CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045795	Vibrio parahaemolyticus 10329 chromosome 2, complete sequence	1 crisprs	cas3,DEDDh,WYL,csa3,cas5f,cas7f,cas6f	0	0	1	0
NZ_CP045794	Vibrio parahaemolyticus 10329 chromosome 1, complete sequence	0 crisprs	DinG,cas3,csa3,DEDDh,RT,csx1	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045795_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045795_1

932019-932152

Orphan

Consensus_repeat	Method
GGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045795_1

>merge|NZ_CP045795|1|932019-932152|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGGTCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAAGGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

>NZ_CP045795|1|1|932019-932152|CRISPRCasFinder
GGTGGTCGCCGTGACGGTGGTCGTCGCGATGGCGG	TCGTCGTGAAGGTGGTTTCCGTGGTAACCGCGAAGGTGGCAACCGTGGTGGTGAGCGTCGTGAA
GGCGGTCGTCGTGAAGGTGGCTTCCGTGGTAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045795.1\|WP_011106305.1\|918703_918802_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045795.1\|WP_017448087.1\|926686_927085_+\|DUF3024-domain-containing-protein	unknown	unknown	gnl\|CDD\|371425
NZ_CP045795.1\|WP_005498484.1\|938232_938784_+\|membrane-protein	unknown	unknown	gnl\|CDD\|227700
NZ_CP045795.1\|WP_079748646.1\|932356_933958_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	unknown	unknown	gnl\|CDD\|238923
NZ_CP045795.1\|WP_005483343.1\|934097_934223_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045795.1\|WP_005498472.1\|927089_927893_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP045795.1\|WP_005498490.1\|940601_942206_-\|methylcrotonoyl-CoA-carboxylase	unknown	unknown	gnl\|CDD\|178415
NZ_CP045795.1\|WP_005462115.1\|924912_925593_+\|MaoC-family-dehydratase	unknown	unknown	gnl\|CDD\|239534
NZ_CP045795.1\|WP_005498486.1\|938819_939722_-\|hydroxymethylglutaryl-CoA-lyase	unknown	unknown	gnl\|CDD\|180206
NZ_CP045795.1\|WP_005498474.1\|927964_929971_-\|exoribonuclease-II	unknown	unknown	gnl\|CDD\|179920
NZ_CP045795.1\|WP_005498488.1\|939718_940564_-\|gamma-carboxygeranoyl-CoA-hydratase	unknown	unknown	gnl\|CDD\|235664
NZ_CP045795.1\|WP_005485953.1\|937328_938207_+\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP045795.1\|WP_079748675.1\|918806_919733_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176155
NZ_CP045795.1\|WP_005498493.1\|942240_943410_-\|isovaleryl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173845
NZ_CP045795.1\|WP_005498470.1\|925647_926475_-\|phosphate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270371
NZ_CP045795.1\|WP_005483382.1\|934255_935449_+\|acetate-kinase	unknown	unknown	gnl\|CDD\|183528
NZ_CP045795.1\|WP_005498481.1\|935729_937043_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|206779
NZ_CP045795.1\|WP_005498463.1\|919763_922133_-\|arylsulfatase	unknown	unknown	gnl\|CDD\|293749
NZ_CP045795.1\|WP_005498468.1\|923514_924468_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP045795.1\|WP_079748645.1\|922140_923403_-\|anaerobic-sulfatase-maturase	unknown	unknown	gnl\|CDD\|188457

Protein	Function_ID	Function_description	E-value
NZ_CP045795.1\|WP_005498493.1\|942240_943410_-\|isovaleryl-CoA-dehydrogenase	gnl\|CDD\|173845	cd01156, IVD, Isovaleryl-CoA dehydrogenase. Isovaleryl-CoA dehydrogenase (IVD) is an is an acyl-CoA dehydrogenase, which catalyzes the third step in leucine catabolism, the conversion of isovaleryl-CoA (3-methylbutyryl-CoA) into 3-methylcrotonyl-CoA. IVD is a homotetramer and has the greatest affinity for small branched chain substrates.	0
NZ_CP045795.1\|WP_017448087.1\|926686_927085_+\|DUF3024-domain-containing-protein	gnl\|CDD\|371425	pfam11225, DUF3024, Protein of unknown function (DUF3024). This family of proteins has no known function.	5.55354e-20
NZ_CP045795.1\|WP_005498484.1\|938232_938784_+\|membrane-protein	gnl\|CDD\|227700	COG5413, COG5413, Uncharacterized integral membrane protein [Function unknown].	6.27155e-24
NZ_CP045795.1\|WP_079748646.1\|932356_933958_-\|bifunctional-diguanylate-cyclase/phosphodiesterase	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	1.02607e-90
NZ_CP045795.1\|WP_005498472.1\|927089_927893_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.08542e-25
NZ_CP045795.1\|WP_005498490.1\|940601_942206_-\|methylcrotonoyl-CoA-carboxylase	gnl\|CDD\|178415	PLN02820, PLN02820, 3-methylcrotonyl-CoA carboxylase, beta chain.	0
NZ_CP045795.1\|WP_005462115.1\|924912_925593_+\|MaoC-family-dehydratase	gnl\|CDD\|239534	cd03450, NodN, NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit. Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division. The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.	4.13783e-69
NZ_CP045795.1\|WP_005498486.1\|938819_939722_-\|hydroxymethylglutaryl-CoA-lyase	gnl\|CDD\|180206	PRK05692, PRK05692, hydroxymethylglutaryl-CoA lyase; Provisional.	2.89058e-177
NZ_CP045795.1\|WP_005498474.1\|927964_929971_-\|exoribonuclease-II	gnl\|CDD\|179920	PRK05054, PRK05054, exoribonuclease II; Provisional.	0
NZ_CP045795.1\|WP_005498488.1\|939718_940564_-\|gamma-carboxygeranoyl-CoA-hydratase	gnl\|CDD\|235664	PRK05995, PRK05995, enoyl-CoA hydratase; Provisional.	3.4745e-98
NZ_CP045795.1\|WP_005485953.1\|937328_938207_+\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	5.12613e-12
NZ_CP045795.1\|WP_079748675.1\|918806_919733_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176155	cd08466, PBP2_LeuO, The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse model of Salmonella. In Vibrio cholerae, LeuO is involved in control of biofilm formation and in the stringent response. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.74448e-27
NZ_CP045795.1\|WP_005498470.1\|925647_926475_-\|phosphate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270371	cd13653, PBP2_phosphate_like_1, Substrate binding domain of putative ABC-type phosphate transporter, a member of the type 2 periplasmic binding fold superfamily. This subfamily contains uncharacterized phosphate binding domains found in PstS proteins that serve as initial receptors in the ABC transport of phosphate in eubacteria and archaea. After binding the ligand, PstS interacts with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. The PstS proteins belong to the PBP2 superfamily of periplasmic binding proteins that differ in size and ligand specificity, but have similar tertiary structures consisting of two globular subdomains connected by a flexible hinge. They have been shown to bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap.	1.36753e-85
NZ_CP045795.1\|WP_005483382.1\|934255_935449_+\|acetate-kinase	gnl\|CDD\|183528	PRK12440, PRK12440, acetate/propionate family kinase.	0
NZ_CP045795.1\|WP_005498481.1\|935729_937043_+\|PAS-domain-S-box-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	3.78527e-45
NZ_CP045795.1\|WP_005498463.1\|919763_922133_-\|arylsulfatase	gnl\|CDD\|293749	cd16025, PAS_like, Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.	0
NZ_CP045795.1\|WP_005498468.1\|923514_924468_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.23398e-30
NZ_CP045795.1\|WP_079748645.1\|922140_923403_-\|anaerobic-sulfatase-maturase	gnl\|CDD\|188457	TIGR03942, sulfatase_rSAM, anaerobic sulfatase-maturating enzyme. Members of this protein family are radical SAM family enzymes, maturases that prepare the oxygen-sensitive radical required in the active site of anaerobic sulfatases. This maturase role has led to many misleading legacy annotations suggesting that this enzyme maturase is instead a sulfatase regulatory protein. All members of the seed alignment are radical SAM enzymes encoded next to or near an anaerobic sulfatase. Note that a single genome may encode more than one sulfatase/maturase pair. [Protein fate, Protein modification and repair].	0

>NZ_CP045795.1|WP_005498474.1|927964_929971_-|exoribonuclease-II
MFQDNPLLAQLKQQIQENLPKKEGSIKATDKGFGFLEVDSKTSFFIPPAYMKKCIHGDKVVAIIRTENEREVAEPQELIEQSLTRFIGRVKMFKGKLNVVPDHPQLKKLSLKAKLKKGLKPDNFAEGDWVVAHLVRHPLKGDNTFFVEISEKITDADDKIAPWWVTLAQNDLPNSEPAGIENWELKDDADLERIDMTHVPFVTIDGESTKDMDDALYAKKTESGDFELTIAIADPTAYITPEDEMDKVARERGYTIYLPGRNIPMLPRDLADNLCSLIEGEIRPAICCTVTVSKDGVIGDYIKFFAANIKSHARLAYDHVSDWLENGNSDAWQPSEEIATIVRDLYEFSLARAEWREKNAVVFPDRPDYRFELSEDNDVIAIHADMRRSANRLVEESMITANICAGRTLREKFETGVFNTHAGLKPEKIEEVVQLVNPEGTLEFTAESIATLEGFAALRRWLAVQETSYLDNRIRKFQAYSEVGNQPLPHYAMGLDIYATWTSPIRKYGDMINHRMLKAVILDKEPVQKPDDQVGEELALHRKHHKIAERNVSDWLYARTLADEPSKQTCFTGEIFDINRAGARVRLLENGAAAFIPGALILDNKERIECNGDNGTISIDKEVVYKLGDTLEIVLADVNQENRSLVAKPTQVFADQPAPQTEQTVSEE
>NZ_CP045795.1|WP_005498472.1|927089_927893_-|helix-turn-helix-transcriptional-regulator
MPNIEIIRFNHFTARKSERYTATHNGLYVVEEGALVVHQPNGEQFELQAGDFTLYNSCDLRSAEAIPGENGFKAVALVFDISLFCEFKKAHPGLHSEAEHRRFYPFSPESNSEITQLKNTLLALTSRNAPDYTQSHIAMALLSLMVEVQPDILSIIDDASSLTASQKAIKYIEKNIEKDITLEGLAAHMSMSIATLKRRLAAENLSFSQILKVKRINYAATQLRVSQKSITEIAFESGFKSAAHFSTAFKSIYNITPKDFRNQVVRG
>NZ_CP045795.1|WP_017448087.1|926686_927085_+|DUF3024-domain-containing-protein
MALGCILKTTYQENVMSVSQMATSRLYKLVQILCSARNANLPVEQGKCLYEPIENGVELHHAHFLLDSQHSEYTSPIAKILFDSQTQLWRFYVPASRSEEIRWIPYKKLPHSHTLEDLLAELESDPQACFWE
>NZ_CP045795.1|WP_005498470.1|925647_926475_-|phosphate-ABC-transporter-substrate-binding-protein
MLRFTVATLLAMAVSLPSAMAKEVNISGSTSVARVMDVLAEEYNKTHPDNYIAVQGIGSSAGITMVNKGVVKLGMSSRYLTESEKGEDLNVFPIAYDGLAVVVNRTNSVTNLSAQQLFDIYKGEIKNWKEVGGADQPIAVVTREASSGSRYSFESLLGLTKVINDRLVSDISPNNLVVNSNSMVKTIVNHNTRAIGFISVGSVDLSVKAIQFNGIEPTAANIANHKYKLARPFLVLYKVDSLDQAGKDFIAFLKSEVGQKTIADYGYIPVKNFNQ
>NZ_CP045795.1|WP_005462115.1|924912_925593_+|MaoC-family-dehydratase
MKVTNLFKDKVDAISAHQSEFMNWMSPTLRDYWSDFLGKAQNSFLFSNVRDHNQPAVNEEVAPQPAPIVLQPEAQKLYDELSGKIGEVIHTGDWVHVSQERINQFGAVTEDMQWIHTDPERASVESPFKTTIAHGFLTLALLPKLTDSVDADKPLFPTAKLVVNLGLNQVRFPYPVKAGNNVRAVSTLTKVTPIKKGLEIEREIKVEIEGVRRPGAVVVSVIQLHF
>NZ_CP045795.1|WP_005498468.1|923514_924468_+|LysR-family-transcriptional-regulator
MIFNYNLLKPLALLLETKSITATANQMSTSASAVSRTLRSLREIFQDELLTRKNGRMELTPKAISIRAKLNNIIHDIDELTEDMSFDPSTSDIKINIAMNSYIAYWLAPEIIQYFSENAPNIELTIEDWNELTPDRINNQLVHFGIHYFPLNLNKNLVQRKVGKDMSVMVCRKDHPINNESISLETIASYPLAIHLQKHWNERQDKLSRLLLSHGIDFKVKLKTTHISVIINAVETTDLLFPCSIYIAEQLDEKFSYVTSSDEVFLPVLEKEFGFIYDKAYKNDPMIVWLHSTISKLMNDFLDVYNKKFDSRYEKSR
>NZ_CP045795.1|WP_079748645.1|922140_923403_-|anaerobic-sulfatase-maturase
MVGVEESLMAGLHTTVKVVGSKCNYDCQYCFYLEKDLLLKSKKSMNIETLETYIKNYISSQDTPIVEFAWHGGEPTLIGIDFFEKAVEFQKQYANGKLIKNTIQTNGSKLNSDWCRFFRENNFLVGLSLDGPEWLQEKYRTKQGKSAFKESFSALKLLQKMNVEYNVLACVTKEYCKHAEAIYSFFRKNKVKHIQFSPLVESSPLETEQARGQHFGSNLIFSTDKHHTDPQKYEPIAWSVDAKEYGRFLTDVFHLWVSQDVGKVFISNFEQALTQYLGNPSPNCIHAKKCGSSYAVEANGDVYFCDHVAYPESKLGNVFETSLHEMSLNHELQFNKESRLSMRCKQCQFLSLCNGGCPKHRYLSDTGEHENVLCDGYFYFFSSVQKYLQAMTTLLAHGYPASYVMQALDGPLILTPSNKR
>NZ_CP045795.1|WP_005498463.1|919763_922133_-|arylsulfatase
MDILKTTVTITGALAPCLVAAGTVDRTKLPIPDIEPQTYTQLDVRDVQRPEPTRRIAAPKDAPNVLVILLDDVGFSQSSLFGGAVDMPTLDALAKQGLIYNQFHTTGVSSATRTALLTGRNHHQNNMGSIAETSTAFPGNTSVRPNYIAALPKILKYNGYSTAMFGKNHEIPAWETGPAGNQTLWPSEVGFDKFYGFFGGETDQFQPVLIDGNTRIKTPRKKNYHFTADMTDQTIEWLNLQHSYNADQPFFAYYAPGAAHAPHQAPREWIDKFKGKFSMGWDKLRQESFERQKKLGIIPQDTVLPPMPDFVPRWDSLSSDEKRVFERQMEVYAGFLAHTDHEIGRVIDTLKKNGEFDNTLIFYIVGDNGASAEGNRNGSFNSLAFYNLITEDPNRVQENIDKLGGPDSFPHYASGWAVAGDSPFTWTKGMSSDFGGTRNGMVVSWPAGIDNKGQPLRDQWSHVVDIAPTVLEAANLPVPKEVDGVEQIPMAGVSFTNTFKETKAQTRHKPQYFELGGNRAIYHEGWLARVTHWALTEGATKFRDLQDDKWELYDTTKDFSLANDLAKSNPQKLDELKKLFDKEAEKNHVYPIDDRTVERMNAEIAGRPDALFGKKSLTLYEGARGIPENSFLNIKNKSFDIVADISTDNASKTNGVIIAQGGNFGGWTLYVKNGVPTFEYNWLTYEYTKVSGSKLKEGKNEIKVAFRYDENGQGGKGNAAGRGKGGNVYLYVNDKLVEKKLIPNTNSRLFSLDDGVGIGEDEGGAVSKDYQAPFEFNQKIEQVTTSIVQ
>NZ_CP045795.1|WP_079748675.1|918806_919733_-|LysR-family-transcriptional-regulator
MAQESLRTPVDFPNNSLLEFKMSKAIDLNLINTFIVVAECFSYTKAADKLGVTQPAISASIKRLERTTNTKLFTKRGRNIELTSTAQKWLPQLQQALSVIDSVITQPAPYNVYCSNIYPAQQSKLENVFFHESTLSENHLFSLLYSNKADLLLGDIESREASIIVEDVCREPCVVICRNGHPRINEHISTEMLSDEKHCVLASKWSFDTEFEKHLGLIVKSNNIDSIASNYLGILTHVAQSDCIGVIPLSLAKKWGKTFNIKHFTSPFGACFIQYQIAYHQRKVNCKRHGAMRALIKSRVLEDQQRII
>NZ_CP045795.1|WP_011106305.1|918703_918802_-|hypothetical-protein
MIPPYFSTDFIDKKAVVHQRLSFHFHCFNTTD
>NZ_CP045795.1|WP_079748646.1|932356_933958_-|bifunctional-diguanylate-cyclase/phosphodiesterase
MPTIAFLLVILGLILLCWGWQMTKNICSKTEVPGWTWLLMLISCFIFAYAAFLHAIMKKPVASLLETGVSLLLFGGSIFVVLVIKWSNDSILELHSVAEREKRNAVHDSLTGLPNRKYCFELIDDRIQSGDPFSVILFDVVNFKQVNDAMGHFCGDQLLIQIGQRLQDKLKGNDKIFRVGGDEFVILTSSACEKTGTELIESLDCALSARFHLDEFQVSSRVVFGISTYPYDAISNDLLIKHADIAMYHAKRNGNLFAFYHDDMNVGAKYQLEISSRIQCALEKEEFQLYYQPLIDANTNLAVGFEAVIRWHDENGKTISPNDFIPIAERSNQVHNITMWVLGQVEKDLKTFIEKGIKLPVHVNLSAKDLSSNLLFHRLEKLLENNPQFADLISLEITETMAIDRVVELNPLIHQIKGLGIKISLDDFGTGYSSLSLLRDLPVDQIKIDRSFLCTANRTEGSRSIVENTIALAHGLGYSVVAEGVQDMDTLYFLRSRGCDIIQGYLFCPALPLNEVINWVNEHDDKQSHIRRA
>NZ_CP045795.1|WP_005483343.1|934097_934223_-|hypothetical-protein
MRFRAAYFLFAPLLFNNFLIFQQSFSESDLIEQILLIYSKF
>NZ_CP045795.1|WP_005483382.1|934255_935449_+|acetate-kinase
MSNSFVLVINSGSSSLKFAVIDSVSGDAVLSGLGECFGLSDARMSWKFNGEKKEISIEGDDSHHKIAIGKLVGLTEELGLAQDIVAVGHRIVHGGEKFTKTVRITEEVTQEIEKLADLAPLHNPAGAIGIRAAVEAFPSLPQFAVFDTAFHQTMPQRAFTGAIAKELYTDFGIRRYGFHGTSHYFVSREAAKMINKPIEESSFISVHLGNGASVCAINNGESVDTSMGFTPLSGLMMGTRCGDLDPGIIEYLLKKGWSQEKVFNSLNKASGFLGVSGLTSDARGILEAMEEGHEGAALAFQVFTYRVSKYIASYLAALDSFDGIIFTGGIGENSMPIRREILKNLKLLGFVEDVKGNEDARFGNAGVIATSELLGAKALVIPTNEEWVIAQQSVELL
>NZ_CP045795.1|WP_005498481.1|935729_937043_+|PAS-domain-S-box-protein
MFFNKSLQQENQRLKQELYSLQQIQQSLDEEMLRLTLDAKGNVTSANQKFLQQLSLSDKDILAKHISDLVPSNVRNTDHFYRMKQSVQAKAFWNGAFQITKGDGEEAWLRVVIQPVRNTSDQVESFFVFASELTRTITTSREYEDMLNALSRSMAVIEFTLDGTVLKANDNFLSTMGYKHEQIVGKHHRIFCLPEEANSSAYHDFWKRLASGQFVTDRFKRVDQYGSVVWLEASYNPIHNDRGELYKVVKFATNITQQVLQEQSMAQAAQLANEVSQETGTQTVQGRQVIGSTLEKMQTLSEQMQQANAAIEDLKAHSSKISELVNSISGIADQTNLLALNAAIEAARAGDHGRGFAVVADEVRQLAMRTNTTTDEIVSMVTENLERTNNAVALISQCQKEALDTLELSEKAGNVMNDIQDGASRVVEAVAQFNRTL
>NZ_CP045795.1|WP_005485953.1|937328_938207_+|DMT-family-transporter
MFNSERKATVILVATTMIAALGWIFSKETIQGLPPFGFIGLRFTIASLCLLPLCYRPLKAARLKDVLAASGVGLLLGGAVMTWIYAISISDTLGEGAFIMSLSMLFVPIVAWVMFQQRPQRIFWISLPIAVIGLACLSLAGGWKQSASQLWFLGAALILALHFNVNSKYSQKLPVLLLTCVQLFSAGCLGLLVSFLMESRPEQVDSSIWWWFALSTLLATSLRYVMQTMGQKFVQAGNAALIMILEPVWTVVLSILWYGEVLTANKLVGCLLILFSLVIYRTGGRFRFPKRA
>NZ_CP045795.1|WP_005498484.1|938232_938784_+|membrane-protein
MANTEHQETLDFLDKLSVCLYRAGISVFAIALLGLAALESQWLDGMDGRYRAVFAVFTIAGAMSASNIHVYSKSVRTIISWSGWIGAILMVCDPELNRVWLALGFIFITFSGIALKESFCFKVLGLKLVPTLLVVTTFALWFEQSTIVAISALLAGLIMAYLSIAKWRMPLHFDIGIKANYEV
>NZ_CP045795.1|WP_005498486.1|938819_939722_-|hydroxymethylglutaryl-CoA-lyase
MTLPTNVTIVEVGPRDGLQNESPVSTRTKIRLIDLLSDTGLSHIEAGSFVSPKWVPQMADSKEVMQNITRRASVTYSALTPNLQGLEQALDAGANQVAIFTSASEGFCQHNINCSITESLKRFEPLMVQADKYHVPVRGYLSCVVDCPYDGATSPTQVANISQALIELGCYEVSLGDTIGTGTPNRVKEMLESVLASIPNQRLAVHFHDTWGQALANIYQALCMGINTVDSSVAGLGGCPYAHGASGNVATEDVLYLCQGLGIETGVDLELLAKAGWMISDELQRQPTSKVSQALRHRME
>NZ_CP045795.1|WP_005498488.1|939718_940564_-|gamma-carboxygeranoyl-CoA-hydratase
MQERQPSIVPNAQRHNDVLWQVDEFGVATLTLNRTKKHNAFDACMIDLIIHRLDYLALRTDVRCLVLRSNGKHFSSGADLAWMQSMANSTRKENLVDAQSLARLMETLDTFPQPTIAIVQGSAFGGALGLICCSDIAIATNSAQFCLSEVKLGLVPATIAPYVMRAMGNRQARRYILSGEVIPAVKAQQFGIVHEVKEDEELESCVSEVVASLLLNSPDAMRKAKALCEQCHQNPIDSQLIRYTSQLIADIRVSPQGQDGLQAFLEKRPPSWVHQPDAEEE
>NZ_CP045795.1|WP_005498490.1|940601_942206_-|methylcrotonoyl-CoA-carboxylase
MAIIKSKTKPTDELFLSNQAAMEMLVEKLQKDVATIKLGGGERAIAHQRQKGKLPVRERISHLLDDGSNFLEIGQFAAWQVYDEPIPCAGVVAGIGIIEGVQCMVIANDPSVKGGTYYPLTVKKHLRAQEIAQRCQLPCVYLVDSGGANLPHQSDVFPDKDHFGRIFFNQARMSAKGIPQIAVVMGLCTAGGAYVPAMADVSIMVKEQGTIFLAGPPLVKAATGEIVTGEELGGADVHCRKSGVADYYAENDEHALDLAREAIANANRPKPPKSDSAILPPRYDAEEMYGIVNANLRLSFDVREIIARIVDDSDFDEFKALYGRTLVCGFARIHGQLLGIVANNGILFSDSSQKGAHFIELCAKRKTPLLFLQNITGFMVGKKVEEEGIAKHGAKLVMAVACTDVPKFTVIIGGSYGAGNYGMCGRAYDPTMMWMWPNARISVMGGEQAAGVLTQVRKEINQRRGEEWSEQEEHTFKESIIDLYETQGHPYFASARLWDDGIIDPKETRNVLAQALMAALNAPIPDSEFGIFRM
>NZ_CP045795.1|WP_005498493.1|942240_943410_-|isovaleryl-CoA-dehydrogenase
MKTSYIPLNFGLGETIDMLRDHVNAFASEHIAPIAADIDHYNQFPSHLWPLLGEMGLLGVTVSEEYGGAEMGYLAHVVAMEEISRASASVALSYGAHSNLCVNQIFRNGTPTQREKYLPKLVDGSHIGALAMSEVNSGSDVVSMQLKAEDKGDHFLLNGTKMWITNGPDADVVVVYAKTDANAGSRGITAFIVERSFTGFSDAQKLDKLGMRGSNTSELVFNNCKVPKENILGALNCGVEVLMSGLDYERVVLAAGPLGIMQACMDIVVPYVHERKQFGKSIGEFQLVQGKLADMYSRMSAAKAYVYTVAAACDRGECTRKDAAGVILYSAELATQMALDAIQLLGGNGYINEYATGRLLRDAKLYEIGAGTSEIRRMLIGRELFEESR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1633537 : 1684989

Vibrio_phage(37.5%)

transposase,integrase,protease

attL 1664067:1664091|attR 1678946:1678970

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499394.1\|1633537_1634830_-\|protease	serine protease	V5LS29	Emiliania_huxleyi_virus	4.5e-11	22.7
WP_005499396.1\|1635065_1635470_-	cell division protein DamX	NA	NA	NA	NA
WP_005499397.1\|1635756_1636926_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	3.4e-82	45.6
WP_011106462.1\|1637562_1637865_-	hypothetical protein	NA	NA	NA	NA
WP_005499399.1\|1638352_1639210_-	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_005499401.1\|1639422_1639989_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005499403.1\|1640088_1640622_+	diacylglycerol kinase	NA	NA	NA	NA
WP_005499405.1\|1640870_1641053_-	hypothetical protein	NA	NA	NA	NA
WP_005499407.1\|1641136_1641976_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005499413.1\|1643983_1644574_-	hypothetical protein	NA	NA	NA	NA
WP_005499414.1\|1644756_1645476_-	beta-ketoacyl-ACP reductase	NA	NA	NA	NA
WP_101893994.1\|1645619_1645733_-	hypothetical protein	NA	NA	NA	NA
WP_079451942.1\|1645744_1646554_-	metal ABC transporter permease	NA	NA	NA	NA
WP_079748673.1\|1646550_1647498_-	hypothetical protein	NA	NA	NA	NA
WP_005499420.1\|1647469_1648612_-	hypothetical protein	NA	NA	NA	NA
WP_079748682.1\|1648851_1649475_+	cupin	NA	NA	NA	NA
WP_079399849.1\|1651156_1651813_+	hypothetical protein	NA	NA	NA	NA
WP_005499427.1\|1651805_1652120_+	acetyl-CoA acetyltransferase	NA	NA	NA	NA
WP_021448349.1\|1653908_1654829_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.3e-158	88.5
WP_005499450.1\|1657356_1657881_-	hypothetical protein	NA	NA	NA	NA
WP_005499452.1\|1658097_1658466_-	hypothetical protein	NA	NA	NA	NA
WP_021448345.1\|1659835_1661662_-	cell motility protein	NA	NA	NA	NA
WP_011106469.1\|1661934_1662030_-	hypothetical protein	NA	NA	NA	NA
WP_023650135.1\|1662333_1662903_-	thermostable direct hemolysin TDH	NA	NA	NA	NA
WP_021448344.1\|1663116_1664037_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.2e-162	91.1
1664067:1664091	attL	NA	NA	NA	NA
WP_079399902.1\|1664945_1665257_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_005499462.1\|1665451_1666090_-	urease accessory protein UreG	NA	NA	NA	NA
WP_020842398.1\|1666098_1666764_-	urease accessory protein UreF	NA	NA	NA	NA
WP_005499466.1\|1666791_1667271_-	urease accessory protein UreE	NA	NA	NA	NA
WP_005499467.1\|1667325_1669029_-	urease subunit alpha	NA	NA	NA	NA
WP_005499468.1\|1669025_1669349_-	urease subunit beta	NA	NA	NA	NA
WP_005499469.1\|1669359_1669662_-	urease subunit gamma	NA	NA	NA	NA
WP_005499470.1\|1669679_1670522_-	urease accessory protein ureD	NA	NA	NA	NA
WP_005499471.1\|1670927_1672466_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_023650108.1\|1672456_1673425_+	ABC transporter permease	NA	NA	NA	NA
WP_005499475.1\|1673441_1674242_+	ABC transporter permease	NA	NA	NA	NA
WP_005499477.1\|1674229_1674922_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	9.8e-05	24.3
WP_005499478.1\|1674918_1675545_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.8e-05	27.3
WP_005499480.1\|1675691_1676540_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005499483.1\|1676976_1677546_+	TDH-related hemolysin TRH1	NA	NA	NA	NA
WP_021448339.1\|1677870_1678761_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.6e-153	86.9
WP_100198882.1\|1678985_1679888_-	OspB protein	A0A0P0ZCT1	Stx2-converting_phage	1.2e-29	35.3
1678946:1678970	attR	NA	NA	NA	NA
WP_005499492.1\|1680103_1680508_-	H-NS histone family protein	NA	NA	NA	NA
WP_021448338.1\|1680618_1684989_-\|protease	SslE/AcfD family lipoprotein zinc metalloprotease	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP045794

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1165722 : 1183120

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|1165722_1167363_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|1167441_1168743_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455577.1\|1169370_1169652_+	cell division protein FtsB	NA	NA	NA	NA
WP_005493934.1\|1169653_1170358_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	3.4e-05	24.3
WP_005493937.1\|1170375_1170852_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_005493940.1\|1170898_1171942_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005493942.1\|1171941_1172718_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.6e-66	52.4
WP_005455562.1\|1172717_1173344_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_005455560.1\|1173358_1174282_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005493944.1\|1175431_1177993_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	4.4e-34	23.9
WP_005493945.1\|1178077_1178560_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.9e-27	48.7
WP_005478550.1\|1178760_1179804_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_005493947.1\|1179927_1180395_+	recombination regulator RecX	NA	NA	NA	NA
WP_005455546.1\|1180537_1183120_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

DBSCAN-SWA_2

2211877 : 2223073

Vibrio_phage(91.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005494987.1\|2211877_2212243_+	hypothetical protein	Q9MCC4	Vibrio_phage	6.0e-62	95.9
WP_005494989.1\|2212272_2212983_-	hypothetical protein	NA	NA	NA	NA
WP_005494991.1\|2213121_2213400_-	hypothetical protein	NA	NA	NA	NA
WP_005494993.1\|2213551_2213824_-	hypothetical protein	NA	NA	NA	NA
WP_101893729.1\|2214252_2214369_+	hypothetical protein	NA	NA	NA	NA
WP_005494995.1\|2214339_2214483_-	hypothetical protein	NA	NA	NA	NA
WP_005494996.1\|2214482_2215868_-	toxin	Q783T9	Vibrio_phage	1.2e-264	99.1
WP_005477634.1\|2215872_2216217_-	DUF2523 domain-containing protein	Q783U0	Vibrio_phage	5.0e-58	100.0
WP_005494998.1\|2216218_2217325_-	hypothetical protein	Q783U1	Vibrio_phage	1.3e-155	98.6
WP_011105866.1\|2217727_2217838_-	hypothetical protein	NA	NA	NA	NA
WP_005495000.1\|2217850_2218096_-	hypothetical protein	Q783U2	Vibrio_phage	3.7e-31	97.5
WP_005477619.1\|2218101_2218332_-	hypothetical protein	Q783U3	Vibrio_phage	1.6e-36	100.0
WP_005477647.1\|2218335_2218695_-	DUF1293 domain-containing protein	Q783U4	Vibrio_phage	9.1e-63	100.0
WP_079400570.1\|2218698_2219907_-	phage replication protein	Q7DKP2	Vibrio_phage	4.7e-244	99.8
WP_005488200.1\|2219830_2220046_-	hypothetical protein	A0A1W6UGD1	Vibrio_phage	1.8e-34	98.6
WP_021447749.1\|2220049_2220673_-	3'-5' exonuclease	W6ASW5	Vibrio_phage	8.5e-40	50.3
WP_005495006.1\|2220806_2221175_+	hypothetical protein	Q9MCC3	Vibrio_phage	1.6e-33	59.5
WP_005495008.1\|2221342_2223073_-	response regulator	A0A1V0SGX0	Hokovirus	2.1e-43	31.3

DBSCAN-SWA_3

2466130 : 2474197

Vibrio_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005495398.1\|2466130_2468356_-	ribonuclease R	Q0GXV6	Lactococcus_phage	8.2e-61	31.7
WP_005483265.1\|2468650_2468863_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.9e-16	61.2
WP_005495400.1\|2469767_2469971_+	hypothetical protein	NA	NA	NA	NA
WP_005495402.1\|2470193_2470601_-	APSE-2 prophage; Q protein	NA	NA	NA	NA
WP_005495404.1\|2470637_2471039_-	NinG recombination protein/bacteriophage lambda NinG family protein	A0A2I7S3K0	Vibrio_phage	3.7e-20	45.0
WP_005495406.1\|2471028_2471211_-	hypothetical protein	NA	NA	NA	NA
WP_005495408.1\|2471207_2471858_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	7.0e-21	36.5
WP_005495410.1\|2471850_2472231_-	hypothetical protein	NA	NA	NA	NA
WP_005495412.1\|2472227_2473181_-	helix-turn-helix domain-containing protein	A0A1V0E831	Vibrio_phage	3.8e-39	35.3
WP_005495414.1\|2473246_2473465_-	hypothetical protein	NA	NA	NA	NA
WP_005495415.1\|2473461_2473926_-	hypothetical protein	K7PJS5	Enterobacterial_phage	3.0e-18	48.0
WP_005495417.1\|2473945_2474197_-	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	3.8e-07	41.9

DBSCAN-SWA_4

2746755 : 2756569

Klosneuvirus(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005495749.1\|2746755_2748036_+	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.5e-22	26.4
WP_005495751.1\|2748105_2748372_-	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	2.1e-16	48.9
WP_023650089.1\|2748924_2749824_-	DUF3380 domain-containing protein	K4RM41	Pseudomonas_phage	4.8e-36	43.0
WP_005495761.1\|2750026_2751334_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	2.2e-90	42.8
WP_005495763.1\|2751425_2752775_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-84	42.1
WP_005460060.1\|2752781_2753408_-	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_005495766.1\|2753482_2756569_-	DNA translocase FtsK	A0A218M9A2	Mycobacterium_phage	3.8e-88	49.9

DBSCAN-SWA_5

3187834 : 3194536

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005440184.1\|3187834_3188305_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3
WP_005496254.1\|3188474_3189584_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005496255.1\|3189753_3190407_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.1e-33	37.0
WP_005496256.1\|3190419_3191544_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.8e-48	36.0
WP_005482986.1\|3191551_3192001_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_005496257.1\|3192128_3193379_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.6e-98	47.9
WP_005483011.1\|3193396_3194536_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045795

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP045794

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection