CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045700	Vibrio sp. SM1977 chromosome 2, complete sequence	0 crisprs	DEDDh,csa3	0	0	3	0
NZ_CP045699	Vibrio sp. SM1977 chromosome 1, complete sequence	1 crisprs	cas3,DEDDh,cas5f,cas7f,cas6f,csx1,DinG,csa3,RT	0	0	4	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045699_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045699_1

967831-967918

Unclear

Consensus_repeat	Method
GTGACCTGCCGAGTAGGCAGCTAAAAAT	CRISPRCasFinder

1 spacers

cas6f,cas7f,cas5f

The CRISPR arrays of NZ_CP045699_1

>merge|NZ_CP045699|1|967831-967918|CRISPRCasFinder
GTGACCTGCCGAGTAGGCAGCTAAAAATGCACTATCTCAAGAGCAGATCAATTGGATGCGGTGACCTGCCGAGTAGGCAGCTAAAAAT

>NZ_CP045699|1|1|967831-967918|CRISPRCasFinder
GTGACCTGCCGAGTAGGCAGCTAAAAAT	GCACTATCTCAAGAGCAGATCAATTGGATGCG
GTGACCTGCCGAGTAGGCAGCTAAAAAT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045699.1\|WP_153446855.1\|970586_971516_+\|PD-(D/E)XK-nuclease-superfamily-protein	unknown	unknown	unknown
NZ_CP045699.1\|WP_153446851.1\|969765_970098_-\|DUF1508-domain-containing-protein	unknown	unknown	gnl\|CDD\|225956
NZ_CP045699.1\|WP_153446844.1\|963945_966045_+\|hypothetical-protein	cas5f	cd09736_cas5f_CAS-I-F	gnl\|CDD\|187867
NZ_CP045699.1\|WP_153446830.1\|954513_954828_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP045699.1\|WP_153446853.1\|970293_970446_+\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|379184
NZ_CP045699.1\|WP_153448149.1\|973537_974134_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|271188
NZ_CP045699.1\|WP_153446842.1\|962731_963943_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP045699.1\|WP_153448147.1\|966073_967105_+\|type-I-F-CRISPR-associated-protein-Csy3	cas7f	cd09737_cas7f_CAS-I-F	gnl\|CDD\|187868
NZ_CP045699.1\|WP_153446848.1\|968135_968540_+\|S24-family-peptidase	unknown	unknown	gnl\|CDD\|182350
NZ_CP045699.1\|WP_153446836.1\|958288_959284_+\|Abi-family-protein	unknown	unknown	gnl\|CDD\|227160
NZ_CP045699.1\|WP_153446832.1\|954940_955462_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045699.1\|WP_153446838.1\|959365_960865_+\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|280533
NZ_CP045699.1\|WP_153448148.1\|972864_973347_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378077
NZ_CP045699.1\|WP_153446859.1\|974408_974879_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379326
NZ_CP045699.1\|WP_153446834.1\|955592_958049_+\|DEAD/DEAH-box-helicase	unknown	unknown	gnl\|CDD\|226581
NZ_CP045699.1\|WP_153446857.1\|971834_972392_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045699.1\|WP_153446840.1\|960864_962610_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341173
NZ_CP045699.1\|WP_108092694.1\|975153_976026_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
NZ_CP045699.1\|WP_153446846.1\|967101_967713_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	cd09739_cas6f_CAS-I-F:CAS-IV	gnl\|CDD\|187870
NZ_CP045699.1\|WP_153446849.1\|968544_969705_+\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|176454

Protein	Function_ID	Function_description	E-value
NZ_CP045699.1\|WP_153446844.1\|963945_966045_+\|hypothetical-protein	gnl\|CDD\|187867	cd09736, Csy2_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy2. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas5 ortholog.	1.49365e-15
NZ_CP045699.1\|WP_153446830.1\|954513_954828_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	4.73756e-12
NZ_CP045699.1\|WP_153446853.1\|970293_970446_+\|DUF4113-domain-containing-protein	gnl\|CDD\|379184	pfam13438, DUF4113, Domain of unknown function (DUF4113). Although the function is not known this domain occurs almost invariably at the very C-terminus of the IMS family DNA-polymerase repair proteins, IMS, pfam00817.	9.29882e-15
NZ_CP045699.1\|WP_153448149.1\|973537_974134_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|271188	cd01188, INT_RitA_C_like, C-terminal catalytic domain of recombinase RitA, a component of the recombinase trio. Recombinases RitA (also known as pAE1), RitB, and RitC are encoded by three adjacent and overlapping genes. Collectively they are known as the Recombinase in Trio (RIT). This RitA family includes various bacterial integrases and integrases from the deletion-prone region of plasmid pAE1 of Alcaligenes eutrophus H1. All three integrases contain a catalytic motif, suggesting that they are all active enzymes. However, their specific roles are not fully understood. All three families belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	4.68377e-34
NZ_CP045699.1\|WP_153446842.1\|962731_963943_+\|hypothetical-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	8.90418e-10
NZ_CP045699.1\|WP_153448147.1\|966073_967105_+\|type-I-F-CRISPR-associated-protein-Csy3	gnl\|CDD\|187868	cd09737, Csy3_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas7 ortholog.	7.54548e-119
NZ_CP045699.1\|WP_153446848.1\|968135_968540_+\|S24-family-peptidase	gnl\|CDD\|182350	PRK10276, PRK10276, translesion error-prone DNA polymerase V autoproteolytic subunit.	2.53997e-21
NZ_CP045699.1\|WP_153446836.1\|958288_959284_+\|Abi-family-protein	gnl\|CDD\|227160	COG4823, AbiF, Abortive infection bacteriophage resistance protein [Defense mechanisms].	3.18957e-64
NZ_CP045699.1\|WP_153446851.1\|969765_970098_-\|DUF1508-domain-containing-protein	gnl\|CDD\|225956	COG3422, COG3422, Uncharacterized conserved protein [Function unknown].	3.07726e-23
NZ_CP045699.1\|WP_153446838.1\|959365_960865_+\|N-6-DNA-methylase	gnl\|CDD\|280533	pfam02384, N6_Mtase, N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.	2.83966e-108
NZ_CP045699.1\|WP_153448148.1\|972864_973347_+\|hypothetical-protein	gnl\|CDD\|378077	pfam08877, MepB, MepB protein. MepB is a functionally uncharacterized protein in the mepRAB gene cluster of Staphylococcus aureus.	1.08311e-33
NZ_CP045699.1\|WP_153446859.1\|974408_974879_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379326	pfam13673, Acetyltransf_10, Acetyltransferase (GNAT) domain. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.32018e-31
NZ_CP045699.1\|WP_153446834.1\|955592_958049_+\|DEAD/DEAH-box-helicase	gnl\|CDD\|226581	COG4096, HsdR, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NZ_CP045699.1\|WP_153446840.1\|960864_962610_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341173	cd17284, RMtype1_S_Cbo7060ORF11580P_TRD2-CR2_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to Clostridium botulinum CFSAN024410 S subunit (S.Cbo7060ORF11580P) TRD2-CR2 and Shewanella xiamenensis BC01 S subunit (S.SxiBC01ORF77P) TRD1-CR1. The recognition sequences of Clostridium botulinum CFSAN024410 S subunit (S.Cbo7060ORF11580P) and Shewanella xiamenensis BC01 S subunit (S.SxiBC01ORF77P) are undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one heteromeric enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	3.72775e-65
NZ_CP045699.1\|WP_108092694.1\|975153_976026_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	8.456e-12
NZ_CP045699.1\|WP_153446846.1\|967101_967713_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|187870	cd09739, Cas6_I-F, CRISPR/Cas system-associated RAMP superfamily protein Cas6f. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6f is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-F subtype; Possesses RRM fold; also known as Csy4 family.	7.09812e-41
NZ_CP045699.1\|WP_153446849.1\|968544_969705_+\|DUF4113-domain-containing-protein	gnl\|CDD\|176454	cd01700, PolY_Pol_V_umuC, umuC subunit of DNA Polymerase V. umuC subunit of Pol V. Pol V is a bacterial translesion synthesis (TLS) polymerase that consists of the heterotrimer of one umuC and two umuD subunits. Translesion synthesis is a process that allows the bypass of a variety of DNA lesions. TLS polymerases lack proofreading activity and have low fidelity and low processivity. They use damaged DNA as templates and insert nucleotides opposite the lesions. Pol V, RecA, single stranded DNA-binding protein, beta sliding clamp, and gamma clamp loading complex are responsible for inducing the SOS response in bacteria to repair UV-induced DNA damage.	3.43293e-129

>NZ_CP045699.1|WP_153446846.1|967101_967713_+|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MTQRYYFIVKFLLEDVDAGLLAGRCISTLHGFINNNLTGKNQVGVSFPLWSDDTLGNAVAFVADDKELLIGLSFQPYFSLMKSEELFDLSPVVPVPTDLPEIRFVRNQTIGKSFLGSKRRRMKRAQSRAETMGKLITPQPNEEREFELFHRVPLTSKSTGEEMMLHVQKQSNVEVVDTNFNAYGLATNQAWKGTVPDLKNAML
>NZ_CP045699.1|WP_153448147.1|966073_967105_+|type-I-F-CRISPR-associated-protein-Csy3
MKLCKQLNYVRSLSSGKACFFFLDNDQKMQPISIDRTRLRGSKGDYSQAYSGDLKRKNVAPHELAQGNIHFIEECYVPPTVNEIYCAFSLRIKANSLKPEVCSDEEVRVTLTHLAMLYAENGGYEELAQRYAKNILLGTWLWRNRESRGVRIEVLNSEQTSFVIENALKLSWHGSWDKKSTTVLNKLTHYLTQALTSSQDYFYMDIKATISVGWGDEVFPSQEFLDQKENGKPTKRLSTVCLPDELETVAFHAQKVGAAIQCIDDWWQDDADKPLRVNEYGADREYVIARRHSSLNTDFYYLISQAEHWIDVLNQSKTIPDEVHFIMSVLVKGGLFNSSKDSQ
>NZ_CP045699.1|WP_153446844.1|963945_966045_+|hypothetical-protein
MTKLSELIAIENLTDRQAALKKAFMPYSDLVEVDGNERDALRVLVNLSLTKPECKNWLDKERAKQYLSNPENISIGCDEVKWMHTHNLKFPDCRVAKQRLLAEPLICDESFISSTSVMSSLGWSHNSAVYKHTIWLLNEFMWQGNPTNILCFIAQQDEFWLKVLKSCGLKVAAFKALKNAIEKDLPTSTLPNRVDPFSKQVRFPWNNDYLSITPVVSHVMQVELERMSRQSGRTLKFTTMYFPNSPSIGNLCGSLGGNMKVLHYPIEVQASKKRTFSSSKNQTQCFFDDYQLTNAKFCKVLSHLCGAEALKTRKQRKHVRQYQLRIARKQIGLWLLPLIELRDHIDSELDSHIIDSDDPIIDPFLYGTESKLSELLILLNQRLHQTLQNNRYSSRYAYHPELLSVLKIQLKWILEQLSSPQAAPNDYGDHKVNHDEQEQYIHLSSLRVEDANAMSCPYLCGAPSLTSIWGFVHNYQRQLNQSLDGAATFEFESFAVFIRNENINMTAKLTEPSVLAAKRTLSHAKRPTIIATNLVDIEFDMVIKVRSVGRLSDYGRQLKTSLPTIFSGGALFQPRLDSADNWLCCYQKQSDVFYRIKSLPAYGVWLVPSDLQPTRFSELASILAQDDSLIPISNGYHFLEQPTLRSNSLTSLHAYAENTLGVAKRLNPIDVRFSAKDHFFKQAFWTQHNYSASILIPKA
>NZ_CP045699.1|WP_153446842.1|962731_963943_+|hypothetical-protein
MEFKFTHYPDETLESFLLRLSQYQGYERFAHFAEDLWHETLEQHEAMAGAFPFELSRVNLYHAQTSSQMRVRVFMHLAKKFELPQFNIMNTPLSHSKAIFSPNYKAVFRNNIDYPFSFLRKRFTPVCSQCLAQSPHIRQQWQFIPHQACHIHHIKLLHHCPECKTRLEYQSTESITQCDCGYDLTMAIPEQAGVSQVQVARWLMGEVVDDAGLMASSISISERYGFLLWYVNRYGELEGINMESFVHYCESWPKGLQQDLNATFNKADMVRVRPWNKTFFHEVFGTLLKDCRQLPNRRINHNPVLMAVLDGLTQLIANNPRNKQANIGDVLLSPLEASTLLSCTTDEIYRLYEFGELKAAVRLKLHSKLASQQSAFTLRSIIEMKLARMCSSSDGMNVYLPDW
>NZ_CP045699.1|WP_153446840.1|960864_962610_+|restriction-endonuclease-subunit-S
MSNEHSREHNVESLITEHIDIWTSTIKSKSASGRGSSKKIDLYGIKKLRELILELAVRGKLVPQDPSDEPAEVLLERIAIEKAQLVKDKKIKKPKALPEISEEEKPFELPNGWEWSRLGNTGFGSTGKTPNTKKVEYFKGNIPFIGPGQITLNGQILESEKFLSAEGLKNSTECVLGDILMVCIGGSIGKAAIAKQTMGFNQQINAIRALKIRSEYLYLAVSTITFYEELLDISTGSATPIINRGKWEELLVPIPPLQEQHRIVAKVDELMILCDQLESQTEKQLSAHQQLVETLLATLVASENAAELNQNWKRLAAYFDLLFTTEVSIDQLKQTILQLAVMGKLVPQNPNDEPASKLLERIKAEKEQLIKDKIYQKTSKLKPINTDIQYPSNWVSVQTGQVCPSIVPNRDRPKSFTGNIPWVTLPAFPTQGFYLDNTNVELALTALEVQQYSARLIPEKSVLMSCVGRFGLTAINTTSVTSNQQVHAFIVLNGLLPEYLSMVIKVEGKFLENVATSTTIAYLNKTNCESIQFGLPPTEEQHRIVSKADALMAICDQLKTKLSESQQTQLHLTDAIVEQAV
>NZ_CP045699.1|WP_153446838.1|959365_960865_+|N-6-DNA-methylase
MSISSAIKSIQDIMRKDAGVDGDAQRLGQMSWLLFLKVFDAQEEELELELDNYKAPIPEKYLWRNWAQDSQGITGDALLEFVNDDLFYNLKNFTAPVDLNPRGHVVKEAFSDAFNYMKNGTLLRQVINKLNEIDFTDSSERHLFGDIYEQILRDLQSAGNSGEFYTPRAVTRFIVNRLDPKLGETIMDPATGTGGFLACSFDHVKENYVNTAADHQTLQQQIHGVEKKQLPHLLCITNMMLHGIEVPVQIKHGNTLNKPLSSWDSNINVIATNPPFGGTEEDGIEKNFPSDMQTRETADLFLQLIIEVLDSGDETKAGGRAGVVLPDGTLFGEGVKTKIKKMLTEECNLHTIVRLPNGVFNPYTGIKTNILFFTKGTPTKDVWFYEHPYPEGVKNYNKTKPMKFEEFQAEIDWWGCEEDGFASRVETHQAWKVSIDDIIARNFNLDIKNPYQGEVVNHDPVALLAEYQTQQAEISELRNQLKDILGAALTSGSQSGEQA
>NZ_CP045699.1|WP_153446836.1|958288_959284_+|Abi-family-protein
MPLTPAKPFKQYDELINILTDRGMHIADTPRAIRKLTQVGYYRLSGFWYPARKIQRDDNQNPINCEFLNRPKRSNHFEPKTQFEQVVNLYLFDKQLRLVMLDGLERIEVYIRSVIAHELGRGKAKMPGSGDDIPDPLAWQDADYINGKFLTRKGNKRSLWSDWQNKHEKLIKRSREDCIVWHQRNDKEMPFWVVIEAWDFGTLSKYYGMLKDKYRQNICAKLGITDKKETDVLRAWLMEMNILRNRCAHHTRIWNQQSSKQLKLTSHAYFDDIRGDENTLSRLYGVMRVMWFLIEQIGPNSTWFKQLNHLIEEFPTVPGCPLSSLGLPNPH
>NZ_CP045699.1|WP_153446834.1|955592_958049_+|DEAD/DEAH-box-helicase
