1|WP_064106901.1|2013195_2015571_+|phosphoenolpyruvate-synthase
MVEYVVSLDKLGVHDVEHVGGKNASLGEMISNLAGAGVSVPGGFATTAQAYRDFLELSGLNKQIHDALDALDVDDVNALAKTGAQIRQWIMEAEFPEKLNAEIRTAFAKLSEGNPDIAVAVRSSATAEDLPDASFAGQQETFLNIRGVENVIRAAKEVFASLFNDRAISYRVHQGFDHKLVALSAGVQRMVRSETGTAGVMFTLDTESGFRDVVFITGAYGLGETVVQGAVNPDEFYVHKGTLQAGRPAILRRNLGSKAIKMVYGDEAKAGRSVKTVDVDKAERARFCLTDAEVSELAKQAMIIEQHYKCPMDIEWAKDGDDGKLYIVQARPETVKSRTQANVMERYLLKETGTVLVEGRAIGQRIGAGKVRIIKDVSEMDKVQAGDVLVSDMTDPDWEPVMKRASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLKDGQGVTVSCAEGDTGYIFEGELGFDIKKNSVDAMPDLPFKIMMNVGNPDRAFDFAQLPNAGVGLARLEFIINRMIGVHPKALLNYDGLPQEIKDSVDKRIAGYNDPVGFYVEKLVEGISTLAAAFWPKKVIVRLSDFKSNEYANLIGGKLYEPEEENPMLGFRGASRYISESFRDCFELECRALKRVRNEMGLTNVEIMVPFVRTLGEASQVVDLLAENGLARGDNGLRVIMMCELPSNAILAEEFLEFFDGFSIGSNDLTQLTLGLDRDSGIIAHLFDERNPAVKKLLANAIAACNKAGKYIGICGQGPSDHPDLAKWLMEQGIESVSLNPDSVLETWFFLAEGQAAV
>NZ_CP045701.1|WP_014337326.1|2012192_2013011_-|kinase/pyrophosphorylase
MKRSAFFISDGTGITAETLGQSLLAQFENITFAKFIRPYIDNVDKARAMVQQINKAAETDGFRPIIFDTIVNQDIREILATSNGFMIDIFSTFLAPLEQELSEHSSYSVGKSHSIGHNSNYMERIEAVNFALDNDDGARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDMERLQLPSALRAHQHKLFGLTIDPDRLTAIRNERKPNSRYSSYAQCEFEVREVENLFRRENIPHINSTHFSVEEISAKILVEKGVERRFK
>NZ_CP045701.1|WP_028237696.1|2011778_2012006_+|MbtH-family-protein
MTSVFDREDIVFQVVVNHEEQYSIWPDYKAVPEGWRTVGKSGFKKECLAYIEEVWTDMRPLSLRKKMEEQAAVAH
>NZ_CP045701.1|WP_058542368.1|2021928_2022684_-|uroporphyrinogen-III-C-methyltransferase
MNAKVWLVGAGPGDPELMTLKAVRALGEADVVLIDDLVNAAVLEHCPDARIIAVGKRGGCRSTPQAFIHRLMLRYARQGKCVVRLKGGDPCIFGRGGEEAQWLREQGVEVEMVNGITAGLAGATQCDIPLTLRGIARGVTLVTAHTQDGSSLNWQALAQSGTTLVVYMGVAKLSEIREQLLAGGLAADTPVAMIENASLPHQRDCRSDLASMEGDASAFQLKSPAILVIGAVAGAAELAATPSAWGQVSAL
>NZ_CP045701.1|WP_153387887.1|2022694_2025412_-|molybdopterin-dependent-oxidoreductase
MNRQITASTCCYCGVGCGVLIEHDGERILGVSGDPAHPANFGKLCSKGSTLHLTGDLAARALYPELRLGKGLARARTGWDSALDHAASVFAETIAEHGPDSVAFYISGQLLTEDYYAFNKLARALVGTNNIDSNSRLCMSSAVVGYKRSLGADAPPCSYEDLELSDCVMIVGSNMAYAHPILFRRLEEAKSRRPQMKIIVIDPRRTDTCDLADLHLAILPGTDVALFHGILHLLLWEDWVDRDFIKAHTEGLAELKNLVRDYTPTMVAQLCGISVEHLHQCAEWVGTSPSFLSLWCMGLNQSTAGSAKNSALINLHLAMGQIGRPGAGPFSLTGQPNAMGGRETGSLSNLLPGHREAANPEHRAEVAHYWGVEQLPASTGLSAIELFEQVRSGKIKALWIACTNPAQSMPDQTAVREALQSCPFVVLQEAFRTTETAAFADLLLPAASWGEKEGSVTNSERRISHVRRAINAPGEARADWAITVDFAQRLEKRLRPGQPSLFAFESPAQLFDEYKQLTRGRDLDLSGISHALIDELGPQQWPFPDGATVGTARLYVDGIFPTDSGRARFVADPYRAAKELRDARYPLTLNTGRLRDQWHGMSRTGTAAQLFGHVNEAVLSLHPDELQRHRLQAGDLVNLKSRRGSVIVAVDSDDSVRPGQAFLPMHWGDRFLKGGVNTLTQPAFDPLSKQPELKHSGVRLEPVDLPWQLFALIEGDVQQHLEALRPLCEAFSYVSLSLTGRERPALLIRAASAIAPQPQLLQAIDEQLGLIDGPVLAYDDPRRSIGKRVRIENGRITAIRLAGETLARHWLQSLWLEGRADEQLRRWLLAPLSAPPGNVGAATGGSKTLCNCMNVSQRAICAGIERGLDLQGLKQELGCGTQCGSCVPEIKRLLVATAQPLAAIS
>NZ_CP045701.1|WP_058544713.1|2025411_2025729_-|nitrite-reductase-small-subunit-NirD
MNWLDICALEDINILGSRIINGPKGDIAIFRTSDDEVFALDDRCPHKGGPLSQGLVYGKRVACPLHNWQIDLETGQAQAPDVGCAHHHSARVENGRVQLALRDAS
>NZ_CP045701.1|WP_153387888.1|2025725_2028179_-|nitrite-reductase-large-subunit
MKKLKLVMIGNGMAGVRTLEELLKLSNELYDITVFGAEPHTNYNRILLSPVLAGEQTFEEIVLNDLSWYLDNNIKLLLNRKVVEIDRVKRRVIAEDGSEAEYDRLLIATGSTPFILPIPGNTLEGVIGYRDIADTQAMINTAKTHKHAVVIGGGLLGLEAANGLKLRGMDVTVVHLGEWLLERQLDKTSGQLLQTALENRGLKFRLSEQTQALHDAGNGRVGSVQFKNGDIIPADLVVMAAGIRPNTELAEKSGIPCNRGILVNDTMQTYDPRIYAIGECASHRGTAYGLVAPLFEQAKVCANHLAQLGFATYKGSVTSTKLKVTGIDLFSAGDFMGGEGTETITLSDPIGGVYKKLVIKDDVLVGACLYGDTADGGWYFRQIRENHGISEIRDHLMFGENALGDVGHQGQDKAMSMADTAEVCGCNGVCKSTIVKAIQEHGLFSVDDVKKHTKAASSCGSCAGLVEQILINTVGGAADVKPKSEKAICGCSDLNHGQIRQAIRDQHLLTIAGAMSYLNWRTPNGCATCRPALNYYLISTWPGEAHDDPQSRLINERAHANIQKDGTYSVVPRMWGGVTNPSELRRIADVADKYNVPMVKVTGGQRIDLLGIKKQDLPGVWKDLDMPSGHAYGKSIRTVKTCVGSEFCRFGTQNSTQLGIELEHDLFNMWSPHKVKLAVSGCPRNCSEAGIKDVGIIGVDSGWEMYIGGNGGIKTEVAEFFVKLKTAEQVREYNGAFLQLYREEAFYLERTVHYMQRVGMDHIKKAVLEDPTRRKALHERLKFSLSLEQDPWKQRLEQPQLKKEFEVIPVKNLEVPA
>NZ_CP045701.1|WP_153387889.1|2028661_2030332_-|protein-kinase
MSLQLSFAEASAIGPREENQDALRLVTPAPALAASKGYLFAIADGVSQCADGGLAARSTLQALALDYYSTPQTWGVAQALDRLLLAQNRWLQANGGGQPLLTTVSALVLRGQRFTLAHVGDCRVYRWHADHLQRISEDHVWEQQGMQHVLKRALGLDQHLILDFLDGELRTDETFVLLSDGVWAVLGDTAIAGILRDQPDLDLAAQTLVNAAHLAGSQDNASALLVRVDAVGEASIGDALIQLQQWPLPPALKPGQVFEGWQVESLLGHSQQSLLYRVHDGQGQPWLLKTLPMHLRDDTRAGQALLSEEWFLKRVAGRQFPEVHGAPQRQHLYYVMREYPGATLAELFNQGGPLPLAQWLDLAQRLVRAVGLLHRRQIYHRDIKPENLHLGDDGELRLLDFGLAYCPGLSEDQANVLPGTPSYIAPEAFAGTAPTAQQDLYAVGVTLYFLLTGHYPYGEIEAFQRPRFGVPVNASRYRPDLPEWLGLSLERAVAADPQQRFETAEEWLLLLEQGERRSLSVRPRPLLEREPLKVWRTLALVSLVVNVVLLFLVFHS
>NZ_CP045701.1|WP_153387890.1|2030341_2031553_-|MFS-transporter
MNSSFWKSGHTPTLFAAFLYFDLSFMVWYLLGPLAVQISADLHLTTQQRGLMVATPILAGAVLRLFMGLLADRISPKAAGMVGQVIVIGALFCAWKLGIHSYEQALLLGLFLGVAGASFAVALPLASQWYPPQHQGKAMGIAGAGNSGTVLAALIAPVMAVTFGWTNVFGFALIPLVLTLVLFTWLAKNAPERPKAKSMADYLKALGDRDSWWFMFFYSVTFGGFIGLASALPGYFNDQYGLSPVTAGYYTAACVFGGSLMRPLGGALADRFGGIRTLLGMYTVAAVCIAAVGFNLPSSYAALALFVCTMLGLGAGNGAVFQLVPQRFRREIGVMTGLIGMAGGIGGFALAAGMGAIKQSTGSYQLALWLFASLGVLAWFGLHGVKRRWRTTWGSAAVTAARV
>NZ_CP045701.1|WP_058544718.1|2031803_2032379_-|ANTAR-domain-containing-protein
MLRILLINDTAKKVGRLKAALMEAGFEVIDESGLTIDLPARVETVRPDVILIDTESPGRDVMEQVVLVSRDQPRPIVMFTDEHDPNVMRQAIKSGVSAYIVEGIHAARLQPILDVAMARFESDQALRAQLLARDQQLAERKRIELAKGMLMKMKECNEEQAYTLMRRQAMSRQQKLIQVAEQIIAMNELLG
>NZ_CP045701.1|WP_058544719.1|2032394_2033606_-|ABC-transporter-substrate-binding-protein
MNEVPANPLAWVNGSDAPEKSAVNLGFMALSDCAPVVVAATQGFAQPYGLTLNLKRQASWANLRDKLVSGEIDAAHSLYGLIYAVHLGIGGVAASDMAVLMGLNQNGQSINLSHGLQAQGVTSPEALERHVHQTRPKLTFAQTFPTGTHAMWLYYWLAAQGIHPLSDVDSVVVPPPQMIAHLQAGRIDGFCVGEPWCASAVKQNLGFTLATTQTIWPDHPEKVLGCTRAFVEQYPNTARALVMAILEASRFIEQSNENRRSTAQLLTAPEYLDAPLDCIEPRLLGIYADGLGNSWQDPHAMRFHGNGEVNLPYLSDGMWFMTQFRRWGLLREDPDYLAVAQDVQQLKLYREACAALDIASPRQDMRSSQLIDGITWDGSDPAGYARSFKLHALSDAAPLLASR
>NZ_CP045701.1|WP_153387891.1|2033838_2034858_+|quinone-dependent-dihydroorotate-dehydrogenase
MYTLVRELLFKLSPETSHDLSLDLIGAGGRLGLNGLLCKAPAKLPVTVMGLEFPNPVGLAAGLDKNGAAIDGFAQLGFGFVEIGTVTPRPQPGNPKPRLFRLPQAEAIINRMGFNNLGVDHLLARVAAAKYKGVLGINIGKNFDTPVERAVDDYLICLDKVYAHASYVTVNVSSPNTPGLRSLQFGDSLKQLLADLARRRAELALIHGRHVPLAIKIAPDMTDEETTQVALALIETGMDAVIATNTTLGREGVEGLEYGDEAGGLSGAPVRDKSTHTVKVLAAELAGRLPIIAAGGITEGRHAAEKITAGASLVQIYSGFIYKGPALIRESVDAIAALG
>NZ_CP045701.1|WP_003223300.1|2035185_2035401_-|ribosome-modulation-factor
MRRLKRDPLERAFLRGYQYGVGGKSRELCPFTLPSVRQAWINGWREGRGDNWDGMTGTAGIHRLNELHAVG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045701_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045701_3

4734996-4735152

Orphan

Consensus_repeat	Method
GGGAGAGCCAGGTCGGCTGCCAGGCCGCCTCGCGAGCAAGCTTTGCTCCCACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045701_3

>merge|NZ_CP045701|3|4734996-4735152|CRISPRCasFinder
GGGAGAGCCAGGTCGGCTGCCAGGCCGCCTCGCGAGCAAGCTTTGCTCCCACAGGTCCTGTTCCCACAGGTCCTGCTCAGGCAGATCTGATCGGCGTACGACTGGGAGAGCCAGGTCGGCTGTCAGGCCGCCTCGCGAGCAAGCTTTGCTCCCACAG

>NZ_CP045701|3|3|4734996-4735152|CRISPRCasFinder
GGGAGAGCCAGGTCGGCTGCCAGGCCGCCTCGCGAGCAAGCTTTGCTCCCACAG	GTCCTGTTCCCACAGGTCCTGCTCAGGCAGATCTGATCGGCGTACGACT
GGGAGAGCCAGGTCGGCTGTCAGGCCGCCTCGCGAGCAAGCTTTGCTCCCACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045701.1\|WP_153388716.1\|4744722_4745253_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227295
NZ_CP045701.1\|WP_003204309.1\|4729673_4730081_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045701.1\|WP_116641550.1\|4726048_4726708_-\|transglutaminase-family-protein	unknown	unknown	gnl\|CDD\|376628
NZ_CP045701.1\|WP_058542365.1\|4725380_4726004_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP045701.1\|WP_058546601.1\|4734462_4734732_+\|DUF3613-domain-containing-protein	unknown	unknown	gnl\|CDD\|289069
NZ_CP045701.1\|WP_153388715.1\|4737534_4738977_-\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP045701.1\|WP_153388712.1\|4730254_4731253_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP045701.1\|WP_058542924.1\|4742563_4743376_-\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP045701.1\|WP_064106985.1\|4727124_4729572_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|236528
NZ_CP045701.1\|WP_058542925.1\|4743391_4744720_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223679
NZ_CP045701.1\|WP_058542920.1\|4738980_4740201_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|349765
NZ_CP045701.1\|WP_058542923.1\|4741176_4742493_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|379164
NZ_CP045701.1\|WP_058542922.1\|4740688_4741168_-\|pilus-assembly-protein-TadG	unknown	unknown	gnl\|CDD\|377921
NZ_CP045701.1\|WP_058542917.1\|4735558_4736524_-\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP045701.1\|WP_116641551.1\|4724312_4725245_-\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP045701.1\|WP_064106984.1\|4732446_4733670_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NZ_CP045701.1\|WP_058546602.1\|4733726_4734440_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|227343
NZ_CP045701.1\|WP_058542921.1\|4740194_4740689_-\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|377921
NZ_CP045701.1\|WP_153388714.1\|4736551_4737538_-\|secretion-system-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP045701.1\|WP_153388713.1\|4731343_4731970_+\|alanyl-tRNA-editing-protein	unknown	unknown	gnl\|CDD\|178546

Protein	Function_ID	Function_description	E-value
NZ_CP045701.1\|WP_153388716.1\|4744722_4745253_-\|hypothetical-protein	gnl\|CDD\|227295	COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	4.50974e-13
NZ_CP045701.1\|WP_116641550.1\|4726048_4726708_-\|transglutaminase-family-protein	gnl\|CDD\|376628	pfam01841, Transglut_core, Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.	9.96269e-15
NZ_CP045701.1\|WP_058542365.1\|4725380_4726004_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	1.05979e-51
NZ_CP045701.1\|WP_058546601.1\|4734462_4734732_+\|DUF3613-domain-containing-protein	gnl\|CDD\|289069	pfam12266, DUF3613, Protein of unknown function (DUF3613). This family of proteins is found in bacteria. Proteins in this family are typically between 94 and 126 amino acids in length.	1.00596e-13
NZ_CP045701.1\|WP_153388715.1\|4737534_4738977_-\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	2.83026e-154
NZ_CP045701.1\|WP_153388712.1\|4730254_4731253_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.17995e-75
NZ_CP045701.1\|WP_058542924.1\|4742563_4743376_-\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	1.11975e-60
NZ_CP045701.1\|WP_064106985.1\|4727124_4729572_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|236528	PRK09463, fadE, acyl-CoA dehydrogenase; Reviewed.	0
NZ_CP045701.1\|WP_058542925.1\|4743391_4744720_-\|hypothetical-protein	gnl\|CDD\|223679	COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones].	1.04655e-10
NZ_CP045701.1\|WP_058542920.1\|4738980_4740201_-\|AAA-family-ATPase	gnl\|CDD\|349765	cd03111, CpaE-like, pilus assembly ATPase CpaE. This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.	3.62489e-86
NZ_CP045701.1\|WP_058542923.1\|4741176_4742493_-\|pilus-assembly-protein	gnl\|CDD\|379164	pfam13400, Tad, Putative Flp pilus-assembly TadE/G-like. This is an N-terminal domain on a family of putative Flp pilus-assembly proteins. The exact function is not known. The Flp-pilus biogenesis genes include the Tad genes, and some members of this family are putatively assigned as being TadG.	6.75659e-08
NZ_CP045701.1\|WP_058542922.1\|4740688_4741168_-\|pilus-assembly-protein-TadG	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	1.99886e-08
NZ_CP045701.1\|WP_058542917.1\|4735558_4736524_-\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	5.35145e-23
NZ_CP045701.1\|WP_116641551.1\|4724312_4725245_-\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	1.00117e-105
NZ_CP045701.1\|WP_064106984.1\|4732446_4733670_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	1.30443e-98
NZ_CP045701.1\|WP_058546602.1\|4733726_4734440_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|227343	COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion].	5.58972e-15
NZ_CP045701.1\|WP_058542921.1\|4740194_4740689_-\|pilus-assembly-protein	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	2.37417e-08
NZ_CP045701.1\|WP_153388714.1\|4736551_4737538_-\|secretion-system-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	1.0613e-51
NZ_CP045701.1\|WP_153388713.1\|4731343_4731970_+\|alanyl-tRNA-editing-protein	gnl\|CDD\|178546	PLN02961, PLN02961, alanine-tRNA ligase.	1.86705e-23

>NZ_CP045701.1|WP_058546601.1|4734462_4734732_+|DUF3613-domain-containing-protein
MITKQLMIACMVGLSSSAWAIEPGPSSPAQQGTESWMQLQIRGVVASTNLQTASAAEREMAMQRWLNSFNYPIPEFFEQDSGGDITSSK
>NZ_CP045701.1|WP_058546602.1|4733726_4734440_+|tetratricopeptide-repeat-protein
MKAVIAIAASLMLVGCASNSVVASRSTQCAKPESDQELALNMAEDMANEGRLYASLANLERLPEDLVQVRLRKARVLRLMGRNEAEPLYKSLLGTCLAADGEHGLGQLAAAKNDNTAATQYLERAAKMAPTEGKIRNDLGVVYLNQRRISEARFEFMTAMELQQSDTLAALNMVTLLIYQDNWKQAAELANMAKLSPQQVADAQARAEKIRGSATNAVTSPANRLTEVVDASTGAVK
>NZ_CP045701.1|WP_064106984.1|4732446_4733670_+|type-II-and-III-secretion-system-protein-family-protein
MTQRTAPVLKHFIHGLFWMGLGLEAAQAAAANCSQLDNLPATFEVGQGHQSELRILAPVTKLAVGDPKIADVQPSGSDAFILTGLAPGATSLMVWTDCSKIPRQSMVFVKGRATEALTSAASIPSEDPMLLAQVQTDIRFVEVSRTKLKEASTSIFGSRGNFLFGSPRTLPTVGGIVRPSLPANNDMFNLSFATGKTLLMINALEGSGFAYTLARPSLVALSGQSASFLAGGEVPIPVPSAGSDNVSIEYKEFGIRLTLTPTVIGKNRIMLKVAPEVSELDFTNAVNIAGTLVPALTVRRTDTSIALADGESFVISGLISTRNSSQVNKFPGLGDVPILGAFFRDNSINREERELLMIVTPHLVQPLAADAQLPTLPGEQLRNYDPNFYRMYFLEHGEFDNRSGLSQ
>NZ_CP045701.1|WP_153388713.1|4731343_4731970_+|alanyl-tRNA-editing-protein
MTLRLFFHSDDLKANVEVLDCSPREHEFAVVLHATLFHPQGGGQPCDTGWIGESQVLRVVQEGPQIVHYVDGPVPLGMAAISVDAQRRQLNSRLHTAGHLIGHFAQARGWKPIKAHHWPGESRVQFQPGDNPQELDTSTIQQGIDEWIAGDLPRLITLREGLREVGFGELAAYGCGGTHVQRLQELGTVTIASLSQKKGTLSVRYHVA
>NZ_CP045701.1|WP_153388712.1|4730254_4731253_-|LysR-family-transcriptional-regulator
MSTNLPLPLLAEMAIFVKVVETGSFSEAARQSGTSPSAISRSISRLEKALATRLLQRTTRKLRLSDGGEEVFKRCQEMVAAARSVMEISGQFSQEAEGRIRVSVPKAVGRFVIHPHMPEFLRRYPKVDVELFLEDRQVDLIDDHVDLAIRITDQPPVGLVGRQLLTIDHLLCATPQYLAEHGTPMHPHDLLEHSCIYLGATANDSRWKFKKGTKSVTVGVHGRYAANHTGVRLGAVLQHIGIGSLPYFTARHALEQGLIVQVLADWTFLASYHGGLWLLHSPTRYLPPKLRVFIDYLVACLEKEPTLSTASGGSGPGKVATGYELPQSDGLF
>NZ_CP045701.1|WP_003204309.1|4729673_4730081_+|hypothetical-protein
MSNVVADHLVLLDHLRSILVAVGEAEQVPEESHALFLERFDELRAQLPVDPIESQYLGQDLLCQVIVRYPQIAHLVPRDLLWYFAGDCLHYMPDEEIALYQALEERRFEAEQNDEPFDWNQEKQLLAMSDQDSKH
>NZ_CP045701.1|WP_064106985.1|4727124_4729572_+|acyl-CoA-dehydrogenase
MLLLWILVLVVGKAWLAHRRTAPLTALGIIAAYLLAMSLFSPAPGWLMLIFWVALAAVAAPLLLPDLRRKYFSAPMFDWFQKTLPPMSETERDAIDAGTVWWDGELFSGRPDWDLLLAYPKVQLTEEEQAFLDGPTEALCAMVSDWQIGQAMDLPPEAWAHIKEHGFFALIIPKEYGGKGFSAYAHSQVAMKLATRSGDLASTVMVPNSLGPAELLLHYGTDEQRNHYLPRLARGDDIPCFALTGPLAGSDAGAMPDTGIICKGEWEGQETLGLRLNWEKRYITLGPVATLLGLAFKAYDPDHLLGDEEDLGISLALIPTDTPGVQIGRRHLPLGAAFMNGPNWGKDVFIPLDFLIGGQAMLGKGWMMLMNCLSVGRSISLPAVGTGAAKFTSLVTGQYAQVREQFNVPLSAFEGIQEAMARIGGNAWMMDAARMLTANAVDLGEKPSVLSAILKYHLTERGRECISHAMDVHGGKGIIMGPNNYLGRSWQGAPIFITVEGANILSRNLMIFGQGAIRCHPFVLKEMALASREDKDQALVEFDALLLKHIGFAISNAASTLVLNLGLGHFEKAPGNALSQGYFRALNRQAAAFALLADLSMMLLGGELKRRERLSARLGDVLSNLYLASAALKRYHDLDSPDHMTPLFTWAMEESLGQSERALDELLSNFPNRVLGCLLRLVVFPFGRRHKGPSDKLDAEVAAVIGRPKGDPTLEELLQGCYRPQSTDDPVGALQHAADLLAAAHPLHKKLHVALKQGQLNPAPGEPLIDAALEAGVLQTAEAQTLRAAEAARRKVIDVDDFDKDELTLAQGKVR
>NZ_CP045701.1|WP_116641550.1|4726048_4726708_-|transglutaminase-family-protein
MQQYLNPGPFIDSDHPAVIDFTETHRGTDRDPLAQAVSLYYAVREAVRYNPYTFSRDPATLRGSYALAAGQSYCVPKATLLAGCARHCGIPARIGLADVRNHLSTPRLLELLRSDVFAMHGYTELYLNDRWVKATPAFNQGLCELFDVAPLEFDGRHDSVFHPFNRQGAKLMEYVTDHGPFADVPEAFFFEHLEKCYPHLFGEQVPLLLGDLQGDLSRA
>NZ_CP045701.1|WP_058542365.1|4725380_4726004_-|glutathione-S-transferase
MLKIWGRKNSSNVRKALWCAEELGLAYEAIDAGGAFGVVDTPEYRGKNPNGRVPMIEDDGFVLWESNTIVRYLAARHASGSAWYPADVQARAQAEKWMDWTTSSFAAPFRTVFWGVLRTPAEQQDWAAINAAIKECDDLLAMVEQTLSEQPYLSGDEIGMGDIPLGSFIYAWFEMPIQRAELPGVQAWYARLQQRAAYRKAVMTALT
>NZ_CP045701.1|WP_116641551.1|4724312_4725245_-|ABC-transporter-ATP-binding-protein
MSSALSIRQLTKTYGNGFQALSGIDLDVAEGDFFALLGPNGAGKSTTIGILSTLVNKTSGTVNVFGHDLDREPAALKRCIGVVPQEFNFNQFEKTFDIVVTQAGYYGIPPKIANERAEQYLTQLGLWDKRDVPSRSLSGGMKRRLMIARALVHEPRLLILDEPTAGVDIELRRSMWSFLTELNQKGITIILTTHYLEEAEQLCRNIGIIDHGTIVENTSMRQLLSQLHVETFLLDLKNDLKAAPQLMGYPARLVDSHTLEVQVDKAVGITGLFAQLALQNIEVQSLRNKTNRLEELFVSLVEKNLAKVAV
>NZ_CP045701.1|WP_058542917.1|4735558_4736524_-|type-II-secretion-system-F-family-protein
MDFLLGLLSRFTGNEELARLLFIAAIGLSTVLAAVALLLLMLGLQDPVQRRLALIKRGYAGNAVGQEAPSNLQLLLERVGQRFASTDQAHTSATQTLLTHAGYRSASAVQMYWAVRLMLPLLMVGVALLLLPMVKVSVAIGLLAVTLVAGIGWLLPAIYVGKRKQARQGRLRAAFPDALDLMVVCVESGLALPTTIERVAEEMSVSQVELAEELALVNAQIRAGITSTEALKQLAVRTGLEDIQGLVSLLAQSIRFGTSVADTLRIYADEFRDRRTQAAEEMGAKIGTKLIFPLIFCLWPSFFLVAIGPAMIGVFRAFGNM
>NZ_CP045701.1|WP_153388714.1|4736551_4737538_-|secretion-system-protein
MSNIPSEFILIFLGMVFIAVFLLSQGVVVPVFGEAGRMRKRIRGRLHVLEKANHLPNMQTVLRQKYLTRLSPLEARLEQLPFMANLTQLIEQAGHEYRAYRVMLLGLALGAAAGALVLMVSPVWWLALLATFVATWLPVLKILRDRNKRFAAFEEGLPDALDAMCRALRAGHPFNETLRLVAEEHKGPVAQEFGMTFSDINYGNDVRRAMLGLLERMPSMTVMMLVTSILIHRETGGNLTEVLERLSRLIRGRFRFQRKIRTLSAEGRMSAWVLVAIPFVLAIAIVLTSPSYMPVLINDPIGHKLIIGAFCAMLIGIFWIKKIIRIQV
>NZ_CP045701.1|WP_153388715.1|4737534_4738977_-|CpaF-family-protein
MISDFRNRLRKQPVKPGASADAQPGDGLPDPTDALMAWEQAIPDVLYETRSQVTPVEAEWREKIYQQLLKVMDLSLLDTLEQVEAARQIREICQRLLEEHSAPVSTASRQLIIKQITDEVLGLGPLEPLLADHSVSDILVNGFASVYVERFGKLQRTDVRFRDDQHLLNIIDRIVSSLGRRIDESSPLVDARLKDGSRVNAIIPPLAIDGPSMSIRRFAVDLLNTDSLIQVGTMTPAIALLLKAIVRGRLNVLISGGTGSGKTTMLNVLSSFIPHNERIVTIEDSAELQLQQPHVVRLETRPSNIEGRGEVSQRELVRNSLRMRPDRIVIGEVRGAEAMDMLTAMNTGHDGSLTTIHANTARDALGRVENMVSMTGATFPIKAMRQQIASAIDVVIQLERQEDGKRRVVSMQEINGMEGEIITMTEIFSFVRQGIGEHGEVLGEYRPSGMIPAFRDVLAKRGIELPLTLFRPEWMEGRTS
>NZ_CP045701.1|WP_058542920.1|4738980_4740201_-|AAA-family-ATPase
MLNTRETPLASTTGRAGLRILISSRDAASLRDLQCVCQRMPGLEVSTRLVSNGHVDPLYGLDRMPDLLLLRVSHLWREELSALLQRPAHERPPMLVCGPLGEQEGMRLAMQAGARDVLPEPIADTELVAALNRLVVDVRLGNGNEGKLVAVISAKGGSGGTLVACNLAQQLSARAGNTLLLDMDLQFGSVTHYLDVAQSHSHLEVLQQVDDMDSVALRGFCSHFSPTLHVLGGRAGELCLPQDAQPEQLDALLQLARASYDWVVVDLPRQIDHLTGSVLEQVDRVYVVVQQSVSHLRDASALVRILREDLGVRGDQLQIVVNRYDKSAAVNLKDIGEALRCTNLSKLPNDFNLVSQSQNTGVPLGLHAPKAAITAALRDLTEDLVGHQMATDKGLLKRAFNRFFGG
>NZ_CP045701.1|WP_058542921.1|4740194_4740689_-|pilus-assembly-protein
MNNKHMRGTYVVEFAFVGLLVFTLLFGVLEMGRLYFTVNALDEAARRGARLAAVCNISDPVVLRRAIFNAATDSGTSQLISSLATSNLALTYLDVNGAVVANPADTSGVTGFRAIRYVQLSVQNFVFNLFIPGLGVPITLPTFRATLPRESLGRHSDSGEITPC
>NZ_CP045701.1|WP_058542922.1|4740688_4741168_-|pilus-assembly-protein-TadG
MGLSHFKSAQAQQGVALVEFTLVLPLLLLLLLAFGEFGRMLYQYNVLLQASRDADRFVASQAWNSTLGAVALSSTLLTQTKNVAVYGVPSASGTAVVSGLTTANVQVAAVGIDHVRVTITYTFCPVIGAGSCNGSIPGFFGNAIPLGIQLVATTVMRAL
>NZ_CP045701.1|WP_058542923.1|4741176_4742493_-|pilus-assembly-protein
MMNANIRRQGGAVSVLMVIALVAISMMAALALDGGHMLLNKTRLQNAVDAAALGGAKTLSQVSGGINMASTTRAAALDTFNRNANAAGNAELATAVAGNPGAFAVVELSSSVYGPFSYPGPTDAKYVRVSVANYQLNGFFWSFVQSMGSGGLGGKAVAAIATAGPSPTSPCDLAPLMVCGDPTQYNPAAGNFWGYQFGDLEVLKTAAGNTSPIGPGNFQLLDFGSGGSAVREDLAGGGSVCRSVGDNVQTAPGNKAGPTSQGLNTRFGIYNGPVSSSDYPPDLVTASGTPAITYNDSLSQAQYKGQAITSSNGDLSAGGEAIQDYNDWRAQVAACVAGGASGCESNGVFERRMLKIVIGDCAGKLSGSTSIPVLGFGCYFVLQPVSGGGSESIIFGQFVQECEGDNVPGPTPSTDSGPQIIQLYKTYLNGSGTPSTDS
>NZ_CP045701.1|WP_058542924.1|4742563_4743376_-|Flp-pilus-assembly-protein-CpaB
MSSRTLPLIGVSLVMGLGAAWMADSWLSARLNATPDDHLRSVVVATVEIPFGQMVEAQQVTTVRMPMDTIPDDAFDASEQAVGKIATFDILRGDIVRGARLSEHLGGSTLASLIAPDKRAISVRVDDVVGVGGFLLPGNRVDVLATKTTNAGSNTATSRTLLENLRVLAVDQTAGTDKTQPVVVRAVTLEMSASEAELLVTAQTEGKLQLALRNPLNLEKKAVAVAPPAPAPVMAKAAALPKPVVQRSAKPQGAAITLIRGVESSVINIR
>NZ_CP045701.1|WP_058542925.1|4743391_4744720_-|hypothetical-protein
MHVINDSDAYPSEREAVQRLAPQPCTIGDTGLTESFLGELVCKHLHDAGVLDMSRLVERLALTGAVLEEVLAFLRKDGRVEVLGQLGQTGGQTLRYGLTERGRSSARDALARSGYIGAAPFPVSTYRSLIKIQTIHHGRITAKDMNHALAGLVLSQGMLDQLGVALNSGRAIMIYGPAGTGKTYVSSRLIRLFAEAIWVPHAIVINESVIEIYDPQVHQRLDDNGQSNNLMLNEGIDRRLLCCKRPIVITGGELSMEQLDVRYDPFTRQYQAALQLKASNGLFIIDDMGRQRMAPAELLNRWIVPMEEKRDFINLGGGRHCELPFDLVLVFSTNLNPLELADEAFLRRIGYKVQFGYLKPEEYEQIWRQECERLGIPYDPLLVRYVLQRLYAGEGMPLVPCHPRDLLNMALDRQRYLGGSGPLLPQELEWAWHNYFVQLDFL
>NZ_CP045701.1|WP_153388716.1|4744722_4745253_-|hypothetical-protein
MSMELLMSTVLLLGLLGVAVVSDLLRHRIPNTLVLLGLALGLASQIYTSGIGGLGDSLLGMLICFGLFLPMYAVGGMAAGDVKLMTMVGSFLPFHYALWAALFSLIAGGVCGFLIVLARGQLLQTLGRYWLMVRAQSYLAPTSDEVAGKPFPYSIAILIGTLNSVYWQLVAGGWGV

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP045701_2	2.1\|2021736\|35\|NZ_CP045701\|CRISPRCasFinder	2021736-2021770	35	NZ_CP045701.1	1336406-1336440	2	0.943
NZ_CP045701_2	2.1\|2021736\|35\|NZ_CP045701\|CRISPRCasFinder	2021736-2021770	35	NZ_CP045701.1	2927380-2927414	2	0.943
NZ_CP045701_2	2.1\|2021736\|35\|NZ_CP045701\|CRISPRCasFinder	2021736-2021770	35	NZ_CP045701.1	3731072-3731106	2	0.943
NZ_CP045701_2	2.1\|2021736\|35\|NZ_CP045701\|CRISPRCasFinder	2021736-2021770	35	NZ_CP045701.1	5262800-5262834	2	0.943

1. spacer 2.1|2021736|35|NZ_CP045701|CRISPRCasFinder matches to position: 1336406-1336440, mismatch: 2, identity: 0.943

tacacccatccgatctgtgggagcaaagcttgctc	CRISPR spacer
tacacccatcatatctgtgggagcaaagcttgctc	Protospacer
**********  ***********************

2. spacer 2.1|2021736|35|NZ_CP045701|CRISPRCasFinder matches to position: 2927380-2927414, mismatch: 2, identity: 0.943

tacacccatccgatctgtgggagcaaagcttgctc	CRISPR spacer
tacacccgtcagatctgtgggagcaaagcttgctc	Protospacer
*******.** ************************

3. spacer 2.1|2021736|35|NZ_CP045701|CRISPRCasFinder matches to position: 3731072-3731106, mismatch: 2, identity: 0.943

tacacccatccgatctgtgggagcaaagcttgctc	CRISPR spacer
tacacccatcagatctgtcggagcaaagcttgctc	Protospacer
********** ******* ****************

4. spacer 2.1|2021736|35|NZ_CP045701|CRISPRCasFinder matches to position: 5262800-5262834, mismatch: 2, identity: 0.943

tacacccatccgatctgtgggagcaaagcttgctc	CRISPR spacer
tacacccgtcagatctgtgggagcaaagcttgctc	Protospacer
*******.** ************************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP045701_1	1.1\|1626125\|48\|NZ_CP045701\|CRISPRCasFinder	1626125-1626172	48	EU982300	Pseudomonas phage DVM-2008, genomic sequence	794-841	8	0.833

1. spacer 1.1|1626125|48|NZ_CP045701|CRISPRCasFinder matches to EU982300 (Pseudomonas phage DVM-2008, genomic sequence) position: , mismatch: 8, identity: 0.833

cctgtaggagctggcgaagcctgcgatcttttgatcttttgatcttta	CRISPR spacer
tttgtaggagctggcgaagcctgcgatcttttgatctttcgcttgaga	Protospacer
..*************************************.* *.   *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1282203 : 1390392

104

Pseudomonas_phage(47.17%)

holin,transposase,tail,lysis,plate,tRNA,protease

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025212102.1\|1282203_1283022_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	1.6e-09	28.7
WP_116643088.1\|1283209_1283614_-	SufE family protein	NA	NA	NA	NA
WP_116643087.1\|1283610_1284816_-	cysteine desulfurase	Q2XUY6	environmental_halophage	1.8e-70	36.9
WP_058543194.1\|1284889_1285924_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_153387712.1\|1285956_1286319_-	ArsC family reductase	NA	NA	NA	NA
WP_153387713.1\|1286640_1288287_+	Na+/H+ antiporter	NA	NA	NA	NA
WP_058543422.1\|1288295_1288691_-	hypothetical protein	NA	NA	NA	NA
WP_116643084.1\|1289173_1289533_+	hypothetical protein	B5TK57	Pseudomonas_phage	6.6e-21	54.3
WP_003198225.1\|1290307_1291507_-	succinyldiaminopimelate transaminase	NA	NA	NA	NA
WP_153387714.1\|1291644_1294347_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_003198229.1\|1294391_1295174_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_003198231.1\|1295706_1296444_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_058543419.1\|1296638_1297505_+	elongation factor Ts	NA	NA	NA	NA
WP_003198235.1\|1297718_1298462_+	UMP kinase	NA	NA	NA	NA
WP_058543418.1\|1298458_1299016_+	ribosome recycling factor	NA	NA	NA	NA
WP_058543417.1\|1299029_1299785_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	5.5e-17	37.3
WP_058543416.1\|1299784_1300591_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_058543423.1\|1300587_1301778_+	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_116643083.1\|1301830_1303183_+\|protease	RIP metalloprotease RseP	NA	NA	NA	NA
WP_153387715.1\|1303257_1305633_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_058545768.1\|1305678_1306182_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_116643081.1\|1306185_1307241_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_003184897.1\|1307346_1307787_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_053118863.1\|1307783_1308560_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_064107119.1\|1308562_1309693_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_116643079.1\|1309710_1310334_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	1.7e-27	39.2
WP_116643078.1\|1310517_1314039_+	DNA polymerase III subunit alpha	A0A1C9LWZ5	Streptomyces_phage	3.0e-198	36.5
WP_003198261.1\|1314189_1315137_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_116643077.1\|1315287_1316613_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_058542194.1\|1316887_1318519_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	2.2e-156	52.9
WP_047227577.1\|1318523_1319369_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.8e-48	42.4
WP_058542192.1\|1319621_1320911_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	5.9e-136	59.2
WP_003184873.1\|1321082_1321361_+	cell division protein FtsB	NA	NA	NA	NA
WP_058542191.1\|1321357_1322065_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	NA	NA	NA	NA
WP_058542190.1\|1322161_1323058_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_058542189.1\|1323165_1324278_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.1e-32	29.3
WP_153387716.1\|1324286_1325132_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_003184863.1\|1325175_1325649_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_058542187.1\|1325645_1326704_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_058542186.1\|1326691_1327441_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-67	52.6
WP_003198285.1\|1327440_1328118_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.0e-44	50.0
WP_116643075.1\|1328329_1329175_+	peptidoglycan DD-metalloendopeptidase family protein	A0A0S2SXL7	Bacillus_phage	8.3e-06	33.3
WP_058542184.1\|1329281_1330289_+	RNA polymerase sigma factor RpoS	G8CLC7	Synechococcus_phage	6.6e-34	35.8
WP_116641313.1\|1330738_1332169_-\|transposase	IS1182 family transposase	NA	NA	NA	NA
WP_003198291.1\|1332998_1333322_-	ferredoxin family protein	NA	NA	NA	NA
WP_153387717.1\|1333464_1336044_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	9.0e-27	21.9
WP_153387718.1\|1336615_1336969_-	hypothetical protein	B5TK57	Pseudomonas_phage	4.5e-54	96.6
WP_058542523.1\|1337541_1338276_+	helix-turn-helix domain-containing protein	B5TK58	Pseudomonas_phage	1.8e-137	99.6
WP_058542520.1\|1338830_1339181_+\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	3.9e-58	94.8
WP_116643073.1\|1339217_1339730_+	hypothetical protein	NA	NA	NA	NA
WP_116643072.1\|1339733_1340345_+\|plate	phage baseplate assembly protein V	A0A2H4JBW8	uncultured_Caudovirales_phage	7.8e-46	50.3
WP_116643071.1\|1340356_1340689_+\|plate	phage baseplate protein	A0A2H4JI46	uncultured_Caudovirales_phage	4.2e-38	71.8
WP_058542516.1\|1340685_1341681_+\|plate	baseplate J protein	A0A2H4JC04	uncultured_Caudovirales_phage	1.7e-111	65.0
WP_153387719.1\|1341677_1342313_+\|tail	phage tail protein I	A0A2H4JDK0	uncultured_Caudovirales_phage	3.9e-48	56.6
WP_153387720.1\|1344735_1344945_+	hypothetical protein	NA	NA	NA	NA
WP_058542794.1\|1344947_1346114_+	hypothetical protein	B0ZSG8	Halomonas_phage	1.8e-123	56.7
WP_058542795.1\|1346113_1346620_+\|tail	phage tail protein	Q6R4W3	Vibrio_virus	3.1e-24	35.7
WP_058542796.1\|1346759_1347326_+\|tail	phage tail assembly protein	B0ZSH0	Halomonas_phage	4.7e-29	40.0
WP_153387721.1\|1347454_1349506_+\|tail	phage tail tape measure protein	A0A0R6PIJ6	Moraxella_phage	1.0e-20	29.9
WP_038857206.1\|1349505_1349889_+\|tail	phage tail protein	A0A2H4JAC8	uncultured_Caudovirales_phage	8.0e-33	52.0
WP_058542798.1\|1349881_1350094_+\|tail	phage tail protein	A0A2H4JGD9	uncultured_Caudovirales_phage	3.1e-18	64.3
WP_153387722.1\|1350103_1351120_+	phage late control D family protein	A0A2H4JH05	uncultured_Caudovirales_phage	1.3e-106	56.4
WP_153387723.1\|1351257_1351842_+	hypothetical protein	B5TK65	Pseudomonas_phage	4.6e-104	97.9
WP_003198311.1\|1351838_1352021_+	DUF2635 domain-containing protein	B5TK66	Pseudomonas_phage	6.3e-28	100.0
WP_116643060.1\|1352020_1353517_+\|tail	phage tail protein	B5TK67	Pseudomonas_phage	5.4e-274	98.2
WP_003198314.1\|1353583_1353931_+\|tail	phage tail protein	B5TK68	Pseudomonas_phage	5.7e-62	100.0
WP_003198316.1\|1353927_1354224_+\|tail	phage tail assembly protein	B5TK69	Pseudomonas_phage	1.1e-45	100.0
WP_153387724.1\|1354354_1355929_+\|tail	phage tail protein	B5TK70	Pseudomonas_phage	3.3e-157	94.8
WP_116643057.1\|1355915_1357154_+	hydroxyacid dehydrogenase	B5TK71	Pseudomonas_phage	1.7e-225	97.3
WP_058543732.1\|1357157_1358198_+\|plate	baseplate protein	B5TK72	Pseudomonas_phage	4.7e-192	98.3
WP_058543733.1\|1358328_1358838_+\|plate	phage baseplate assembly protein V	B5TK73	Pseudomonas_phage	6.4e-86	98.2
WP_153387725.1\|1358837_1359236_+	hypothetical protein	B5TK74	Pseudomonas_phage	1.7e-70	97.0
WP_058543735.1\|1359225_1360266_+\|plate	baseplate J/gp47 family protein	B5TK75	Pseudomonas_phage	1.8e-180	95.3
WP_024617650.1\|1360253_1360853_+	DUF2313 domain-containing protein	B5TK76	Pseudomonas_phage	4.7e-112	98.5
WP_153387726.1\|1360864_1362019_+\|tail	phage tail protein	B5TK77	Pseudomonas_phage	3.2e-210	96.1
WP_058543737.1\|1362015_1362525_+	hypothetical protein	B5TK78	Pseudomonas_phage	2.5e-82	94.7
WP_153387727.1\|1362552_1363647_+\|tail	phage tail protein	B5TK79	Pseudomonas_phage	1.1e-196	93.4
WP_153387728.1\|1363654_1364215_+\|tail	phage tail protein	B5TK80	Pseudomonas_phage	3.8e-100	93.0
WP_153387729.1\|1364326_1365238_+\|tail	phage tail protein	B5TK81	Pseudomonas_phage	2.9e-153	97.2
WP_058543741.1\|1365251_1365683_+	hypothetical protein	B5TK82	Pseudomonas_phage	1.6e-74	95.1
WP_153387730.1\|1365707_1366271_+	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	2.8e-98	95.2
WP_153387731.1\|1366252_1366789_+\|lysis	lysis protein	B5TK84	Pseudomonas_phage	4.5e-82	93.3
WP_116643051.1\|1366859_1367360_+	CinA family protein	B5TK85	Pseudomonas_phage	1.1e-82	95.8
WP_003198351.1\|1367443_1368496_+	recombinase RecA	A0A0S2MVG1	Bacillus_phage	2.9e-109	61.4
WP_058546690.1\|1368504_1368972_+	recombination regulator RecX	NA	NA	NA	NA
WP_058546691.1\|1369018_1370137_-	TIGR00730 family Rossman fold protein	NA	NA	NA	NA
WP_058546692.1\|1370602_1370797_+	hypothetical protein	NA	NA	NA	NA
WP_153387732.1\|1370797_1371220_-	hypothetical protein	NA	NA	NA	NA
WP_058546694.1\|1371404_1372151_+	DTW domain-containing protein	NA	NA	NA	NA
WP_058546695.1\|1372364_1373018_+	response regulator transcription factor	NA	NA	NA	NA
WP_003184792.1\|1373090_1373453_+	diacylglycerol kinase	NA	NA	NA	NA
WP_081264501.1\|1373457_1374444_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003198368.1\|1374505_1375285_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_153387733.1\|1375384_1376083_-\|tRNA	tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO	NA	NA	NA	NA
WP_053182473.1\|1376116_1376578_-	DUF1456 family protein	Q9EYF4	Enterobacteria_phage	1.1e-36	50.0
WP_024617635.1\|1376635_1377346_-	RNA-binding protein S4	NA	NA	NA	NA
WP_058546700.1\|1377429_1377903_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_014336847.1\|1378131_1379472_-	30S ribosomal protein S12 methylthiotransferase RimO	NA	NA	NA	NA
WP_058546701.1\|1379744_1381646_+	potassium transporter Kup	M1IAJ4	Acanthocystis_turfacea_Chlorella_virus	3.1e-77	34.2
WP_058546702.1\|1381708_1382998_-	virulence factor family protein	NA	NA	NA	NA
WP_116643048.1\|1382997_1385640_-	bifunctional lysylphosphatidylglycerol flippase/synthetase MprF	NA	NA	NA	NA
WP_058546704.1\|1386463_1387525_+	DNA polymerase IV	NA	NA	NA	NA
WP_058546705.1\|1387705_1388659_-	hypothetical protein	NA	NA	NA	NA
WP_058546706.1\|1388676_1390392_-\|tRNA	proline--tRNA ligase	NA	NA	NA	NA

DBSCAN-SWA_2

4130159 : 4136426

uncultured_Caudovirales_phage(83.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058545328.1\|4130159_4130552_+	sulfurtransferase complex subunit TusD	A0A2H4JA39	uncultured_Caudovirales_phage	1.2e-52	79.1
WP_058545314.1\|4130551_4130914_+	sulfurtransferase complex subunit TusC	A0A2H4J8C0	uncultured_Caudovirales_phage	2.0e-41	70.8
WP_153388499.1\|4130913_4131207_+	sulfurtransferase complex subunit TusB	A0A2H4JG28	uncultured_Caudovirales_phage	1.4e-29	66.7
WP_003203314.1\|4131203_4131539_+	TusE/DsrC/DsvC family sulfur relay protein	A0A2H4J8B6	uncultured_Caudovirales_phage	1.0e-44	80.2
WP_058545312.1\|4131535_4132537_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	2.8e-162	83.5
WP_153388500.1\|4132625_4133630_+	glutathione S-transferase family protein	NA	NA	NA	NA
WP_064106935.1\|4133750_4135145_-	uroporphyrinogen-III C-methyltransferase	NA	NA	NA	NA
WP_116641882.1\|4135145_4136426_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.8e-98	53.6

DBSCAN-SWA_3

4400247 : 4460717

uncultured_Caudovirales_phage(36.96%)

integrase,terminase,holin,transposase,tail,capsid,head,lysis,tRNA,portal,protease

attL 4433980:4433995|attR 4451002:4451017

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153387853.1\|4400247_4401792_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.2e-81	36.4
WP_153389157.1\|4401810_4402167_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.7e-17	38.2
WP_153388579.1\|4402914_4403556_-	hypothetical protein	NA	NA	NA	NA
WP_153388580.1\|4403552_4404359_-	DUF4276 family protein	NA	NA	NA	NA
WP_038858737.1\|4405135_4405444_+	putative addiction module antidote protein	NA	NA	NA	NA
WP_003203821.1\|4405572_4405845_-	hypothetical protein	NA	NA	NA	NA
WP_058542883.1\|4406513_4406801_+	antitoxin	NA	NA	NA	NA
WP_116641690.1\|4406813_4407077_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.4e-15	50.6
WP_058542881.1\|4407463_4407673_+	hypothetical protein	A0A1B0VP78	Pseudomonas_phage	4.0e-10	50.8
WP_153388581.1\|4408408_4408924_-\|lysis	lysis protein	A0A2H4IZW4	uncultured_Caudovirales_phage	2.5e-45	61.3
WP_153388582.1\|4408920_4409346_-	cell wall hydrolase	A0A2D1GNI1	Pseudomonas_phage	8.3e-63	81.6
WP_153388583.1\|4409406_4409868_-	hypothetical protein	NA	NA	NA	NA
WP_153388584.1\|4410939_4411614_-	hypothetical protein	A0A2D1GNS6	Pseudomonas_phage	3.7e-41	40.8
WP_153388585.1\|4411613_4411937_-	hypothetical protein	NA	NA	NA	NA
WP_153388586.1\|4411933_4415497_-	DUF1983 domain-containing protein	A0A2H4J8Z6	uncultured_Caudovirales_phage	0.0e+00	60.8
WP_153388587.1\|4415554_4416145_-\|tail	tail assembly protein	A0A2H4J1H0	uncultured_Caudovirales_phage	1.8e-63	68.8
WP_153388588.1\|4416190_4416589_-	DUF2846 domain-containing protein	NA	NA	NA	NA
WP_153388589.1\|4416993_4417755_-\|tail	phage tail protein	A0A2H4J1J7	uncultured_Caudovirales_phage	9.4e-134	83.7
WP_153388590.1\|4417757_4418507_-\|tail	phage minor tail protein L	A0A2H4J4Q5	uncultured_Caudovirales_phage	7.1e-126	83.5
WP_153388591.1\|4418516_4418855_-\|tail	phage tail protein	K7PHJ6	Enterobacteria_phage	1.3e-23	47.3
WP_153388592.1\|4418844_4421730_-\|tail	phage tail tape measure protein	A0A1V0E821	Vibrio_phage	2.8e-138	36.8
WP_153388593.1\|4421733_4422045_-	hypothetical protein	Q9MCA3	Pseudomonas_phage	1.4e-11	44.7
WP_153388594.1\|4421960_4422401_-\|tail	phage tail protein	Q9MCA4	Pseudomonas_phage	3.2e-17	48.6
WP_153389180.1\|4422410_4422872_-	hypothetical protein	A0A1V0E8B3	Vibrio_phage	1.5e-09	60.0
WP_153388595.1\|4423224_4423590_-	DUF3168 domain-containing protein	A0A1J0GUW9	Halomonas_phage	4.2e-31	59.7
WP_153388596.1\|4423589_4424036_-	hypothetical protein	B5WZS9	Pseudomonas_phage	4.6e-40	56.8
WP_153388597.1\|4424025_4424367_-\|head	phage head closure protein	A0A1J0GUY4	Halomonas_phage	1.4e-23	61.1
WP_153388598.1\|4424366_4424666_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J8C5	uncultured_Caudovirales_phage	1.2e-36	73.7
WP_153388599.1\|4424666_4424885_-	hypothetical protein	NA	NA	NA	NA
WP_153388600.1\|4424942_4426145_-\|capsid	phage major capsid protein	A0A2H4J8D1	uncultured_Caudovirales_phage	1.1e-149	66.4
WP_153388601.1\|4426141_4426783_-\|head,protease	HK97 family phage prohead protease	A0A2H4JA51	uncultured_Caudovirales_phage	1.7e-91	78.4
WP_153388602.1\|4426769_4427984_-\|portal	phage portal protein	A0A2H4JFN7	uncultured_Caudovirales_phage	1.1e-179	76.7
WP_153388603.1\|4427986_4429666_-\|terminase	terminase large subunit	A0A0N7KZG0	Stx2-converting_phage	9.5e-195	59.9
WP_153388604.1\|4429669_4430158_-	hypothetical protein	S4TNN3	Salmonella_phage	3.1e-13	36.7
WP_153389181.1\|4430317_4430659_-	HNH endonuclease	A0A2H4PHY5	Pseudomonas_phage	1.3e-21	56.6
WP_153388605.1\|4430773_4431106_-\|holin	phage holin, lambda family	A0A2H4J1U5	uncultured_Caudovirales_phage	1.9e-54	95.5
WP_153388606.1\|4431481_4431754_-	hypothetical protein	NA	NA	NA	NA
WP_153388607.1\|4431931_4432495_-	hypothetical protein	A0A2H4J2J2	uncultured_Caudovirales_phage	1.3e-66	57.5
WP_153389182.1\|4432498_4432804_-	hypothetical protein	A0A2D1GNG3	Pseudomonas_phage	7.9e-07	34.3
WP_153388608.1\|4432803_4434102_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1GND4	Pseudomonas_phage	5.0e-135	56.3
4433980:4433995	attL	NA	NA	NA	NA
WP_153388609.1\|4434098_4434515_-	VRR-NUC domain-containing protein	A0A2D1GNH3	Pseudomonas_phage	8.9e-62	87.6
WP_153388610.1\|4434511_4434814_-	DUF1364 family protein	A0A2K8HR56	Pseudomonas_phage	1.0e-19	47.1
WP_153388611.1\|4434804_4435032_-	DUF3310 domain-containing protein	A0A2I7QLD5	Vibrio_phage	2.6e-23	71.4
WP_153388612.1\|4435031_4435826_-	AAA family ATPase	A0A2H4J3E5	uncultured_Caudovirales_phage	7.4e-81	56.6
WP_153388613.1\|4435815_4436736_-	hypothetical protein	A0A2H4J580	uncultured_Caudovirales_phage	5.4e-35	35.4
WP_153388614.1\|4437014_4437245_+	hypothetical protein	NA	NA	NA	NA
WP_153388615.1\|4437440_4437671_-	hypothetical protein	NA	NA	NA	NA
WP_153389183.1\|4437816_4438515_+	XRE family transcriptional regulator	W6MVG5	Pseudomonas_phage	7.2e-64	57.4
WP_153388616.1\|4438889_4439195_+	hypothetical protein	A0A2H4JA92	uncultured_Caudovirales_phage	5.4e-08	60.0
WP_153388617.1\|4439271_4439709_+	tellurite resistance protein	Q1MVI3	Enterobacteria_phage	1.1e-46	65.7
WP_153388618.1\|4440580_4440865_+	hypothetical protein	NA	NA	NA	NA
WP_153388619.1\|4440861_4441176_+	hypothetical protein	NA	NA	NA	NA
WP_153388620.1\|4441257_4441638_+	hypothetical protein	NA	NA	NA	NA
WP_153388621.1\|4441959_4442163_-	hypothetical protein	NA	NA	NA	NA
WP_153388622.1\|4442259_4442448_-	hypothetical protein	NA	NA	NA	NA
WP_153388623.1\|4442525_4444331_+	DNA cytosine methyltransferase	A0A1I9KFW0	Aeromonas_phage	4.6e-102	36.0
WP_153388624.1\|4444374_4445016_+	hypothetical protein	A0A2I7RIF7	Vibrio_phage	7.4e-15	30.0
WP_153388625.1\|4445012_4445327_+	DUF4406 domain-containing protein	A0A0M4S3W0	Mycobacterium_phage	2.5e-16	47.8
WP_153388626.1\|4445381_4445765_-	hypothetical protein	NA	NA	NA	NA
WP_153388627.1\|4445761_4446064_-	hypothetical protein	NA	NA	NA	NA
WP_153389184.1\|4446568_4446838_+	hypothetical protein	A0A1B0VM42	Pseudomonas_phage	1.3e-37	73.0
WP_153388628.1\|4446887_4447310_+	hypothetical protein	A0A218M341	Acidovorax_phage	2.7e-05	54.8
WP_153388629.1\|4447888_4448095_+	hypothetical protein	NA	NA	NA	NA
WP_055135598.1\|4448131_4448365_+	hypothetical protein	A0A2H4JA17	uncultured_Caudovirales_phage	2.7e-31	87.0
WP_153388630.1\|4448364_4449501_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J1K3	uncultured_Caudovirales_phage	3.5e-201	90.7
WP_153388631.1\|4449870_4451154_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
4451002:4451017	attR	NA	NA	NA	NA
WP_058545772.1\|4451824_4452598_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_058545771.1\|4452594_4453806_-	O-succinylhomoserine sulfhydrylase	NA	NA	NA	NA
WP_003203840.1\|4453864_4455370_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	5.9e-87	41.8
WP_039593931.1\|4455411_4455972_-	colicin V production protein CvpA	NA	NA	NA	NA
WP_058546592.1\|4456061_4456736_-	cell division protein	NA	NA	NA	NA
WP_058546591.1\|4456719_4458027_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_058546590.1\|4458023_4458944_-	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_058546589.1\|4459196_4459829_-	phosphoribosylanthranilate isomerase	NA	NA	NA	NA
WP_058546593.1\|4459892_4460717_-\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA

DBSCAN-SWA_4

4840968 : 4877446

uncultured_Caudovirales_phage(42.42%)

integrase,terminase,holin,tail,capsid,head,lysis,plate,portal

attL 4834877:4834896|attR 4877475:4877494

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4834877:4834896	attL	NA	NA	NA	NA
WP_153388736.1\|4840968_4842246_-	translesion error-prone DNA polymerase V subunit UmuC	I6RSM4	Salmonella_phage	1.7e-111	51.3
WP_014338712.1\|4842238_4842664_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	5.3e-17	43.0
WP_153388737.1\|4842762_4843464_+	hypothetical protein	A0A2H4J5W2	uncultured_Caudovirales_phage	6.1e-55	48.4
WP_153388738.1\|4843460_4843652_-	hypothetical protein	NA	NA	NA	NA
WP_153388739.1\|4843735_4844530_-	DNA adenine methylase	C7BGE1	Burkholderia_phage	5.4e-100	65.8
WP_153388740.1\|4844679_4845222_-\|lysis	lysis protein	B5TK84	Pseudomonas_phage	1.9e-51	66.1
WP_153388741.1\|4845203_4845767_-	glycoside hydrolase family 19 protein	B5TK83	Pseudomonas_phage	8.4e-79	76.5
WP_153388742.1\|4845834_4846881_-	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	2.5e-145	73.0
WP_153388743.1\|4846944_4847151_-\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	3.8e-21	68.7
WP_153389187.1\|4847125_4847890_-\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	1.3e-87	64.8
WP_153388744.1\|4847980_4850560_-\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	1.1e-64	32.4
WP_014339635.1\|4850660_4850987_-\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_079302217.1\|4851053_4851563_-\|tail	phage major tail tube protein	A0A2H4JBU0	uncultured_Caudovirales_phage	1.5e-66	70.7
WP_153388745.1\|4851575_4852739_-\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	1.6e-185	82.4
WP_153388746.1\|4852826_4853252_-\|tail	phage tail protein	A0A291LAV4	Bordetella_phage	1.3e-28	52.9
WP_153388747.1\|4853261_4855163_-\|tail	phage tail protein	A4PE45	Ralstonia_virus	1.2e-73	54.8
WP_153388748.1\|4855162_4855765_-\|tail	phage tail protein I	A0A2H4JDH5	uncultured_Caudovirales_phage	2.0e-78	69.2
WP_153388749.1\|4855761_4856646_-\|plate	baseplate assembly protein	A0A2H4JFK9	uncultured_Caudovirales_phage	3.5e-108	70.0
WP_123351333.1\|4856642_4856969_-\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.1e-33	65.7
WP_153388750.1\|4856973_4857174_-	hypothetical protein	A0A2H4J885	uncultured_Caudovirales_phage	1.2e-11	55.7
WP_153388751.1\|4857281_4857845_-\|plate	phage baseplate assembly protein V	A0A2H4JG06	uncultured_Caudovirales_phage	1.2e-53	63.8
WP_153388752.1\|4857841_4858372_-	hypothetical protein	A0A2H4J881	uncultured_Caudovirales_phage	6.3e-44	50.3
WP_153388753.1\|4858364_4859027_-	hypothetical protein	A0A2H4JBV1	uncultured_Caudovirales_phage	7.5e-71	62.0
WP_153388754.1\|4859023_4859344_-	hypothetical protein	NA	NA	NA	NA
WP_153388755.1\|4859343_4859532_-	hypothetical protein	NA	NA	NA	NA
WP_153388756.1\|4859533_4860565_-\|capsid	major capsid protein	A0A0C5ABI0	Bacteriophage	1.5e-70	41.4
WP_153388757.1\|4860577_4860928_-\|head	head decoration protein	A0A2D1GMY6	Marinobacter_phage	4.1e-07	36.5
WP_153388758.1\|4860940_4862161_-	S49 family peptidase	A0A2H4EXF7	Aeromonas_phage	9.7e-48	42.6
WP_153388759.1\|4862163_4863771_-\|portal	phage portal protein	A0A067ZJA4	Vibrio_phage	9.7e-96	42.8
WP_149632521.1\|4863773_4863989_-	hypothetical protein	NA	NA	NA	NA
WP_149632522.1\|4864000_4865890_-\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	7.7e-169	50.2
WP_149632523.1\|4865933_4866458_-\|terminase	terminase small subunit	A0A2D1GMW4	Marinobacter_phage	2.8e-20	37.8
WP_149632524.1\|4866576_4866918_-\|holin	pyocin R2, holin	B5TK61	Pseudomonas_phage	2.6e-43	85.7
WP_153388760.1\|4867430_4867790_-	hypothetical protein	NA	NA	NA	NA
WP_153388761.1\|4867782_4870002_-	toprim domain-containing protein	A0A2D1GN57	Marinobacter_phage	9.9e-192	47.0
WP_072394137.1\|4869991_4870219_-	TraR/DksA family transcriptional regulator	A2I309	Vibrio_virus	1.3e-06	40.8
WP_134923544.1\|4870211_4870772_-	hypothetical protein	NA	NA	NA	NA
WP_072348365.1\|4871057_4871285_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_153388762.1\|4871451_4872225_+	helix-turn-helix domain-containing protein	A0A1B0Z078	Pseudomonas_phage	3.1e-60	50.4
WP_153388763.1\|4872251_4872563_+	hypothetical protein	NA	NA	NA	NA
WP_053124096.1\|4872829_4873414_+	hypothetical protein	NA	NA	NA	NA
WP_072348346.1\|4873424_4873709_+	DNA-binding protein	NA	NA	NA	NA
WP_153388764.1\|4873849_4874257_+	hypothetical protein	NA	NA	NA	NA
WP_153388765.1\|4874253_4874583_+	transcriptional regulator	NA	NA	NA	NA
WP_153388766.1\|4874627_4875059_+	hypothetical protein	NA	NA	NA	NA
WP_153388767.1\|4875055_4875277_+	hypothetical protein	NA	NA	NA	NA
WP_153388768.1\|4875273_4875816_+	phosphohydrolase	A0A2D1GNL9	Pseudomonas_phage	1.7e-28	43.6
WP_153388769.1\|4876237_4877446_+\|integrase	tyrosine-type recombinase/integrase	J7HXC4	Pseudomonas_phage	1.3e-132	60.2
4877475:4877494	attR	NA	NA	NA	NA

DBSCAN-SWA_5

6056325 : 6105943

Lake_Baikal_phage(25.0%)

holin,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_135847519.1\|6056325_6056832_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_058543388.1\|6057170_6058058_+	acyltransferase	NA	NA	NA	NA
WP_058543387.1\|6058058_6058631_-	DUF2780 domain-containing protein	NA	NA	NA	NA
WP_058543386.1\|6058933_6059356_+	DUF3757 domain-containing protein	NA	NA	NA	NA
WP_058543385.1\|6059836_6060049_+	cold shock domain-containing protein	A0A2H4N7Y6	Lake_Baikal_phage	3.9e-13	54.7
WP_003206297.1\|6060166_6061366_-	formaldehyde dehydrogenase, glutathione-independent	A0A2K9L7I1	Tupanvirus	2.9e-12	29.7
WP_058543384.1\|6061488_6062346_-	formyltetrahydrofolate deformylase	NA	NA	NA	NA
WP_058543383.1\|6062529_6063162_-	sarcosine oxidase subunit gamma family protein	NA	NA	NA	NA
WP_153389022.1\|6063259_6066277_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_003206305.1\|6066273_6066603_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_008057117.1\|6066617_6067868_-	sarcosine oxidase subunit beta	NA	NA	NA	NA
WP_003206308.1\|6067889_6069143_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	2.5e-99	52.7
WP_081264434.1\|6069444_6070149_-	conjugal transfer protein TraX	NA	NA	NA	NA
WP_058543380.1\|6070346_6071387_+	low specificity L-threonine aldolase	NA	NA	NA	NA
WP_058543379.1\|6071558_6072659_-	glycine-betaine demethylase subunit GbcB	NA	NA	NA	NA
WP_064106876.1\|6072942_6074238_+	glycine-betaine demethylase subunit GbcA	NA	NA	NA	NA
WP_058543659.1\|6074340_6075585_-	hypothetical protein	NA	NA	NA	NA
WP_153389023.1\|6075612_6077481_-	hypothetical protein	NA	NA	NA	NA
WP_153389024.1\|6077676_6081129_-\|holin	choline dehydrogenase	NA	NA	NA	NA
WP_153389025.1\|6082256_6083027_-	electron transfer flavoprotein subunit beta	NA	NA	NA	NA
WP_116643679.1\|6083040_6084261_-	electron transfer flavoprotein subunit alpha/FixB family protein	NA	NA	NA	NA
WP_153389026.1\|6084257_6086210_-	dimethylglycine demethylation protein DgcB	NA	NA	NA	NA
WP_058545294.1\|6086418_6088479_-	dimethylglycine demethylation protein DgcA	NA	NA	NA	NA
WP_030139308.1\|6088494_6089025_-	hypothetical protein	NA	NA	NA	NA
WP_030139307.1\|6089103_6090081_-	membrane dipeptidase	NA	NA	NA	NA
WP_058545295.1\|6090316_6090718_+	DUF1311 domain-containing protein	NA	NA	NA	NA
WP_058545296.1\|6090775_6091192_+	DUF3010 family protein	NA	NA	NA	NA
WP_116643676.1\|6091393_6092569_-	hypothetical protein	NA	NA	NA	NA
WP_058545298.1\|6092637_6093597_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_058545299.1\|6093783_6094728_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_014340599.1\|6094799_6095687_+	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_058545461.1\|6095849_6096815_+	L-carnitine dehydrogenase	NA	NA	NA	NA
WP_058545451.1\|6096946_6097423_+	4-hydroxybenzoyl-CoA thioesterase	NA	NA	NA	NA
WP_058545452.1\|6097443_6098607_+	gamma-butyrobetaine dioxygenase	NA	NA	NA	NA
WP_116643675.1\|6098989_6099253_+	hypothetical protein	NA	NA	NA	NA
WP_058545454.1\|6099336_6100440_-	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_058545455.1\|6101103_6102480_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_058545456.1\|6102904_6103852_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_058545457.1\|6103922_6104768_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_058545458.1\|6104764_6105943_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-26	37.6

DBSCAN-SWA_6

6415177 : 6454089

uncultured_Caudovirales_phage(40.0%)

plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058542700.1\|6415177_6416512_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_058542701.1\|6416527_6417028_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_153389085.1\|6417096_6418581_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_058542703.1\|6418997_6420035_+	type VI secretion system protein TssA	NA	NA	NA	NA
WP_003206923.1\|6420116_6420623_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_058542704.1\|6420625_6422122_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_003206927.1\|6422342_6422831_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_058542705.1\|6422912_6423362_+	hypothetical protein	NA	NA	NA	NA
WP_116643591.1\|6423361_6423799_+	hypothetical protein	NA	NA	NA	NA
WP_058542707.1\|6423792_6424305_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_153389086.1\|6424301_6426161_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_058542709.1\|6426124_6427177_+\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_153389087.1\|6427169_6429848_+	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	2.6e-85	32.3
WP_058545368.1\|6430008_6431946_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.7e-42	27.3
WP_058545367.1\|6431964_6432399_+	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_153389088.1\|6432411_6436851_+	RES domain-containing protein	A0A2H4JFP5	uncultured_Caudovirales_phage	4.8e-28	51.2
WP_116643585.1\|6436852_6437131_+	hypothetical protein	NA	NA	NA	NA
WP_153389089.1\|6437203_6441586_+	type IV secretion protein Rhs	A0A2H4JFP5	uncultured_Caudovirales_phage	5.1e-30	38.5
WP_058545365.1\|6441600_6442035_+	hypothetical protein	NA	NA	NA	NA
WP_153389090.1\|6442621_6442981_+	hypothetical protein	B5TK57	Pseudomonas_phage	2.5e-28	61.3
WP_153389091.1\|6443257_6443542_-	hypothetical protein	NA	NA	NA	NA
WP_153389092.1\|6443508_6443841_-	hypothetical protein	NA	NA	NA	NA
WP_153389093.1\|6443851_6447463_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_153389094.1\|6447472_6448909_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_153389095.1\|6448896_6449517_-	type VI secretion system-associated protein TagO	NA	NA	NA	NA
WP_153389096.1\|6449885_6450389_+	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_153389195.1\|6450425_6451898_+	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_153389097.1\|6451898_6452312_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_153389098.1\|6452322_6454089_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr_ID: NZ_CP045701.1|WP_058546692.1|1370602_1370797_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP045701.1|WP_058546692.1|1370602_1370797_+|hypothetical-protein

1370602_1370797_+

64 aa aa

1282203-1390392

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP045701_2	Orphan	2.1\|2021736\|35\|NZ_CP045701\|CRISPRCasFinder	2021736-2021770	35	1336406-1336440	2

1. spacer 2.1|2021736|35|NZ_CP045701|CRISPRCasFinder matches to NZ_CP045701 position: 1336406-1336440, mismatch: 2

tacacccatccgatctgtgggagcaaagcttgctc	CRISPR spacer
tacacccatcatatctgtgggagcaaagcttgctc	Protospacer
**********  ***********************

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045701

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information