MTTSINKSKLSETDIITKFILPAVKQAGWDDMTQIRQEVKLRDGKVIVRGQAAARKKVKSADIVLYHKPSMPLAVIEAKANKHEVGKGMQQGLDYANLLEVPFIFASNGDGFIFHDKTNLSQLETEIQLEDFPTPAQLWEKFCIWKGYKTEHLPVITQDYHDDGSGKSPRYYQLQAINKTVEAIASGQDRVLLVMATGTGKTYTAFQIIWRLWKSKAKKRILFLADRNILVDQTKTNDFQPFGPAMTKVTGRTVDPAYEIHLALYQALTGPEESQKAYKQVDPDFFDLIVIDECHRGSASEESAWREILEYFSSASQVGLTATPKETDEVSNIEYFGDPVYSYTLKQGIEDGFLAPYKVVRVDIDVDVQGWRPRKGQTDKDGNIIEDRIYNQKDFDRTMVIDERTDLVAQTITNYLKRTDPMAKTIVFCNDIDHAERMRRALVNLNPEQMAKNEKYVMKITGDDEIGKAQLDNFINPKRKYPVIATTSELMTTGVDAQTCKLVVLDQGIQSMTKFKQVIGRGTRINDKYGKLWFTILDFKKATELFADEKFDGEPERIKVTKPEDFDNPEGITDIVDGVDPEDIIDADYPFGDDIDPDSIHEPDAPFGTPSGDNDPTNTTGGDDWTDEEKIRKYHVNGVQVKALAERVQYYDTDGKLVTESFKDYTRKTIAKQFTSLNDFTKKWQDADRKQAIIDELAEEGIIWQALEEEVGKDMDPFDMICHVAYDMPMLTRKERAENVKKRNYFTKYGETAQVVLSNLLDKYADEGVTEIENIHVLKVKPFDEMGRPLEIIKKGFGGKQAYLEAVNELEAEIYQSA
>NZ_CP045699.1|WP_153446832.1|954940_955462_+|hypothetical-protein
MKKEKDFIRKFLIENEMSDFTVRDVVNLLMLKDSSFDVRKKTYQYVYRNVCRLETLGRLRSYGFQRHRRFKKLGALYLKESNFELNGLNTIFQDNPILAELDDEKAKAETDLAIVLGEVDEYKTLISRLPKHKSVLQGLIVQTSDKSARLLGKINALSTVIEYSSTNIDDRGV
>NZ_CP045699.1|WP_153446830.1|954513_954828_-|helix-turn-helix-domain-containing-protein
MQKDNPIPARLKAARKKAKITQKNLGVKIGMEESSASGRMNHYEKGRHIPDIGTLRRMAEELDVPLNYFFCDDDVMAELVCAINKLSDNDKLDLIDTLKKKSNV
>NZ_CP045699.1|WP_153446848.1|968135_968540_+|S24-family-peptidase
MKVIPISAGAGITGFESPAAEYSQLSLSLDDLLVDHPSSTFLCKACGDSMQNVGIFSQDILIVDRHEVAKNLDVVVANFNGEFVCKIIDMKNRLLLSANEKIQPVAVFDYDQFSIEGVVVRSIRCHRPSYLLAS
>NZ_CP045699.1|WP_153446849.1|968544_969705_+|DUF4113-domain-containing-protein
MFALVDANAFYCSAEQVFRPDLRGKPLVVLSNNDGCIVAANRQAKELGIPKFAPFFKVRELCEKQGVIALSSNYELYADLSAKMMAVIGRFAPVQHIYSIDESFLSLRHCHQAIPCLLTHGALIRRAVWKECRLPVCVGMGETLTLAKLANHAAKKIEGYQGVCILNNETARQQVLKSVDVSEVWGIGRRLSAKLKVMKVHTAWDLSRLEPAVAQRQFNVEVERIVYLHSLQQALSKHTAIAAYKARQQHSLCKVLMCFAASSPYDVKPVSHKMVHSFAYPTSDTTVLTHTVMAMAKAMFQQGERYYKIGVGLLDLVEGKHAQIDFLNPKPDDPRLMAVFDGLNQRYGTDSVFLAAQGIEHKWAMRRERLSPQYTTKWGDLPVVRC
>NZ_CP045699.1|WP_153446851.1|969765_970098_-|DUF1508-domain-containing-protein
MSGKFEMYTDAAGEFRFRLKAGNGQNILASEGYTTKASCENGIESVKTNAPDDSRFERKETASGKHMFNLKAGNHQVIGTSQSYASIASRDNGIESVKTNAPSAQVEDLT
>NZ_CP045699.1|WP_153446853.1|970293_970446_+|DUF4113-domain-containing-protein
MGDALNQRYGTDSVFLVVQGFDEKWAMWRERLSPHYTTWWEGSADCEVLV
>NZ_CP045699.1|WP_153446855.1|970586_971516_+|PD-(D/E)XK-nuclease-superfamily-protein
MKELNTFQSVNERDVDLLVLEELNVSDSFAQWFVCRVREEITSIKTLGAWHSVVDTNLGESDLVYIYQSDDLSSQAILIENKIDASAQAQQGEIYRLRGNRGLEDGLWQDFRTCIIAPKAYIARNAEPYDAAISYEEIMVYLAAQGDKRGLYKAQTLRDAIEKNRRGYVATVCIKTTDFAQKYLAYASEHFPQLNPEQPKPRANGHDWIHFYPEPINKKIRIIHQIYGKVIKLQFLGQADNFDDIKSHFEGLECSGYRIIKSGKSVNIETPLPEISIAEQSFDSVLEEIGIALNKAQQLHSWMENYHSV
>NZ_CP045699.1|WP_153446857.1|971834_972392_-|hypothetical-protein
MSLKSNLVKVGCLVVAVVLFLSGYELGASITENRLTRLAYSEMYGWGSPLYSWSVTSNNKVISLKLPSGLRGNSSYIGMSSDRKAPFVIVKEVPSKGLRCLNVESKTIKIKNQFVNVEQQCLANGFVRISPISEEAIAYFQSVLESEEFISFHLSGEYIENFRSKHFMRSFEQYEKEIAALNRVL
>NZ_CP045699.1|WP_153448148.1|972864_973347_+|hypothetical-protein
MLDRYPQNSKYEALEFSIDGKKILYRKGNVTPDRPGNFLSIWKRPDENSTDPRRTMPYEEHDLDYLFVEVSDCDISKRGIYIFPLTALIDKGVVTSNKAKGKMAFRVFPPWTSSRGELKSKVFSDSAKKTQRWQSHFFLWIEDNEIVDLEKFNNIFSSLS
>NZ_CP045699.1|WP_153448149.1|973537_974134_+|tyrosine-type-recombinase/integrase
MVVFKKTKRSGVKKPFRLEEIWRIRTRLEIENSLMQLALLNLAIDSKLRASDLLSLRVCDVSSQDMIFSRVKHIQRKTDIEVQFEITTRTQQSLMKWILISSLNASDFLFPSQRRQQQPISYSYYRYLVRKWASDLGLDSNLYGTHSMRRTKATLVYAKTKNIRAVQLLLGHTKVDNTIRYLGVELEDALLLSEGTDC
>NZ_CP045699.1|WP_153446859.1|974408_974879_+|GNAT-family-N-acetyltransferase
MSVNIRSAVISDSKAISELILPLAKKYICPTCDASAHYILLNSMSEENVGKYLSTNYNYVIAVTANDEVVGVAGVRDNSHLYHLFVDDNFQGNGLSRQLWEAVKEESIKNGNSGIFTVNSAVNAESVYSRFGFKRTEGIRNRQGMIDIPMLLDLEY
>NZ_CP045699.1|WP_108092694.1|975153_976026_+|NAD(P)-dependent-oxidoreductase
MKVLIAGANGYIGSHVTKMFVESGFEVSTYSRASGVLPDARKLTKVPADLSGYFDIVVNCARPHWSEFSPEEIVDIESKLLTQLDRLAAEGATKIHTSGVWLFGNASHNDLKVFRLKPLDVVKLDAVTIGRAIKKKWHVVYCPSLVYGGENCQLKRIVDSLSDQTIQVAIPSQGHNQYIHVNDIARFYLSLVQGRISSAQHFIAETKGYSPEEFSQLLLDSRIIKKVSKSNWREFENIFGFSAVEIEKLNLKLPVSPLFEPKESLRKYIENYTYKRLRFQDTLSNPNLAC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

611789 : 619853

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153446370.1\|611789_613040_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A240F3L3	Aeromonas_phage	2.1e-98	52.5
WP_153446372.1\|613175_613973_+	sel1 repeat family protein	NA	NA	NA	NA
WP_153446373.1\|614059_614857_+	sel1 repeat family protein	NA	NA	NA	NA
WP_153446374.1\|614976_615306_-	hypothetical protein	A0A0U3TE12	Vibrio_phage	1.2e-21	52.3
WP_153446376.1\|615510_615960_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_153446377.1\|616034_617267_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	3.1e-41	31.9
WP_153446379.1\|617278_617938_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.3e-34	37.2
WP_153446381.1\|617985_619098_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	9.7e-63	38.3
WP_153446382.1\|619385_619853_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	2.4e-31	48.0

DBSCAN-SWA_2

973537 : 1060738

Vibrio_phage(53.19%)

head,terminase,tail,integrase,portal,capsid,protease,tRNA,transposase

attL 1028578:1028594|attR 1059352:1059368

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153448149.1\|973537_974134_+\|integrase	tyrosine-type recombinase/integrase	A0A090C6M9	Clostridium_phage	1.3e-05	32.1
WP_153446859.1\|974408_974879_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_108092694.1\|975153_976026_+	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_153446861.1\|976614_977771_-\|transposase	IS3 family transposase	Q716C2	Shigella_phage	1.9e-45	37.5
WP_153446862.1\|977868_980439_-	MMPL family transporter	NA	NA	NA	NA
WP_153446865.1\|980807_981341_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_153446867.1\|981455_981827_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_153446868.1\|981915_982077_-	hypothetical protein	NA	NA	NA	NA
WP_153446870.1\|982162_983770_-	ABC-F family ATPase	A0A2K9L3Z8	Tupanvirus	4.7e-50	27.5
WP_153446872.1\|984247_985801_-	SpoVR family protein	NA	NA	NA	NA
WP_153446873.1\|985820_987092_-	DUF444 family protein	A0A140HLI1	Bacillus_phage	1.4e-09	33.6
WP_153446874.1\|987190_989125_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_153446875.1\|989413_989914_-	YfbU family protein	NA	NA	NA	NA
WP_153446876.1\|990061_990802_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	7.2e-30	32.4
WP_153446877.1\|990994_993271_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	2.2e-162	42.9
WP_153446878.1\|993989_995381_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.6e-14	36.3
WP_153446879.1\|995630_997115_-	diguanylate cyclase	NA	NA	NA	NA
WP_153446880.1\|997384_999049_-	mechanosensitive ion channel	NA	NA	NA	NA
WP_153446881.1\|999366_1000137_+	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	7.6e-14	27.7
WP_153446882.1\|1000332_1001103_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_153448150.1\|1001175_1001919_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_153446883.1\|1001921_1002599_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_153446884.1\|1002996_1003803_-	exodeoxyribonuclease III	A0A0N9QXX6	Chrysochromulina_ericina_virus	4.3e-12	25.8
WP_153446885.1\|1003888_1004941_-\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	4.1e-95	49.7
WP_153446886.1\|1004944_1005319_-	hypothetical protein	R9TR46	Vibrio_phage	1.6e-22	52.8
WP_153446887.1\|1005337_1005853_-	hypothetical protein	NA	NA	NA	NA
WP_153446888.1\|1005881_1006562_-	transcriptional regulator	A0A1D9C9M6	Salinivibrio_phage	3.5e-31	40.6
WP_153446889.1\|1006634_1006847_+	hypothetical protein	NA	NA	NA	NA
WP_153446890.1\|1006981_1007518_+	transcriptional regulator	A0A2I7RNI1	Vibrio_phage	1.7e-41	50.3
WP_153446891.1\|1007545_1007758_+	hypothetical protein	NA	NA	NA	NA
WP_153448151.1\|1007781_1008186_+	hypothetical protein	R9TRR4	Vibrio_phage	1.8e-27	47.0
WP_153446892.1\|1008418_1008652_+	hypothetical protein	U3PIK2	Vibrio_phage	5.4e-16	54.2
WP_153446893.1\|1008648_1008933_+	hypothetical protein	NA	NA	NA	NA
WP_153446894.1\|1008948_1010958_+	hypothetical protein	A0A2I7RNF8	Vibrio_phage	5.0e-142	42.0
WP_153446895.1\|1010950_1011172_+	hypothetical protein	NA	NA	NA	NA
WP_153446896.1\|1011176_1011740_+	3'-5' exoribonuclease	K7PM77	Enterobacteria_phage	4.3e-43	50.0
WP_153446897.1\|1011736_1012051_+	DUF4406 domain-containing protein	A0A222YYT7	Escherichia_phage	3.7e-20	56.0
WP_153446898.1\|1012148_1012361_+	hypothetical protein	NA	NA	NA	NA
WP_153446899.1\|1012364_1012616_-	transcriptional regulator	R9TNQ2	Vibrio_phage	1.6e-29	75.9
WP_153446900.1\|1012763_1013336_+	hypothetical protein	NA	NA	NA	NA
WP_153446901.1\|1013429_1013615_+	hypothetical protein	NA	NA	NA	NA
WP_153446902.1\|1013681_1014779_-\|portal	phage portal protein	A0A1D9C9P9	Salinivibrio_phage	3.8e-128	64.7
WP_153446903.1\|1014784_1016578_-\|terminase	terminase	A0A1D9C9R1	Salinivibrio_phage	1.3e-255	75.5
WP_153446904.1\|1016765_1017641_+\|capsid	capsid protein	A0A1D9CA10	Salinivibrio_phage	3.0e-67	48.6
WP_153446905.1\|1017695_1018712_+\|capsid	phage major capsid protein, P2 family	A0A2I7RNH6	Vibrio_phage	5.7e-110	62.7
WP_153446906.1\|1018729_1019458_+\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	1.0e-73	53.5
WP_153446907.1\|1019609_1020074_+\|head	head protein	U3PFL1	Vibrio_phage	1.6e-43	63.0
WP_153446908.1\|1020070_1020565_+	hypothetical protein	R9TRS7	Vibrio_phage	1.5e-28	43.3
WP_153446909.1\|1020561_1021320_+	phage virion morphogenesis protein	R9TPZ7	Vibrio_phage	9.7e-30	35.1
WP_153446910.1\|1021352_1022471_+	DUF2586 family protein	A5X9I0	Aeromonas_virus	2.1e-113	57.9
WP_153446911.1\|1022495_1022951_+	DUF2597 family protein	A5X9I1	Aeromonas_virus	6.0e-51	62.9
WP_153448152.1\|1023015_1023198_+	transcriptional regulator	NA	NA	NA	NA
WP_153446912.1\|1023191_1023614_+	hypothetical protein	M4M9N1	Vibrio_phage	3.8e-44	63.0
WP_153446913.1\|1023670_1023982_+	hypothetical protein	A0A2I7RW63	Vibrio_phage	2.7e-10	36.2
WP_153446914.1\|1024024_1024321_+	hypothetical protein	NA	NA	NA	NA
WP_153446915.1\|1024357_1024642_+	hypothetical protein	NA	NA	NA	NA
WP_153446916.1\|1024683_1024827_+	hypothetical protein	NA	NA	NA	NA
WP_153446917.1\|1024848_1026738_+\|tail	phage tail tape measure protein	A0A2I7RNI7	Vibrio_phage	1.3e-128	44.9
WP_153446918.1\|1026730_1027069_+	DUF2590 family protein	A5X9J0	Aeromonas_virus	1.5e-22	55.4
WP_153446919.1\|1027089_1028274_+	hypothetical protein	R9TRT3	Vibrio_phage	2.3e-110	53.2
WP_153446920.1\|1028266_1028956_+\|tail	phage tail protein	U3PB79	Vibrio_phage	1.6e-55	50.2
1028578:1028594	attL	NA	NA	NA	NA
WP_153446921.1\|1028970_1030551_+	hypothetical protein	R9TNR5	Vibrio_phage	2.1e-82	37.9
WP_153446922.1\|1030550_1031270_+	hypothetical protein	R9TPW8	Vibrio_phage	1.5e-40	50.5
WP_153446923.1\|1031262_1031742_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_153446924.1\|1031719_1032616_+	hypothetical protein	U3PIM3	Vibrio_phage	8.7e-46	39.1
WP_153446925.1\|1032608_1033259_+	DNA-binding protein	A0A2I7RNK5	Vibrio_phage	2.3e-19	38.9
WP_153446926.1\|1033255_1034848_+	hypothetical protein	R9TNN7	Vibrio_phage	1.7e-148	50.6
WP_153446927.1\|1034847_1035045_+	hypothetical protein	R9TR72	Vibrio_phage	1.5e-19	78.5
WP_153446928.1\|1036110_1037271_-	cupin domain-containing protein	NA	NA	NA	NA
WP_153446929.1\|1037462_1038833_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	7.2e-116	48.2
WP_153446930.1\|1038920_1039538_-	high frequency lysogenization protein HflD	NA	NA	NA	NA
WP_153446931.1\|1039603_1040764_-\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_153446932.1\|1040872_1041574_-	pseudouridine synthase	NA	NA	NA	NA
WP_153446933.1\|1041760_1042981_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_153446934.1\|1042977_1043286_+	hypothetical protein	NA	NA	NA	NA
WP_153446935.1\|1043569_1044382_+	hypothetical protein	A0A126HHD5	Vibrio_phage	1.4e-29	37.9
WP_153446936.1\|1044534_1046382_+	hypothetical protein	A0A2I7RKF1	Vibrio_phage	1.3e-35	28.1
WP_153446937.1\|1046973_1047288_+	hypothetical protein	NA	NA	NA	NA
WP_153446938.1\|1047290_1048055_+	hypothetical protein	NA	NA	NA	NA
WP_153446939.1\|1048304_1048784_+	hypothetical protein	NA	NA	NA	NA
WP_153446940.1\|1048776_1049112_+	hypothetical protein	NA	NA	NA	NA
WP_153446941.1\|1049620_1050208_+	hypothetical protein	NA	NA	NA	NA
WP_153446942.1\|1050209_1050413_+	hypothetical protein	NA	NA	NA	NA
WP_153446943.1\|1050413_1050671_+	hypothetical protein	NA	NA	NA	NA
WP_153446944.1\|1050708_1051710_+	hypothetical protein	NA	NA	NA	NA
WP_153446945.1\|1052334_1054575_+	NADP-dependent isocitrate dehydrogenase	NA	NA	NA	NA
WP_153446946.1\|1054851_1055415_+	HD domain-containing protein	NA	NA	NA	NA
WP_153446947.1\|1055489_1055708_-	cold shock domain-containing protein CspD	A0A2H4N7Y6	Lake_Baikal_phage	1.2e-14	56.7
WP_153446948.1\|1056148_1056469_+\|protease	ATP-dependent Clp protease adapter ClpS	A0A1B1IT64	uncultured_Mediterranean_phage	4.5e-13	41.5
WP_153446949.1\|1056569_1058834_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.0e-163	41.2
WP_001040192.1\|1058979_1059198_-	translation initiation factor IF-1	NA	NA	NA	NA
WP_153446950.1\|1059314_1060007_-	arginyltransferase	NA	NA	NA	NA
1059352:1059368	attR	NA	NA	NA	NA
WP_153446951.1\|1060015_1060738_-\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA

DBSCAN-SWA_3

1850900 : 1858341

uncultured_Mediterranean_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153447590.1\|1850900_1853495_+	DNA mismatch repair protein MutS	A0A1V0SGG8	Hokovirus	2.2e-33	24.5
WP_153447591.1\|1853867_1854788_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	5.3e-147	80.3
WP_153447592.1\|1855073_1856039_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	4.8e-34	34.8
WP_153447593.1\|1856092_1856899_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	1.4e-05	34.7
WP_153447594.1\|1856915_1857542_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	9.1e-34	49.7
WP_153447595.1\|1857603_1858341_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.8e-68	52.4

DBSCAN-SWA_4

1913893 : 1921213

Powai_lake_megavirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153447640.1\|1913893_1914325_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	2.1e-21	41.7
WP_153447641.1\|1914387_1915683_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.2e-35	34.3
WP_153447642.1\|1916001_1916199_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_153447643.1\|1916216_1916555_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_153447644.1\|1916604_1918455_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	8.2e-107	42.1
WP_153447645.1\|1918485_1919001_-	co-chaperone HscB	NA	NA	NA	NA
WP_153447646.1\|1919127_1919451_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.4e-24	48.6
WP_153447647.1\|1919543_1919924_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.3e-53	77.4
WP_153447648.1\|1919998_1921213_-	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	1.6e-29	28.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045700

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

278995 : 324865

Vibrio_phage(89.47%)

plate,head,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153448438.1\|278995_280071_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	8.3e-43	38.4
WP_153448439.1\|280151_280412_-	hypothetical protein	NA	NA	NA	NA
WP_153448440.1\|283303_283678_+	c-type cytochrome	NA	NA	NA	NA
WP_153448441.1\|285231_285822_+	cytochrome-c oxidase, cbb3-type subunit II	NA	NA	NA	NA
WP_153448442.1\|285831_287940_+	cytochrome-c oxidase, cbb3-type subunit III	NA	NA	NA	NA
WP_153448443.1\|288167_289127_+	C4-dicarboxylate ABC transporter	NA	NA	NA	NA
WP_153448444.1\|289238_289508_-	hypothetical protein	NA	NA	NA	NA
WP_153449006.1\|289993_290677_-	XRE family transcriptional regulator	A0A2I7S9A5	Vibrio_phage	4.0e-67	57.8
WP_153448445.1\|290948_291182_+	transcriptional regulator	A0A2I7S995	Vibrio_phage	3.0e-14	52.8
WP_153448446.1\|291181_293182_+	DDE endonuclease	A0A2I7S9A8	Vibrio_phage	2.6e-284	72.8
WP_153448447.1\|294180_294399_+	hypothetical protein	NA	NA	NA	NA
WP_153448448.1\|294385_294706_+	hypothetical protein	A0A2I7S9B1	Vibrio_phage	3.3e-24	55.1
WP_153448449.1\|294717_295341_+	DUF3164 family protein	M4MHH7	Vibrio_phage	9.0e-74	68.5
WP_153448450.1\|295348_295567_+	hypothetical protein	NA	NA	NA	NA
WP_153448451.1\|295720_295936_+	hypothetical protein	NA	NA	NA	NA
WP_153448452.1\|295928_296084_+	hypothetical protein	NA	NA	NA	NA
WP_153448453.1\|296172_296631_+	hypothetical protein	M4MHH2	Vibrio_phage	1.2e-51	66.7
WP_153448454.1\|296630_296957_+	DUF3850 domain-containing protein	U5U430	Lactobacillus_phage	1.9e-14	53.8
WP_153448455.1\|296953_297511_+	hypothetical protein	A0A2P9JZH6	Alteromonadaceae_phage	4.3e-27	46.4
WP_153448456.1\|297495_298020_+	DUF1018 domain-containing protein	M4MB83	Vibrio_phage	6.2e-44	54.1
WP_153448457.1\|298165_298558_+	transcriptional regulator	M4MHG9	Vibrio_phage	2.3e-35	58.3
WP_153448458.1\|298569_298752_+	hypothetical protein	NA	NA	NA	NA
WP_153448459.1\|298759_299239_+	hypothetical protein	NA	NA	NA	NA
WP_153448460.1\|299319_299868_+	peptidoglycan-binding protein	A0A2I7S9B9	Vibrio_phage	1.9e-56	56.7
WP_153448461.1\|299867_300200_+	hypothetical protein	NA	NA	NA	NA
WP_153448462.1\|300186_300435_+	DUF2644 domain-containing protein	F6MIK0	Haemophilus_phage	8.1e-10	50.7
WP_153448463.1\|300431_300692_+	DUF2681 domain-containing protein	NA	NA	NA	NA
WP_153448464.1\|300827_301049_+	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_153448465.1\|301049_301349_+	DUF2730 family protein	M1Q558	Vibrio_phage	2.6e-18	48.9
WP_153448466.1\|301351_301642_+	ArsR family transcriptional regulator	A0A2I7S9D8	Vibrio_phage	1.1e-21	56.8
WP_153448467.1\|301650_301899_+	hypothetical protein	NA	NA	NA	NA
WP_153448468.1\|301870_302449_+	DUF3486 family protein	A0A2I7S9D1	Vibrio_phage	7.1e-33	42.6
WP_153449007.1\|302499_304059_+	hypothetical protein	A0A2I7S9C5	Vibrio_phage	6.0e-252	84.0
WP_153448469.1\|304055_305645_+	DUF935 family protein	M4M9P3	Vibrio_phage	1.5e-229	74.6
WP_153448470.1\|305637_306432_+	hypothetical protein	A0A2I7S9F9	Vibrio_phage	1.6e-120	79.3
WP_153448471.1\|306570_307254_+	hypothetical protein	NA	NA	NA	NA
WP_153448472.1\|307395_308364_+	peptidase	M1Q578	Vibrio_phage	7.1e-94	54.6
WP_153448473.1\|308363_309263_+\|head	phage head protein	A0A2I7S9D0	Vibrio_phage	1.5e-133	76.9
WP_153448474.1\|309370_309928_+	hypothetical protein	A0A2I7S9F2	Vibrio_phage	3.1e-25	69.3
WP_153448475.1\|309958_310399_+	DUF1320 domain-containing protein	M1PVU7	Vibrio_phage	1.0e-63	82.9
WP_153448476.1\|310398_310941_+	phage morphogenesis protein	A0A2I7S9D7	Vibrio_phage	3.0e-73	74.4
WP_153448477.1\|310954_311557_+	hypothetical protein	M4MHF0	Vibrio_phage	1.9e-73	68.0
WP_153448478.1\|311592_311802_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_153448479.1\|311804_313283_+\|tail	phage tail protein	M1Q565	Vibrio_phage	3.2e-218	75.6
WP_153448480.1\|313310_313661_+\|tail	phage tail protein	A0A2I7S9D5	Vibrio_phage	5.6e-41	69.6
WP_153448481.1\|313660_314005_+	hypothetical protein	M4MB64	Vibrio_phage	7.0e-44	78.8
WP_153448482.1\|314130_315882_+\|tail	phage tail tape measure protein	M4MHE6	Vibrio_phage	4.3e-190	64.5
WP_153448483.1\|315903_317235_+	multidrug DMT transporter permease	A0A2I7S9E8	Vibrio_phage	1.4e-161	66.6
WP_153448484.1\|317227_318298_+\|tail	phage tail protein	M1PVV2	Vibrio_phage	4.2e-148	71.9
WP_153448485.1\|318291_318894_+\|plate	phage baseplate assembly protein V	A0A2I7S9F6	Vibrio_phage	3.9e-82	76.1
WP_153448486.1\|318902_319361_+	hypothetical protein	M4MB61	Vibrio_phage	3.3e-49	69.7
WP_153448487.1\|319350_320418_+\|plate	phage baseplate protein	A0A2I7S9E5	Vibrio_phage	1.7e-152	76.2
WP_153448488.1\|320402_320999_+	DUF2313 domain-containing protein	A0A2I7S9L6	Vibrio_phage	3.4e-86	76.3
WP_153448489.1\|320998_321790_+	hypothetical protein	A0A0K1LJM8	Vibrio_phage	2.8e-32	45.7
WP_153448490.1\|321786_322470_+	hypothetical protein	A0A2I7QZ19	Vibrio_phage	1.4e-24	43.6
WP_153448491.1\|322472_322673_+	hypothetical protein	NA	NA	NA	NA
WP_153448492.1\|322853_323165_-	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_153448493.1\|323161_323848_-	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_153448494.1\|323944_324865_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	9.0e-147	80.3

DBSCAN-SWA_2

533078 : 641900

Vibrio_phage(64.29%)

terminase,portal,capsid,tail,integrase,plate

attL 587793:587808|attR 642304:642319

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153448684.1\|533078_534305_-\|integrase	tyrosine-type recombinase/integrase	Q7M297	Enterobacteria_phage	4.1e-22	24.5
WP_153448685.1\|534449_535019_-	hypothetical protein	NA	NA	NA	NA
WP_153448686.1\|535183_536194_-	phospholipase	NA	NA	NA	NA
WP_153448687.1\|536419_537001_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_153448688.1\|537059_538364_-	guanine deaminase	NA	NA	NA	NA
WP_153449018.1\|538482_539301_-	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.5e-36	30.9
WP_153448689.1\|539385_541821_-	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	7.3e-204	47.8
WP_153448690.1\|544547_545057_-	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	1.0e-30	50.0
WP_153448691.1\|545115_545820_-	UTRA domain-containing protein	NA	NA	NA	NA
WP_153448692.1\|545959_546121_-	YqaE/Pmp3 family membrane protein	NA	NA	NA	NA
WP_153448693.1\|546189_546588_-	YccF domain-containing protein	NA	NA	NA	NA
WP_153448694.1\|546692_548060_-	Ktr system potassium transporter B	NA	NA	NA	NA
WP_153448695.1\|548074_548737_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_153448696.1\|549085_550207_+	mechanosensitive ion channel	NA	NA	NA	NA
WP_153448697.1\|550288_550687_-	DUF1090 family protein	NA	NA	NA	NA
WP_153448698.1\|550820_551897_+	23S rRNA (adenine(1618)-N(6))-methyltransferase RlmF	NA	NA	NA	NA
WP_153448699.1\|552090_554394_-	U32 family peptidase	Q6DW11	Phage_TP	2.8e-19	29.8
WP_153448700.1\|554496_555177_+	glutathione S-transferase	NA	NA	NA	NA
WP_153448701.1\|555301_556357_-	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	1.7e-80	47.1
WP_153448702.1\|556570_556771_-	hypothetical protein	NA	NA	NA	NA
WP_153448703.1\|558148_558358_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	9.8e-17	66.2
WP_153448704.1\|559645_559855_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	3.4e-17	67.6
WP_153448705.1\|560264_561281_-	lipoate--protein ligase	NA	NA	NA	NA
WP_153449019.1\|561447_562839_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_153448706.1\|562953_581205_-	hypothetical protein	NA	NA	NA	NA
WP_153448707.1\|581135_583703_-	retention module-containing protein	NA	NA	NA	NA
WP_153448708.1\|584246_585641_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_153448709.1\|585802_587746_+	EAL domain-containing protein	NA	NA	NA	NA
WP_153449020.1\|587754_590079_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.7e-32	26.4
587793:587808	attL	NA	NA	NA	NA
WP_153449021.1\|590316_591636_+	TolC family outer membrane protein	NA	NA	NA	NA
WP_153448710.1\|591645_592239_+	OmpA family protein	NA	NA	NA	NA
WP_153448711.1\|592241_592958_+	sulfate adenylyltransferase	NA	NA	NA	NA
WP_153448712.1\|592962_594879_+	EAL domain-containing protein	NA	NA	NA	NA
WP_153448713.1\|594988_597028_+	EAL domain-containing protein	NA	NA	NA	NA
WP_153448714.1\|597146_598175_-	OmpA family protein	NA	NA	NA	NA
WP_153448715.1\|598341_598953_-	AI-2E family transporter	NA	NA	NA	NA
WP_153448716.1\|598979_601454_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	3.2e-66	27.7
WP_153448717.1\|601467_602562_-	cytochrome C	NA	NA	NA	NA
WP_153448718.1\|603619_603814_+	hypothetical protein	NA	NA	NA	NA
WP_153448719.1\|603879_604119_-	GlsB/YeaQ/YmgE family stress response membrane protein	NA	NA	NA	NA
WP_153448720.1\|604444_604666_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	3.3e-23	92.6
WP_153448721.1\|604696_605698_-\|tail	phage tail protein	R9TNM7	Vibrio_phage	3.4e-59	40.2
WP_153448722.1\|605688_605895_-\|tail	phage tail protein	E5G6M9	Salmonella_phage	3.5e-11	50.0
WP_153448723.1\|605869_606274_-	hypothetical protein	R9TMP6	Vibrio_phage	1.0e-25	45.8
WP_153448724.1\|606285_608118_-	hypothetical protein	R9TRP8	Vibrio_phage	4.9e-43	26.6
WP_153448725.1\|608217_608547_-	hypothetical protein	NA	NA	NA	NA
WP_153448726.1\|608576_609092_-\|tail	phage tail protein	R9TR65	Vibrio_phage	2.7e-23	42.0
WP_153448727.1\|609091_610558_-\|tail	phage tail protein	R9TMQ0	Vibrio_phage	3.3e-119	48.0
WP_153448728.1\|610632_611175_-	hypothetical protein	A0A2I7RD07	Vibrio_phage	1.5e-32	52.9
WP_153448729.1\|611174_611957_-	hypothetical protein	R9TNJ7	Vibrio_phage	2.0e-38	38.9
WP_153448730.1\|611957_612512_-\|tail	phage tail protein I	R9TR33	Vibrio_phage	2.5e-59	63.2
WP_153448731.1\|612514_613396_-\|plate	phage baseplate protein	R9TML5	Vibrio_phage	4.4e-74	51.7
WP_153448732.1\|613392_613731_-\|plate	phage baseplate protein	A0A088FV58	Escherichia_phage	1.9e-30	56.2
WP_153448733.1\|613738_613936_-	hypothetical protein	R9TR72	Vibrio_phage	8.6e-15	63.1
WP_153448734.1\|613935_614475_-\|plate	phage baseplate assembly protein V	A0A219YA41	Aeromonas_phage	4.8e-31	44.1
WP_153448735.1\|614452_614998_-	hypothetical protein	A0A193GYB4	Enterobacter_phage	2.3e-17	31.9
WP_153448736.1\|614994_615609_-	hypothetical protein	R9TR34	Vibrio_phage	5.9e-62	58.8
WP_153448737.1\|615574_615922_-	hypothetical protein	R9TMM0	Vibrio_phage	4.1e-28	53.4
WP_153448738.1\|615932_616121_-	hypothetical protein	R9TRM3	Vibrio_phage	1.4e-11	70.9
WP_153449022.1\|616180_617995_-\|capsid	phage major capsid protein	R9TPU0	Vibrio_phage	6.5e-250	72.7
WP_153449023.1\|617972_619418_-\|portal	phage portal protein	R9TNK3	Vibrio_phage	8.2e-163	59.8
WP_153448739.1\|619426_619672_-	hypothetical protein	R9TR37	Vibrio_phage	4.3e-24	72.8
WP_153448740.1\|619672_621553_-\|terminase	phage terminase large subunit family protein	R9TMM4	Vibrio_phage	0.0e+00	83.4
WP_153448741.1\|621524_622067_-	hypothetical protein	R9TRM5	Vibrio_phage	4.4e-69	73.0
WP_153448742.1\|622169_622451_-	hypothetical protein	NA	NA	NA	NA
WP_153448743.1\|622478_622955_-	hypothetical protein	I6RSJ6	Salmonella_phage	5.9e-09	34.1
WP_153449024.1\|622944_623394_-	glycoside hydrolase family protein	A0A1V0E844	Vibrio_phage	1.5e-46	62.2
WP_153448744.1\|623503_624169_-	hypothetical protein	R9TRM8	Vibrio_phage	6.6e-67	56.7
WP_153448745.1\|624170_625169_-	acyltransferase family protein	NA	NA	NA	NA
WP_153448746.1\|625225_626257_-	DUF968 domain-containing protein	R9TRM9	Vibrio_phage	1.2e-126	63.6
WP_153448747.1\|626250_626538_-	DUF4406 domain-containing protein	A0A1V0E824	Vibrio_phage	2.9e-27	58.5
WP_153448748.1\|626530_626842_-	hypothetical protein	R9TNL4	Vibrio_phage	2.9e-41	78.4
WP_153448749.1\|626838_627474_-	hypothetical protein	NA	NA	NA	NA
WP_153448750.1\|627466_627676_-	hypothetical protein	NA	NA	NA	NA
WP_153448751.1\|627665_628322_-	hypothetical protein	W6MVG8	Pseudomonas_phage	7.1e-13	29.0
WP_153448752.1\|628325_629168_-	hypothetical protein	K7PJZ3	Enterobacterial_phage	2.1e-17	40.7
WP_153448753.1\|629164_629713_-	phage N-6-adenine-methyltransferase	A0A1V0E8C8	Vibrio_phage	2.1e-66	64.8
WP_153448754.1\|629918_630092_-	hypothetical protein	NA	NA	NA	NA
WP_153449025.1\|630088_630538_-	hypothetical protein	R9TRN6	Vibrio_phage	1.7e-37	61.7
WP_153448755.1\|630600_630813_-	helix-turn-helix domain-containing protein	A0A1V0E8C7	Vibrio_phage	1.6e-11	44.8
WP_153449026.1\|630918_631584_+	helix-turn-helix domain-containing protein	Q37946	Enterobacteria_phage	4.9e-70	60.8
WP_153448756.1\|631596_632631_+	hypothetical protein	A4KWR9	Enterobacteria_phage	2.6e-33	28.9
WP_153448757.1\|633008_633197_+	hypothetical protein	NA	NA	NA	NA
WP_153448758.1\|633209_633404_-	hypothetical protein	NA	NA	NA	NA
WP_153448759.1\|633759_634011_+	hypothetical protein	A0A1V0E8D8	Vibrio_phage	2.1e-21	62.5
WP_153448760.1\|634049_634568_+	hypothetical protein	A0A1V0E8E0	Vibrio_phage	2.6e-26	41.8
WP_153448761.1\|634600_634942_+	hypothetical protein	NA	NA	NA	NA
WP_153448762.1\|634942_635155_+	hypothetical protein	A0A1V0E8D5	Vibrio_phage	2.1e-11	52.3
WP_153448763.1\|635254_635695_+	hypothetical protein	A0A2I7R2T2	Vibrio_phage	6.6e-47	62.6
WP_153448764.1\|635698_636061_+	hypothetical protein	I3PV00	Vibrio_phage	6.2e-27	55.9
WP_153448765.1\|636060_636360_+	hypothetical protein	NA	NA	NA	NA
WP_153448766.1\|636525_636792_+	hypothetical protein	NA	NA	NA	NA
WP_153448767.1\|636810_637407_+	hypothetical protein	R9TPV7	Vibrio_phage	2.6e-70	67.5
WP_153448768.1\|637406_637982_+	single-stranded DNA-binding protein	R9TR60	Vibrio_phage	5.2e-60	64.5
WP_153448769.1\|638255_639479_+\|integrase	tyrosine-type recombinase/integrase	R9TMP3	Vibrio_phage	3.9e-190	78.9
WP_153449027.1\|639636_640674_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	3.3e-20	90.2
WP_153448770.1\|640706_641900_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	1.5e-40	29.5
642304:642319	attR	NA	NA	NA	NA

DBSCAN-SWA_3

729710 : 780239

Vibrio_phage(87.5%)

plate,transposase,tail,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153448841.1\|729710_730631_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	5.8e-146	79.7
WP_153448842.1\|730714_730954_+	EamA family transporter	NA	NA	NA	NA
WP_153448843.1\|731011_731773_-	3'-5' exonuclease	NA	NA	NA	NA
WP_153448844.1\|732010_733813_-	transporter	A0A240F3J2	Aeromonas_phage	1.2e-06	23.4
WP_153448845.1\|734798_735518_+	porin	NA	NA	NA	NA
WP_153448846.1\|735712_736558_-	polysaccharide lyase family 7 protein	NA	NA	NA	NA
WP_153448847.1\|736603_737545_+	hypothetical protein	NA	NA	NA	NA
WP_153448848.1\|737632_739501_-	CBS domain-containing protein	NA	NA	NA	NA
WP_153448849.1\|739812_740622_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_153448850.1\|740868_741630_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	NA	NA	NA	NA
WP_153448851.1\|741714_742041_+	cupin domain-containing protein	NA	NA	NA	NA
WP_153448852.1\|742125_742764_+	hypothetical protein	NA	NA	NA	NA
WP_153448853.1\|743015_743537_+	YgjV family protein	NA	NA	NA	NA
WP_153448854.1\|744119_744506_-	hypothetical protein	NA	NA	NA	NA
WP_153448491.1\|744679_744880_-	hypothetical protein	NA	NA	NA	NA
WP_153448490.1\|744882_745566_-	hypothetical protein	A0A2I7QZ19	Vibrio_phage	1.4e-24	43.6
WP_153448855.1\|745562_746114_-	hypothetical protein	A0A0K1LJM8	Vibrio_phage	2.0e-32	45.7
WP_153448856.1\|746107_746353_-	hypothetical protein	M1PVW1	Vibrio_phage	1.6e-26	79.7
WP_153448488.1\|746352_746949_-	DUF2313 domain-containing protein	A0A2I7S9L6	Vibrio_phage	3.4e-86	76.3
WP_153448486.1\|747989_748448_-	hypothetical protein	M4MB61	Vibrio_phage	3.3e-49	69.7
WP_153448485.1\|748456_749059_-\|plate	phage baseplate assembly protein V	A0A2I7S9F6	Vibrio_phage	3.9e-82	76.1
WP_153448484.1\|749052_750123_-\|tail	phage tail protein	M1PVV2	Vibrio_phage	4.2e-148	71.9
WP_153448483.1\|750115_751447_-	multidrug DMT transporter permease	A0A2I7S9E8	Vibrio_phage	1.4e-161	66.6
WP_153448482.1\|751468_753220_-\|tail	phage tail tape measure protein	M4MHE6	Vibrio_phage	4.3e-190	64.5
WP_153448481.1\|753345_753690_-	hypothetical protein	M4MB64	Vibrio_phage	7.0e-44	78.8
WP_153448480.1\|753689_754040_-\|tail	phage tail protein	A0A2I7S9D5	Vibrio_phage	5.6e-41	69.6
WP_153448479.1\|754067_755546_-\|tail	phage tail protein	M1Q565	Vibrio_phage	3.2e-218	75.6
WP_153448478.1\|755548_755758_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_153448477.1\|755793_756396_-	hypothetical protein	M4MHF0	Vibrio_phage	1.9e-73	68.0
WP_153448476.1\|756409_756952_-	phage morphogenesis protein	A0A2I7S9D7	Vibrio_phage	3.0e-73	74.4
WP_153448475.1\|756951_757392_-	DUF1320 domain-containing protein	M1PVU7	Vibrio_phage	1.0e-63	82.9
WP_153448474.1\|757422_757980_-	hypothetical protein	A0A2I7S9F2	Vibrio_phage	3.1e-25	69.3
WP_153448473.1\|758087_758987_-\|head	phage head protein	A0A2I7S9D0	Vibrio_phage	1.5e-133	76.9
WP_153448472.1\|758986_759955_-	peptidase	M1Q578	Vibrio_phage	7.1e-94	54.6
WP_153448471.1\|760096_760780_-	hypothetical protein	NA	NA	NA	NA
WP_153448470.1\|760918_761713_-	hypothetical protein	A0A2I7S9F9	Vibrio_phage	1.6e-120	79.3
WP_153448469.1\|761705_763295_-	DUF935 family protein	M4M9P3	Vibrio_phage	1.5e-229	74.6
WP_153449007.1\|763291_764851_-	hypothetical protein	A0A2I7S9C5	Vibrio_phage	6.0e-252	84.0
WP_153448468.1\|764901_765480_-	DUF3486 family protein	A0A2I7S9D1	Vibrio_phage	7.1e-33	42.6
WP_153448467.1\|765451_765700_-	hypothetical protein	NA	NA	NA	NA
WP_153448466.1\|765708_765999_-	ArsR family transcriptional regulator	A0A2I7S9D8	Vibrio_phage	1.1e-21	56.8
WP_153448465.1\|766001_766301_-	DUF2730 family protein	M1Q558	Vibrio_phage	2.6e-18	48.9
WP_153448464.1\|766301_766523_-	TraR/DksA family transcriptional regulator	NA	NA	NA	NA
WP_153448463.1\|766658_766919_-	DUF2681 domain-containing protein	NA	NA	NA	NA
WP_153448462.1\|766915_767164_-	DUF2644 domain-containing protein	F6MIK0	Haemophilus_phage	8.1e-10	50.7
WP_153448461.1\|767150_767483_-	hypothetical protein	NA	NA	NA	NA
WP_153448460.1\|767482_768031_-	peptidoglycan-binding protein	A0A2I7S9B9	Vibrio_phage	1.9e-56	56.7
WP_153448459.1\|768111_768591_-	hypothetical protein	NA	NA	NA	NA
WP_153448458.1\|768598_768781_-	hypothetical protein	NA	NA	NA	NA
WP_153448457.1\|768792_769185_-	transcriptional regulator	M4MHG9	Vibrio_phage	2.3e-35	58.3
WP_153448456.1\|769330_769855_-	DUF1018 domain-containing protein	M4MB83	Vibrio_phage	6.2e-44	54.1
WP_153448455.1\|769839_770397_-	hypothetical protein	A0A2P9JZH6	Alteromonadaceae_phage	4.3e-27	46.4
WP_153448454.1\|770393_770720_-	DUF3850 domain-containing protein	U5U430	Lactobacillus_phage	1.9e-14	53.8
WP_153448857.1\|770719_771178_-	hypothetical protein	M4MHH2	Vibrio_phage	4.2e-52	66.7
WP_153448452.1\|771266_771422_-	hypothetical protein	NA	NA	NA	NA
WP_153448451.1\|771414_771630_-	hypothetical protein	NA	NA	NA	NA
WP_153448450.1\|771783_772002_-	hypothetical protein	NA	NA	NA	NA
WP_153448449.1\|772009_772633_-	DUF3164 family protein	M4MHH7	Vibrio_phage	9.0e-74	68.5
WP_153448448.1\|772644_772965_-	hypothetical protein	A0A2I7S9B1	Vibrio_phage	3.3e-24	55.1
WP_153448447.1\|772951_773170_-	hypothetical protein	NA	NA	NA	NA
WP_153449037.1\|773178_774123_-	AAA family ATPase	M4M9P4	Vibrio_phage	4.6e-138	79.2
WP_153448446.1\|774169_776170_-	DDE endonuclease	A0A2I7S9A8	Vibrio_phage	2.6e-284	72.8
WP_153448445.1\|776169_776403_-	transcriptional regulator	A0A2I7S995	Vibrio_phage	3.0e-14	52.8
WP_153449006.1\|776674_777358_+	XRE family transcriptional regulator	A0A2I7S9A5	Vibrio_phage	4.0e-67	57.8
WP_153448858.1\|777686_778748_-	mannonate dehydratase	NA	NA	NA	NA
WP_153448859.1\|778760_780239_-	hypothetical protein	H8ZJP8	Ostreococcus_tauri_virus	5.6e-50	31.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045699

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045700

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection