CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP045915	Gracilibacillus sp. SCU50 chromosome, complete genome	3 crisprs	RT,csa3,WYL,cas14k,DEDDh,cas3,DinG,cas14j	0	0	7	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP045915_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045915_1

879820-879928

Unclear

Consensus_repeat	Method
TCCTTGGATAAATGATTATATCCAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045915_1

>merge|NZ_CP045915|1|879820-879928|CRISPRCasFinder
TCCTTGGATAAATGATTATATCCAAGGAAGGGAGGAAGTTATCCCAGGAAGATGAGCATTAATCCAAGGAAGGGCTCACCTTCCTCCTTGGATAAATGATGATATCCAA

>NZ_CP045915|1|1|879820-879928|CRISPRCasFinder
TCCTTGGATAAATGATTATATCCAA	GGAAGGGAGGAAGTTATCCCAGGAAGATGAGCATTAATCCAAGGAAGGGCTCACCTTCC
TCCTTGGATAAATGATGATATCCAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045915.1\|WP_153790368.1\|866650_867742_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224195
NZ_CP045915.1\|WP_153790381.1\|887799_888372_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP045915.1\|WP_100361854.1\|873883_874309_-\|Lrp/AsnC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224439
NZ_CP045915.1\|WP_153790372.1\|874424_875186_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|225130
NZ_CP045915.1\|WP_100361842.1\|885176_885575_+\|RidA-family-protein	unknown	unknown	gnl\|CDD\|100004
NZ_CP045915.1\|WP_153790376.1\|880554_880989_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045915.1\|WP_153790374.1\|877790_879674_+\|ABC-F-type-ribosomal-protection-protein	unknown	unknown	gnl\|CDD\|223562
NZ_CP045915.1\|WP_153790375.1\|880004_880406_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045915.1\|WP_153790378.1\|882760_883084_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|212133
NZ_CP045915.1\|WP_153790371.1\|870641_872720_+\|PRD-domain-containing-protein	unknown	unknown	gnl\|CDD\|226234
NZ_CP045915.1\|WP_153790369.1\|867738_868305_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377255
NZ_CP045915.1\|WP_153790377.1\|881084_881810_+\|DUF998-domain-containing-protein	unknown	unknown	gnl\|CDD\|377627
NZ_CP045915.1\|WP_100361840.1\|886358_887510_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP045915.1\|WP_153790373.1\|876443_877340_-\|PhzF-family-phenazine-biosynthesis-isomerase	unknown	unknown	gnl\|CDD\|223461
NZ_CP045915.1\|WP_153792908.1\|872725_873865_+\|mannitol-1-phosphate-5-dehydrogenase	unknown	unknown	gnl\|CDD\|235031
NZ_CP045915.1\|WP_153792909.1\|875347_876343_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380345
NZ_CP045915.1\|WP_153790380.1\|884374_885142_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|369777
NZ_CP045915.1\|WP_153790379.1\|883682_884279_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|379082
NZ_CP045915.1\|WP_100361841.1\|885751_886309_+\|isochorismatase-family-protein	unknown	unknown	gnl\|CDD\|238496
NZ_CP045915.1\|WP_153790370.1\|868642_870553_+\|PTS-mannitol-transporter-subunit-IICBA	unknown	unknown	gnl\|CDD\|237905

Protein	Function_ID	Function_description	E-value
NZ_CP045915.1\|WP_153790368.1\|866650_867742_-\|hypothetical-protein	gnl\|CDD\|224195	COG1276, PcoD, Putative copper export protein [Inorganic ion transport and metabolism].	3.22582e-22
NZ_CP045915.1\|WP_153790381.1\|887799_888372_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	4.39924e-27
NZ_CP045915.1\|WP_100361841.1\|885751_886309_+\|isochorismatase-family-protein	gnl\|CDD\|238496	cd01014, nicotinamidase_related, Nicotinamidase_ related amidohydrolases. Cysteine hydrolases of unknown function that share the catalytic triad with other amidohydrolases, like nicotinamidase, which converts nicotinamide to nicotinic acid and ammonia.	1.21999e-42
NZ_CP045915.1\|WP_153790372.1\|874424_875186_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|225130	COG2220, COG2220, Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only].	5.54008e-23
NZ_CP045915.1\|WP_100361842.1\|885176_885575_+\|RidA-family-protein	gnl\|CDD\|100004	cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function. The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.	1.70604e-21
NZ_CP045915.1\|WP_153790374.1\|877790_879674_+\|ABC-F-type-ribosomal-protection-protein	gnl\|CDD\|223562	COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only].	0
NZ_CP045915.1\|WP_100361854.1\|873883_874309_-\|Lrp/AsnC-family-transcriptional-regulator	gnl\|CDD\|224439	COG1522, Lrp, Transcriptional regulators [Transcription].	3.77495e-27
NZ_CP045915.1\|WP_153790378.1\|882760_883084_-\|hypothetical-protein	gnl\|CDD\|212133	cd11523, NTP-PPase, Nucleoside Triphosphate Pyrophosphohydrolase (EC 3.6.1.8) MazG-like domain superfamily. This superfamily contains enzymes that hydrolyze the alpha-beta phosphodiester bond of all canonical NTPs into monophosphate derivatives and pyrophosphate (PPi). Divalent ions, such as Mg2+ ion(s), are essential to activate a proposed water nucleophile and stabilize the charged intermediates to facilitate catalysis. These enzymes share a conserved divalent ion-binding motif EXX[E/D] in their active sites. They also share a highly conserved four-helix bundle, where one face forms the active site, while the other participates in oligomer assembly. The four-helix bundle consists of two central antiparallel alpha-helices that can be contained within a single protomer or form upon dimerization. The superfamily members include dimeric dUTP pyrophosphatases (dUTPases; EC 3.6.1.23), the nonspecific NTP-PPase MazG proteins, HisE-encoded phosphoribosyl ATP pyrophosphohydolase (PRA-PH), fungal histidine biosynthesis trifunctional proteins, and several uncharacterized protein families.	3.85757e-15
NZ_CP045915.1\|WP_153790377.1\|881084_881810_+\|DUF998-domain-containing-protein	gnl\|CDD\|377627	pfam06197, DUF998, Protein of unknown function (DUF998). Family of conserved archaeal proteins.	1.66276e-07
NZ_CP045915.1\|WP_153790369.1\|867738_868305_-\|hypothetical-protein	gnl\|CDD\|377255	pfam04234, CopC, CopC domain. CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule. Along with CopA, CopC mediates copper resistance by sequestration of copper in the periplasm.	1.55005e-13
NZ_CP045915.1\|WP_153790371.1\|870641_872720_+\|PRD-domain-containing-protein	gnl\|CDD\|226234	COG3711, BglG, Transcriptional antiterminator [Transcription].	4.1329e-40
NZ_CP045915.1\|WP_153790373.1\|876443_877340_-\|PhzF-family-phenazine-biosynthesis-isomerase	gnl\|CDD\|223461	COG0384, COG0384, Predicted epimerase, PhzC/PhzF homolog [General function prediction only].	7.5442e-99
NZ_CP045915.1\|WP_153792908.1\|872725_873865_+\|mannitol-1-phosphate-5-dehydrogenase	gnl\|CDD\|235031	PRK02318, PRK02318, mannitol-1-phosphate 5-dehydrogenase; Provisional.	0
NZ_CP045915.1\|WP_153792909.1\|875347_876343_+\|cupin-domain-containing-protein	gnl\|CDD\|380345	cd02215, cupin_QDO_N_C, quercetinase, N- and C-terminal cupin domains. This family contains quercetinase (also known as quercetin 2,3-dioxygenase, 2,3QD, QDO and YxaG; EC 1.13.11.24), a mononuclear copper-dependent dioxygenase that catalyzes the cleavage of the flavonol quercetin (5,7,3',4'-tetrahydroxyflavonol) heterocyclic ring to produce 2-protocatechuoyl-phloroglucinol carboxylic acid and carbon monoxide. Bacillus subtilis quercetin 2,3-dioxygenase (QDO) is a homodimer that shows oxygenase activity with several divalent metals such as Mn2+, Co2+, Fe2+, and Cu2+, although the preferred one appears to be Mn2+. The dioxygen binds to the metal ion of the Cu-QDO-quercetin complex, yielding a Cu2+-superoxo quercetin radical intermediate, which then forms a Cu2+-alkylperoxo complex which then evolves into endoperoxide intermediate that decomposes to the product. Quercetinase is a bicupin with two tandem cupin beta-barrel domains, both of which are included in this alignment model. The pirins, which also belong to the cupin domain family, have been shown to catalyze a reaction involving quercetin and may have a function similar to that of quercetinase.	1.15349e-56
NZ_CP045915.1\|WP_153790380.1\|884374_885142_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	5.02103e-15
NZ_CP045915.1\|WP_153790379.1\|883682_884279_+\|AAA-family-ATPase	gnl\|CDD\|379082	pfam13238, AAA_18, AAA domain.	5.23946e-10
NZ_CP045915.1\|WP_100361840.1\|886358_887510_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	6.56895e-59
NZ_CP045915.1\|WP_153790370.1\|868642_870553_+\|PTS-mannitol-transporter-subunit-IICBA	gnl\|CDD\|237905	PRK15083, PRK15083, PTS system mannitol-specific transporter subunit IICBA; Provisional.	0

>NZ_CP045915.1|WP_153790374.1|877790_879674_+|ABC-F-type-ribosomal-protection-protein
MIVCSVNKIAKMHGGNSIFEDITFEIKEKERVGLVGPNGSGKTTLIRLLAGLETPDTGQIHWQKGAKIGYLEQIPQYQEATTVKDVLRSAFSSLLQTEEKMKRLEMDMSKETNPDKLEKLITDYGQLQDQFSLNGGYEIESRIEGIVQGLNIPLLLDQPFSKLSGGEKTKVGLGLMLLQQPDLLLLDEPTNHLDLMAVEWLGSFLQEYNGTVLIISHDRYFLDEVVNKIIDLEDGEVNTYHTNFSGFVKEKEAKLLREFQAYEEQQKKIKKMKEAIKRLRDWANRANPPNADLHRRARNMERALERMEKLRRPILNRKKMSLQMDGADRSGNDVIILKEVSKAFDEKQLFHDLNMHVTYQERVAVIGENGTGKTTLIKLILQQLEPDKGMVRVGSNVKIGYLSQNIFFDVKDETVIETFRDVVKVAEGEARKILARFMFYGYDVFKKVAQLSGGERMRLRLAQMMYQDINLLILDEPTNHLDIDSREVLEETLEEFQGTILAVSHDRYFLNKLFDKIYWIEGKKLFCFEGDYNWAKQKMAELREKEIPEHTEKKKKTSVQKDSTSTNQRIENNNFEKALELLEERISTIEKKLLETEDLEILQQLYQEKEEVEHEWEELCEQLENPY
>NZ_CP045915.1|WP_153790373.1|876443_877340_-|PhzF-family-phenazine-biosynthesis-isomerase
MKSIKVYHYDAFSKKPGKGNPAGVVLNGDELSAEEMQEIAFKVGFNETAFPVKSDIADLKIRFFTPGHEMNLCGHATMATVYALKSKGLLGDKTSLTIETKAGILPVILHSTEKDEFLITMKQAPPTFKAFNGSKQELAKAIGLDESDLHDELPVLYGSTGTWTLLVPIIELKAFKEMKPNNKEFPAILKEMPKASVHPFCMDTYDIHADMHARHFSSPYSGTIEDAVTGTASGVMGAYYAKYIDTNFQESLELLIEQGHEINKDGRVIVHVSKQKNSFDIEITGSAVLVEDFQVLLE
>NZ_CP045915.1|WP_153792909.1|875347_876343_+|cupin-domain-containing-protein
MELPMKKTPYLLRSGEGKRYLFGRQVATVMADMTSTENKFEIVLVSGGKGDGFPFHIHDQTYEGILLLDGKLELSINEENYLLLPGDYAHIPPGTIHSYRMQSHRTRFVSYTAKGETANLYSIIGQPYQKIERPPLVSNKIPHEKFMEASNSMDVRFLWDREIGNAKLVDNNELPDNIIPYVLESGEGDRLVAGDQLHRIIASQKNTDGHFIIVASEGPKGEKINDHYHEHHTETFFCLEGKMTMWANGEEIQMYPGDFLHVPENIIHSYRFDFHYTKMIGLLATGLFEPFFRTLGDPYEHHIFPSEPKQIRFDRVLDNIDKLDLKFVNQD
>NZ_CP045915.1|WP_153790372.1|874424_875186_+|MBL-fold-metallo-hydrolase
MQIQQIRNATLVVHYEGKKFLIDPFLADKGTYPPLPDSVRQDQMNPLVSLPISVEQIIEDIDAVIVTHLHLDHWDDAAKEVLPKDIKLFSQNEEDASEIKNAGFTNVEVLQVDTVFEDIQLVKTKGEHGRGEILKIAGQVCGVVFKHANEKTLYIAGDTVWYDGVQQEIETHQPEVIVVNAGDNQFFEGGSLVMGKEDVYQVYQAAPNAKIIASHMEAVNHWTLSREELISFADEKKISSNVLVPEDGEEYSF
>NZ_CP045915.1|WP_100361854.1|873883_874309_-|Lrp/AsnC-family-transcriptional-regulator
MLDSTDIRILEELSNNSRIKMKELGEKVHLTGQATADRVAKLEDSGVIEGYTIKVNQAKLGCSIHAFITIITQSISHQPYLAFIKTQKQYLINNYKISGEGCYMLECKFPSHEILDNFLEDLNKYANYKLSIVITKGSANF
>NZ_CP045915.1|WP_153792908.1|872725_873865_+|mannitol-1-phosphate-5-dehydrogenase
MKQAVHFGAGNIGRGFIGALFSESGYHVTFVDIADQIINQLNEQKSYQVKLATDKQETTTINNVSGLNNMAQENEVIETITNTTYLTTAIGPNILPRIAPLIARGISERVYQTDEQLYVIACENQIGATDILKQHILDNLDEDTKERLEGRVKFFNSAVDRIVPIQEDNDSLDVLVEPYYEWVVEAEEDIPAVEGMTIVVELAPFIERKLFTVNTGHAVIAYLGYLNGKPTIDKTLADEAIEKQVEATLKETGDYLVKQYGLDKEEHFKYIQKIVRRFKNPYLNDGVTRVGRAPIRKLGPEDRLVRPATEAQKAGLQFTNLSKAIAAALLFDHQEDEEAVKLQAMIEENGIAKVLQEVSNLTEDSDVTQEVVKQYDLLK
>NZ_CP045915.1|WP_153790371.1|870641_872720_+|PRD-domain-containing-protein
MFITSREKSIIDLVMKTSGKHTPRSLASYLHVSVRTVQRDLKAVGNILKSFELQLRRTTNDGLMIDGKNEHIFKLMQQLYHVHPTDETPEEKKLQLLIILLHEGSFFKAQVLAKQLGVSVTTLASYLDDVTDWLEKFSIELTRKRGVGVSIDGREANMRKALATYFLFHFHEELLESLYLLQKNNHLDGPVLGYFPPNYLVLIDEMVHHLFDRGQTRLADNDYLGLIVHIAITLQRVENDFLLEEETDSEDEDSTRPFQLISQLCDDLKSELSIPLTKKDVHYLDVILKGSKLQDSETIDYDSIMLGQIIKNIIQDISSQLHVDLSRDFSLFQGLLAHLEPSIFRLKHQMGLFNPLTEQINKKYLVLFMAVRNSLEKEFPDISFPDDEIAFIVLHFGSALLMNEEKTTIHAVVVCPTGIGTSKMLASRIQKEFTEINSVEIKSMKEMEKSNLDEFDIVISTVRLPFDDVHYILVSPLLSDEDIQMIRSFLQSNIQQLTGKKKYVKDSGKETRQEPSSLQDVLQEMKDVQTSIEAILDNFRVYRKSNEDYRQVLKEMVGELEQEGLITDAARVFQKLQDREKIGGLGIPDTNMGLFHCRDASIHELIFQICHLEHPCVIKGMDGKEVQLKNLLLMLSPEKLSFKEQEILSLISTSLIENDTALMIFSSSSEEMIKGKLEDLFSDYLQNKWIKE
>NZ_CP045915.1|WP_153790370.1|868642_870553_+|PTS-mannitol-transporter-subunit-IICBA
MAQSNIKVKVQQFGNFLSSMVMPNIGAFIAWGLITALFIADGFLPNENLAKLVDPMVFYLLPLLIGYTGGKLIHDQRGGVVGAIATMGVIVGAPDTPMFLGAMIIGPLGGYVIKKFDQAMEGKIRSGFEMLVNNFSAGILGGLLAILSFLAIGPAVNGFTQLLVAGVDWLIGVGLLPLTSIFIEPAKILFLNNAINHGILSPIGLEQARSTGESILFLLEANPGPGLGVLLAFMLFGKGSAKQSAPGAGIIHFFGGIHEIYFPYVLMRPMLLIAVILGGMSGIFTLVLLGGGLSAPASPGSIFAIAAVTPGKASVYFANFAAVIVATIVSFVVSGFVLKSGKQDDEDIEEATKKMQEMKGKKSSVAGAIQANQGILPEDVNKIVFACDAGMGSSAMGASLLRKKVKAADLNVSVTNTAISNLPDDAQVVITQEELTPRAKGKLPSAYHISVDNFLSSPEYDKLIDSLQNGVIEELAEVVEDTEANVTGADHDHDDDDLLREENIFLNQEFATKEEAIRFAGEVLVKAGYVEDSYVDAMIDRENVTSTYMGNNVAIPHGTEEAKKAVLRSGFTVLQVPNGVDFDGQEAKLIFGIAGKDGTHLDILSGIAVVCSDEENIEQMVQAKTTKELLDIINSK
>NZ_CP045915.1|WP_153790369.1|867738_868305_-|hypothetical-protein
MVKRLLFFSIVLLIAFPTAVGAHTHLETSDPEENSVLNEDTGTITLMFESTVQELNEITLTHEHGEELPVEKVTHEPADTLVVTLPDQMEDGNYTLSYSIAGEDGHVMEQELSYQFKNVEEEDVVEETEEASEEATEEEATESDQVEENVTKDSTDEANENSTLIAVIAIVLIVVAILAILMLRKKRK
>NZ_CP045915.1|WP_153790368.1|866650_867742_-|hypothetical-protein
MIVSISNGLLYICFAILMGSCLLGVIPKDMKTSVVMPKKTLAIAIILIPLLSFISLLDLAFTLNNYREESIVASIGYVISNIALGHAWLALSLLTLLFLILLFVLRQNATLPILYTLGIFLTFGMLFTQAAVGHSASMGSYPGAAAHLFHYIAVSAWIGVLLITSWFSQNDDNWQEFISWFTPFAIGCVAILALSGMFMNYFLNESIVDSWTLPYGQSLLWKFLLFIPILFFAFINSVLIRKRVKKDAQYSPRNWWRAESVIIITVIAVTASMTEQEPPHNIEQTLTTGESSILFQTFASVPATTDLILELNGLSVLFLLVGLLFLGCILYTFAQRTSPYLALVMAGLSAISLYLGLMNAVTM
>NZ_CP045915.1|WP_153790375.1|880004_880406_-|hypothetical-protein
MSNQNVYHSFNWKLIVILSSIALIRPFLSMFGISEAIGKPVVSITATILISLTWIVVVVLKKEAQPLLTLIFVGIGYGILAIIISGIFSPILTGHLQGPLTNPYAIVSVLFTNAIWGGITGAIATIFSKINHS
>NZ_CP045915.1|WP_153790376.1|880554_880989_+|hypothetical-protein
MKKIVVLISLLIFVLVPNQIYAQSEVACPKLEDLKDTTIKNKYELLKELKQIVADTYVEGEHGDLYSEWELRTVLPFPKTVGRKQDEIYYEMAKNFCGQEVADKSWLVRLYFPKWEGVSASALEGQIFLAKNKDDEWFVWFRYH
>NZ_CP045915.1|WP_153790377.1|881084_881810_+|DUF998-domain-containing-protein
MYTPYILMTLLTIIAFLIVLLLRNQHKIIAGIGFVSWISLSLYFVIEYIVIQATTASYNFLEQPMSDLGVTSCGTNTYSLAPYEICSPYHLLMNWTFTVTGIVIFFGAIALHQFWPDNKKTRIATLLLVIFGLSYNISGIIPADINFLWHTFGSIPGMIVQIPALILISIAIRKVKPKLAIFTFISTIVTTCSLIFLFYQPPFISLPGGLLQRILYGSIYFWMAITAVVLWRNINFERSGR
>NZ_CP045915.1|WP_153790378.1|882760_883084_-|hypothetical-protein
MNVNEFQDWVKEHYDRRGWTDLDIFIRIGFLAEETGEVARAIRALEIGRDRPDESLGTISQHKQELTEELGDVIGNIIVIANKYEIPLETIFQSHRDKLDKRFNSNK
>NZ_CP045915.1|WP_153790379.1|883682_884279_+|AAA-family-ATPase
MVIWLNGAFGSGKTQTSSELNRRIPHSFVYDPENIGYFLNRNIPKNICKADFQDYSIWRELNYTTIKYIVSEHDGVVIAPMTIVNPQYFEEIVGKLRNDGIIVHDFVLWASKETLKKRLRKRGERKNSWAEQQIDRCIEGLANDIFQYRIDTDHMPIDSVVETIASKLNIELLPDNRNKFRKKLDRVKSQLKHIRFFN
>NZ_CP045915.1|WP_153790380.1|884374_885142_+|methyltransferase-domain-containing-protein
MNIENPSFNYDIHGKKYSTYRQTDERIAQYIIDALGSSQTVLNVGAGGGSYEPNDRYVVAVEPSSSMRMQRLKANKVPAVIGTADSLPFDEYSFDASMATLTIHHWPDLEKGLKELRRVTKDQIVIMTYDPEALDVFWNAYYFPELIEVEKARYPKIDDIVGKLGGESDIIEIPIPIDCQDGFQEAFYARPEAFLEKEIRQSQSAWGFLSEGVEHKLVKRLKDDLDSGIWDEKFGSHRNMPFFNGALRLIISTKN
>NZ_CP045915.1|WP_100361842.1|885176_885575_+|RidA-family-protein
MESGKITRKNPTNMPEPVGHYTHITRIPRNAELFVTSGQIGVDQSGQFPESMNEQIRNTFYNIKTVLASENLATSDIIKVNIWATEEIDWNYMYEEWGKLFSNDYPAMTIGYISRLGLPEIKIEIEIWAAKP
>NZ_CP045915.1|WP_100361841.1|885751_886309_+|isochorismatase-family-protein
MKQTLLIIDAQQDLMEGSPEEQGVIDKEKIINNINTVIRKAIAENIPIVFVRDLEVSNGEGPGFQIHKDIKVPSTAEVFDKEATNSFYGTPLREHLNNSNVEHLVIMGCKTEHCIDTAVRTATVSNFDVTLVGDGHSTSDSKNLTAQQIILHHNETLHGHYNVDNFSIVRNSDEDLFKPIHNRYR
>NZ_CP045915.1|WP_100361840.1|886358_887510_-|AI-2E-family-transporter
MESSNRFFKFIGGKNIFYILAFFILIGITIFIYTKVSFIFHPLKVIFSTLAPPVILAFIAYYLLNPVVDILERLRIKRIWGIIILILGISGALTGIILLTAPAIEAQVKDLVEKFPSYLSQLGNSMTTWIQNSFLGPYYDEGYNWLMERLGELPEIIGNYITTGFQGVQNIASTITNTVVSIITFPFILFFLLKDGKKFKQFTVKVFPPRFRDDIKQILSNMDTQVGSYIQGQIIVASVIGILLFIGYLIIGLDYAFTLAIVAAVTSVVPYLGPTIAIIPAIIIAIVSSPFMLLKLAIVWIAVQFLEGNFVSPNVMGRTMKVHPLTIILVLLIAGNLFGILGIILGIPGYAIVKVIGGYLFYKFKKRYNKYFGEDRGKYEMEE
>NZ_CP045915.1|WP_153790381.1|887799_888372_+|histidine-phosphatase-family-protein
MVTVVYMVRHAESPFKLGEERVRGLSEDGEIATKKVTELLMDKDIAAIVSSPYKRAVQTVQGLALLKGLTIKEYEELKERPIKGLEYRLPEQELLKAIEQSFENKEYCLEGGETTTQAQKRAIPVIKQVLREYNGKKIVIGTHGNIMTIIMNYFDECYGYNFWRSTSKPDIYQLTFDDNNSLIEVERLWT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045915_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045915_2

3448911-3448986

Orphan

Consensus_repeat	Method
GATTTGTTGTTTATCTTGATTTATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045915_2

>merge|NZ_CP045915|2|3448911-3448986|CRISPRCasFinder
GATTTGTTGTTTATCTTGATTTATTCAACAAATCTTTTACCCCTCCACGAAGATTTGTTGTTTATCTTAATTTATT

>NZ_CP045915|2|2|3448911-3448986|CRISPRCasFinder
GATTTGTTGTTTATCTTGATTTATT	CAACAAATCTTTTACCCCTCCACGAA
GATTTGTTGTTTATCTTAATTTATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045915.1\|WP_153791907.1\|3454934_3455819_-\|permease	unknown	unknown	gnl\|CDD\|223773
NZ_CP045915.1\|WP_153791891.1\|3435181_3438283_-\|rhamnogalacturonan-lyase	unknown	unknown	gnl\|CDD\|199906
NZ_CP045915.1\|WP_153791904.1\|3453141_3453501_-\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|366361
NZ_CP045915.1\|WP_100359679.1\|3455904_3456375_-\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|197670
NZ_CP045915.1\|WP_100359696.1\|3430929_3431490_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379534
NZ_CP045915.1\|WP_153791902.1\|3451887_3452445_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|223340
NZ_CP045915.1\|WP_153791906.1\|3454768_3454921_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045915.1\|WP_153791894.1\|3441758_3443255_+\|alpha-N-arabinofuranosidase	unknown	unknown	gnl\|CDD\|226064
NZ_CP045915.1\|WP_153791901.1\|3451307_3451886_-\|dihydrofolate-reductase	unknown	unknown	gnl\|CDD\|334719
NZ_CP045915.1\|WP_153791892.1\|3438656_3438887_-\|DUF3949-domain-containing-protein	unknown	unknown	gnl\|CDD\|315735
NZ_CP045915.1\|WP_153791899.1\|3449118_3450420_-\|purine-permease	unknown	unknown	gnl\|CDD\|274468
NZ_CP045915.1\|WP_153791895.1\|3443627_3446162_+\|family-43-glycosylhydrolase	unknown	unknown	gnl\|CDD\|350153
NZ_CP045915.1\|WP_153791903.1\|3452556_3453141_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224647
NZ_CP045915.1\|WP_153791896.1\|3446292_3446700_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319899
NZ_CP045915.1\|WP_153791898.1\|3448029_3448842_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223267
NZ_CP045915.1\|WP_153791900.1\|3450416_3451007_-\|xanthine-phosphoribosyltransferase	unknown	unknown	gnl\|CDD\|181705
NZ_CP045915.1\|WP_153791905.1\|3453810_3454572_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045915.1\|WP_153791890.1\|3431564_3434666_-\|rhamnogalacturonan-lyase	unknown	unknown	gnl\|CDD\|199906
NZ_CP045915.1\|WP_153791897.1\|3446751_3447867_-\|quinoprotein-glucose-dehydrogenase	unknown	unknown	gnl\|CDD\|369642
NZ_CP045915.1\|WP_153791893.1\|3439079_3441503_+\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|223815

Protein	Function_ID	Function_description	E-value
NZ_CP045915.1\|WP_153791907.1\|3454934_3455819_-\|permease	gnl\|CDD\|223773	COG0701, COG0701, Predicted permeases [General function prediction only].	2.22072e-49
NZ_CP045915.1\|WP_153791891.1\|3435181_3438283_-\|rhamnogalacturonan-lyase	gnl\|CDD\|199906	cd10318, RGL11, Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.	0
NZ_CP045915.1\|WP_153791904.1\|3453141_3453501_-\|lactoylglutathione-lyase	gnl\|CDD\|366361	pfam00903, Glyoxalase, Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily.	1.92954e-14
NZ_CP045915.1\|WP_100359679.1\|3455904_3456375_-\|MarR-family-transcriptional-regulator	gnl\|CDD\|197670	smart00347, HTH_MARR, helix_turn_helix multiple antibiotic resistance protein.	7.46295e-17
NZ_CP045915.1\|WP_100359696.1\|3430929_3431490_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379534	pfam14278, TetR_C_8, Transcriptional regulator C-terminal region. This domain is a tetracycline repressor, domain 2, or C-terminus.	1.09999e-15
NZ_CP045915.1\|WP_153791902.1\|3451887_3452445_-\|dihydrofolate-reductase	gnl\|CDD\|223340	COG0262, FolA, Dihydrofolate reductase [Coenzyme metabolism].	8.72e-18
NZ_CP045915.1\|WP_153791894.1\|3441758_3443255_+\|alpha-N-arabinofuranosidase	gnl\|CDD\|226064	COG3534, AbfA, Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].	6.62132e-121
NZ_CP045915.1\|WP_153791901.1\|3451307_3451886_-\|dihydrofolate-reductase	gnl\|CDD\|334719	pfam01872, RibD_C, RibD C-terminal domain. The function of this domain is not known, but it is thought to be involved in riboflavin biosynthesis. This domain is found in the C-terminus of RibD/RibG, in combination with pfam00383, as well as in isolation in some archaebacterial proteins. This family appears to be related to pfam00186.	7.62823e-20
NZ_CP045915.1\|WP_153791892.1\|3438656_3438887_-\|DUF3949-domain-containing-protein	gnl\|CDD\|315735	pfam13133, DUF3949, Protein of unknown function (DUF3949). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 69 and 87 amino acids in length.	1.98622e-09
NZ_CP045915.1\|WP_153791899.1\|3449118_3450420_-\|purine-permease	gnl\|CDD\|274468	TIGR03173, pbuX, xanthine permease. All the seed members of this model are observed adjacent to genes for either xanthine phosphoribosyltransferase (for the conversion of xanthine to guanine, GenProp0696) or genes for the conversion of xanthine to urate and its concomitant catabolism (GenProp0640, GenProp0688, GenProp0686 and GenProp0687). A number of sequences scoring higher than trusted to this model are found in different genomic contexts, and the possibility exist that these transport related compounds in addition to or instead of xanthine itself. The outgroup to this family are sequences which are characterized as uracil permeases or are adjacent to established uracil phosphoribosyltransferases.	0
NZ_CP045915.1\|WP_153791895.1\|3443627_3446162_+\|family-43-glycosylhydrolase	gnl\|CDD\|350153	cd18832, GH43_GsAbnA-like, Glycosyl hydrolase family 43 protein such as Geobacillus stearothermophilus endo-alpha-1,5-L-arabinanase AbnA. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. It includes Geobacillus stearothermophilus T-6 NCIMB 40222 AbnA, Bacillus subtilis subsp. subtilis str. 168 (Abn2;YxiA;J3A;BSU39330) (Arb43B), and Thermotoga petrophila RKU-1 (AbnA;TpABN;Tpet_0637). These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. Many of these enzymes are different from other arabinases; they are organized into two different domains with a divalent metal cluster close to the catalytic residues to guarantee the correct protonation state of the catalytic residues and consequently the enzyme activity. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	7.59625e-149
NZ_CP045915.1\|WP_153791903.1\|3452556_3453141_-\|hypothetical-protein	gnl\|CDD\|224647	COG1733, COG1733, Predicted transcriptional regulators [Transcription].	2.51643e-09
NZ_CP045915.1\|WP_153791896.1\|3446292_3446700_+\|VOC-family-protein	gnl\|CDD\|319899	cd06588, PhnB_like, Escherichia coli PhnB and similar proteins. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to bleomycin resistance proteins, glyoxalase I, and type I extradiol dioxygenases.	4.16876e-40
NZ_CP045915.1\|WP_153791898.1\|3448029_3448842_+\|hypothetical-protein	gnl\|CDD\|223267	COG0189, RimK, Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis].	1.43313e-37
NZ_CP045915.1\|WP_153791900.1\|3450416_3451007_-\|xanthine-phosphoribosyltransferase	gnl\|CDD\|181705	PRK09219, PRK09219, xanthine phosphoribosyltransferase; Validated.	4.04681e-113
NZ_CP045915.1\|WP_153791890.1\|3431564_3434666_-\|rhamnogalacturonan-lyase	gnl\|CDD\|199906	cd10318, RGL11, Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.	0
NZ_CP045915.1\|WP_153791897.1\|3446751_3447867_-\|quinoprotein-glucose-dehydrogenase	gnl\|CDD\|369642	pfam07995, GSDH, Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.	1.08865e-82
NZ_CP045915.1\|WP_153791893.1\|3439079_3441503_+\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|223815	COG0744, MrcB, Membrane carboxypeptidase (penicillin-binding protein) [Cell envelope biogenesis, outer membrane].	0

>NZ_CP045915.1|WP_153791898.1|3448029_3448842_+|hypothetical-protein
MKLVSFNAFRTIGIPGVRYIKPEHMFNEIDIIKEADLILFPETWQVSTLVYGLKKQIFPSIETMQIGANKIEMTRALWSVAKENVPYTEILASTDRNIAHILETFPFPFVAKEAKNSMGKGVFLIENNAHFINYARNNDVLYVQEYLPNDGKDLRVCVVGDQIHDAYWRIGLEGEFLHNVARGGEVSHQFIPAEALALVSKVANLLHIDHAGFDILVSEGKYYILEFNVLFGNQGLTNQKMTVAQAIHHYISKQFVPPHPTSPTPGKVIS
>NZ_CP045915.1|WP_153791897.1|3446751_3447867_-|quinoprotein-glucose-dehydrogenase
MLNREWFILLFILFFITACSADKQPKLIEEQPNSSSETKNKDQSDITEIAEEQEVIAENLNVPWAIETADDTFYLTERPGSIVKIENGQVERQNVELEKELATAAEAGLLGFVFDQDFSESNLAYAYYTYKDDTGQFNRIVRLRLDDDTWTEEEVLLDKIPSGAYHHGGRLKIGPDHKLYATAGDASDAEIAQQNESLGGKILRMNLDGSIPADNPFEDSYVYSLGHRNPQGLTWDKDGTLYASEHGNSANDEVNKLEAGQNYGWPIIEGKEEQQGMITPLFTSGADTTWAPSGIDYHDGKLYVATLRGEAVIEFDLETGDQKEVVSELGRVRDVLIKDNNLYIITNNTDGRGNPEEDDDILYKVSLSDID
>NZ_CP045915.1|WP_153791896.1|3446292_3446700_+|VOC-family-protein
MPVNPYLMFNGNAREVIEFYEKTFQTEPAEIMTYGDMPVQKKEIPEEVKPLVVHGRIFVDGTPIMFSDVTPGMEYKEGNNVNLTVVSDNVELIQHAYKILQEDGKLEMEMQKTFWSENYAKLTDKYGIHWQLSTE
>NZ_CP045915.1|WP_153791895.1|3443627_3446162_+|family-43-glycosylhydrolase
MKSIIRKSILLFLVFMLIPATVGATKNSQQSDNSNKPGQPSEGPVPHFNNVSVHDPSIIKDGDTFYAFGTHIEAAKSKDLISWDRFTNGYTTPDNTLYGDLSENLAGSFEWAGENDADSAGGFAVWAPDIFYNEDYVNEDGSTGAYMIYYSASSTYIRSAIGYAVSQDIEGPYEYVDTVVYSGFTEEEAYDNNSTINKQWENTNISSLVEDGTLAEENDDWFSSDGSFNNTMYPNAIDANLFYDEDGKLWMTYGSWSGGLFLLEIDKETGQVIYPEEDGETEDGRMIDRYFGTKIAGGYTKSGEGPYIVYDEETGYYYLYVTYGWLGADGGYNMRVFRATAPEGPYLDAKGQDAVLPGNVSNHTYGNKIMGNFMFDRKIGEAGDGDGFGYVSPGHNSVYLDEDTGEQLLVFHSRFPNQGEAHEMRIHSIFMNEDDWPVVSPYRYTGKALEKVNKQDIEGLYKFINHGNEYSGAIETSEYITLEKNNKVTGAAEGTWKKTDHNQAEITLDDETYKGVFVPQWDEVSEQYVMTFTAISDQGIAIWGSQQADRTDAEVVKAIEEELNLGNTNEVVSDLELPTVGANGATISWETSDESVITNTGEIDRPSEEVGSLNATLTATITQGEETATKSFEITVLPYQNAELTSHFPFDSNLSDQHGDFGTGTITGDRITNTGGSISYEEGVSGQAIYFDGDSGVLLPDNLITNHQYSVSFWVNPEDLSTYTTTFFGGEFSSWISMLPQGPASDRTMLWSGEAWYDAPSSYTINTNEWTHVAFSVNNGTVKLYLNGEEEFVGSNFPDIFTNADADFSLGVNHWDTPFKGYIDDLQIFNGELSPEQLNQLSSQ
>NZ_CP045915.1|WP_153791894.1|3441758_3443255_+|alpha-N-arabinofuranosidase
MTKETKVEVNPRRVLSSGNSMLYGHFIEQFHRQIYGGIFDPDSPLSDEQGFRQDVLDALKNIGTPIVRWPGGCFVSNYHWEDGVGKREPFFDKAWRVEEPNLFGTDEFVAFCRLIGAEPYICTNAGTGTAEEMSNWVEYCNLKEEGKYAKMRQENGLKEPFNVKYWSIGNENYGNWEIGAKDQKEWARLVLESAKMMKRVDPTIELLAASISDLDWNINLLKEAGDFLDWISIHGYWDRLHEVDNPSPYETCMIHTLEIEEQILKTKHILGSLGYLNKIKIAFDEWNLRGWHHPNVHRGDWMADDIITSRDRNDINSTYTMADAVFNACFLNTCLKHSDVIGMANFAPVINTRGAIFTHEDGLVLRSTYYVFELYTKCMGDKIVDTWTSQNDFFEVKHGGKTYHVPSLDVIATTREGSENVRIAIINRHPNEKRVINIKNNIQFENGTVYSIIGSSKDAYNDIDQLDNCKTVQHTVKVNAYEAAVEVEPHSVNVLVFE
>NZ_CP045915.1|WP_153791893.1|3439079_3441503_+|PBP1A-family-penicillin-binding-protein
MSHMTMKRTTRRKRKQKRCIRIIIATFLIFLSLLIIGGISLFALIQDTPALSEEQLQNPSTSVIYDKNENKVANITGNEHRLPVNIDDVPTQVQNAFIAIEDARFRKHSGVDLKRIAGAILANMEEGWGAEGGSTITQQVVKNTYLSPEKTLKRKAQEAYLAIQMEKNYSKDEILEMYINTIYFGHGAYGLGAAAEVYFNKDVSELTVSEAALLAGLPQRPSGYDPFKYPEAATDRREIVLSAMERHNFISSEMAEEAKNTEIESMLSQEQENNSYQGFIDYAIEELIKKGFEENELYNGGFKIYTTLDPEAQAFTNEVMTGTDTIPFPDEAFKAGVVLMDTKTGAIRAIGGNRDPEAEGIQRGFNFATDIKRQPGSTIKPILDYGPAIEYNNWSTYHQIKDEKLELDGKEFKNYDGRFHGIVSMRESLVNSYNIPAIKTFLELENDQAKQFAANLGIDLEHAYPSYAIGGFGNEDGVSPLKMAGAYATFGNNGQYHEPYAVTKVEYPAGEVRELESEGQKAMNDYTAYMITDMLKDVVEEGTGTLARIDGLPMAGKTGTTNPPEGISAGSTDSWFVGYTTEYTAAVWTGYETTSTEQFISKEDARISRLLFKEIMSHASQDIETADFTKPSSVEEVMIDTRNGKVASNHTPSSSIVAELFVKGTTIPMEYKPVQKDTTNNNSNNQEEKEKKEKEKDQKEEKKEQEKMEKEKKKEEEKKKKEEKEDNNQEKQDSDDNNASNRDKKEKNTDEDANNNSEQNDNSEEDSEDSQEENDSNETDQPGSDDESNKEEESIESDKNNNEEEED
>NZ_CP045915.1|WP_153791892.1|3438656_3438887_-|DUF3949-domain-containing-protein
MIMVGAYILLSSVLVPFQYRYLEGLEEEQYRNWKNQSDYYKSKSAAEQVLHANAQGNLLFVLANVMAYIIYKIIKH
>NZ_CP045915.1|WP_153791891.1|3435181_3438283_-|rhamnogalacturonan-lyase
MPSKSLMKKHFLLITIGILILSSFSIVPTAFANDDFQTVYGTDFGDAEPLEMENWGFSTFAATVSVNEEDIAGNDTAKLDFSIVDQSGGRVATKDFDSAVKGTQIQVKLDWYPGKNNDKGSNANENAGELRIEDEAGNKVFTINNTNNAPLTFFAGNQEPVETGITNPEAWYEVDINFDLLENMIHFSIGDESYPVSLEDVAFDGSVDKLKLVGIRTSGNNHTWTTYLDNVEINQIPVVENAITAVHELPYQRVFLGETTTDIDSIELPETVPVTLANNSTVDAPIANWQVVGEEWNPDQEGVYLFEGVLAESEEIENPFDRTATVYVYNRLTPPETNRETEWLDRGVIALQAEGGIFVSWRLLSDEYDQDVSFDIFRNGEQLNDQPLNVTNYLDEDGNSGDEYRVETIVNGEVTETNEVDSLSEDYLSIPLQKPEGGTTATGDYTYTANDASVGDLDGDGEYEVILKWYPTNSIDSSQTGMTGPTIFDAYKMDGTLLWRINMGHNLTSGAHYHQFVVADFNGNGKSEFLIKSADATTSYGTTDGEYDPNKVLSVIGNPEDDGKWVNDSGHVYGGPEYMSVFDGETGEVIDTIDYAFPVEKEEGDGGASWGDTWYNRSDRFLSGLAYLDGQTPSAIYGRGYYERTSFVAYNLVDDELTEEWTFDSDEAGRGSSLGFHSLATGDVDNDGFDEIIAGSLTLDHDGTILYAMDGEMGRDEGSHGDALHVGAFDPAREGLHVFGVHEVPAVASVEYHDGATGETLMAYFANRDVGRGLAANITSNPGYEFWGTGGNDAETGGGIYNVQGNVHADSFRDAGLSVNFALYWDGDLLHELLDDTAITKYQEDSGQANVMKDFEGVVSNNGTKATPSLQADVLGDWREEVILPTTDSNELRIFSTTVPTEYRLPTLMHDSVYRMGIAWQNSAYNQPPHIGYYLGEDIRDQVLAGELEFPSVNYTTSFAGLKHQVDMEVTAASDQVLRNKLEQAEHHLEKDRTEQAVKQLEDFMKHLKRSDLADDVKDKLLQDAETIINSWS
>NZ_CP045915.1|WP_153791890.1|3431564_3434666_-|rhamnogalacturonan-lyase
MHAKSRLKKQFIFMTVVILILSSFSIVPTAFANDEYQTVYATDFGDAEPLEIENWGFSTFAATLSINEEDIAGNDTKKLDFSVVDQSGGRVATKDFDSSVKGAQIQVKLDWYPGTINDKGVHPNENGGELRIEDATGNTVFTINNTNNAPITFFAGNQEPIETNITTPEAWYQVEIIFNIIDNEILFSIGDENHAVSLNDVAFDGSVDKLKFVGVRTSGNNHTWTMYADNIEMSHIPIEDNVITTVEQLPYERVYVGETTSNIDSIGLPETVPVTLADNTTVEVAVESWQEDGQSWNPDESAVYKFEGILAESEEVENTFERTATIYVYNRLTPPETNRDTEWLGRGVIALPSEDGIFVSWRLLADEYDQDVTFNVFRNGEKINEQPLEVTNLLDEDGNDGDTYQIETIVNGHVTETNEVDSLDKDYLSIPLQKPEGGTTATGDYSYSANDASVGDLDGDGEYEIILKWRPSNAMTALQDVITGPTIFDAYKLDGTPLWRMNMGMNLTSGPAYHQFVVGDMNGNGKSEFLIKTADATTVYGVTDGVFDEDKVISVIGNPEDDGKWINEGGHVVTGPEYVSVFDGETGEDIDTIDFAFPVEKEEGDQGASWGDDFYNRSDRFLSGLAYVNGKTPSAIYGRGYYERTTFVSYSLQNGTLVEDWTFDTDEAGRGEGLGNHNLATGDVDNDGYDEIIAGSLTLDHDGTILYAMDGEMGRVKGSHGDALHVGAFDPDREGLHVFGVREDSEVASLEYHDGATGETLEAFYAYKDAGRGVAGNITSKPGYEYWGTGGANVDDGGGVYNVQGDVIEESFRDIGLPVNFVTYWDGDLSHELLDHTSITKYDEATGEANVIEEFENVVSNNGTKANPSLQADILGDWREEIIFPTEDSSELRVFSTTIPTEYRLPTLMHDSVYRMGIAWQNTTYNQPPHISYYLGEDVREQVLAGELDFPSVDYTPSLASLKHQVNLEVTSENEQVLLNQLDQIEHHLEKGRAKQAVKHLEDFMKHVNRSDLADDVKEGLVNDAESVLNSWS
>NZ_CP045915.1|WP_100359696.1|3430929_3431490_+|TetR/AcrR-family-transcriptional-regulator
MSDKLDRRKKYTRMVLKDSLIELMNEKTFSSITVKEVCFRADINRSTFYTHFTDVLALLYSIEEEIIEEMNKSLNAFSFAKEEESIQMTEKLLEYIKERKEIFEALLENNTGTSFEKRVMDIARHCLMNKTHTANIDAASYLSTFMVSGSIHVIKDWLLNNHTQSPKQMAELISQFTNKGIGSLNL
>NZ_CP045915.1|WP_153791899.1|3449118_3450420_-|purine-permease
MKLTKGKMASLGLQHVLAMYAGAVIVPLIVGASIGLANEQLTYLISIDILMCGVASILQVWKNKFTGIGLPVVLGCTFTAVGPIIAIGNQYGITSVYGSILVSGLVVVLIAKFFSKLIKFFPPVVTGSVVTIIGITLIPVAMNDLAGGEGSADYGSFTNLALGFGTLLVILLIFRFGKGFVQAIAILLGILLGTVTAYFMGMVDLSPVGESTWLHLPTPFHFGTPEFHLTPILTMTLVAIVSLVESTGVYFALGDICDKKLEDKDLEKGYRAEGVAIIFGGIFNSFPYTTFSQNVGLIQLSGVRTNNVIYTAGVMLILLGLVPKIGALTLVIPSAVLGGAMVAMFGMVIAYGIKMLSNVDFASQENLLIVACSVGMGLGVTVVPEIFAGLPESITILTESGIVIGSLTAICLNVIFNFRKTDQTNMKDSEKAA
>NZ_CP045915.1|WP_153791900.1|3450416_3451007_-|xanthine-phosphoribosyltransferase
MEKLQQKIIEEGVALSDTVLKVDKFLNHQIDPQLMHEIGKEFVKRFENKKITKIVTLESSGIAPAVMAGLILDVPVVFARKKKSLTLKDGLITSTVYSYTKQETNEISVAEKFLSKDDHVLIIDDFLANGQAALALIDIVEKTNAEVTGIGIVIEKAFQDGGDILRNKGYQIESLARIKSLGNKSIEFVSEKEYAQ
>NZ_CP045915.1|WP_153791901.1|3451307_3451886_-|dihydrofolate-reductase
MRKIISQMMITVNGLVEGPHHELDWHVIDNEYYQYNDKLFRKVDTLLFGRVTFQHMEAFWQTPVAYEKFPETAERMNQYDKIVFSNTLDQVTWQNTSLITGKEFEKQLRQLKKQNGKDMLVLGSSDLVSALTEYGLVDEYHLIVNPVALAAGKRLWSGLNHSITLQLIDSNVFQSGNVLLRYHRRNHEYSDE
>NZ_CP045915.1|WP_153791902.1|3451887_3452445_-|dihydrofolate-reductase
MRKVIYSQMVSVDGYMEDQNGSIDWSKPDEEVFQHIIDQEKTFDTHLYGRKTYENMAGHWPYVVDDPESSSQDKEWARMWVDMKKIVFSKTLDKAEWNSKIVKDNLREEIEKEKALPGKNLSLGGATIAQTLMELDVIDEYWLYVHPVTLGGGKPMFHKQLTLQLIEARSFASGIVLLRYRKRGE
>NZ_CP045915.1|WP_153791903.1|3452556_3453141_-|hypothetical-protein
MHVKEAIQFTHLLSGRWVLPILIHLQSSGGRFTPLQKKLGISPSRLSDNLTKLVSAEVVQRLTPYERRHPLLPEYKLTPYGNSLLEIAMVIQAAEEAINHGPLHRKTWNWPILLALLHQYARFQSILELLGNPSPRILSTRLNELCEMWLVKKEIKEEPKLVYTYKINESYRSSLSAVWKKVSEIEEHKPYTKD
>NZ_CP045915.1|WP_153791904.1|3453141_3453501_-|lactoylglutathione-lyase
MYKSGLTIWYNVKSMDESVKYFTEGLGFSLDFKDEEQRIAMITTNTKDYCIGFAEAETIAPVTSSAVFEVEDIEKTYVELKERGIQFTGEIETIPNLVKLATFQDPDGNSFELSQTLTD
>NZ_CP045915.1|WP_153791905.1|3453810_3454572_-|hypothetical-protein
MHAPSYILDTWHKFDHYPMETLTKMWYFYQNTEKKQRDVALMEDHYKQYGITGNCFDLAIWLIDVFQKDGITAYPIGHDLHSEEAHAAVMALDEKGNRYLCDLGDQWIKPILMETQHADYTNESLSGFFPAANVQVFSTENQIEITYQRPNGKVSRQSYDPQPVNMEEFLLAAEFSQHTIDPKPLFECRIPYKAETAHWEFNDWEAYLSTSEGLFKEPSFKSIEEWATRINKVSGYDQQFLLTTLKGYQKLQG
>NZ_CP045915.1|WP_153791906.1|3454768_3454921_-|hypothetical-protein
MVDKKGLKNIFSSSDKSCCGVEFEEFKPNHDKEQNEKKKDDLKSEDQSCC
>NZ_CP045915.1|WP_153791907.1|3454934_3455819_-|permease
MSSFISFIQQFLFLFLELTVLFIVISFMVSLIQQKVTEEQIKEILHRPNKWSGYLYGTGLGALTPFCSCSTIPILAGLLSSKAPFGPSMSFLVASPLLNPVIVILLWTFLGWEITVYYFVIVWIFAMVIGFVWEKFGFRTLVKDVRVRRKDSTKVESTVPKWKLALQDAWEFFIPVLPFLVLGVFIGAFIYNFVPESFIIQVAGSDKPWTIPIASIIGIPMYIRAEVMLPIGDALITKGMGIGAVIALLIGGAGASLPEVVLLSKLFKRKLVIAFVLSILFVAISTGFMIQLIL
>NZ_CP045915.1|WP_100359679.1|3455904_3456375_-|MarR-family-transcriptional-regulator
MDKSSNKKQDIQEMRHLFVILSRQFGLLQKESSQCCGVTTIQSHILYEIKQGHHMTLNELAQRLCLDNSTTSRHIHGLVEKEYVVRLPHPEDRRYVTLELSEKGKALEEEITEMMTTSIMDMFKHLPEEKMTSMRTEIKDLTEIMRKSDMCCYPPF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP045915_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP045915_3

4023122-4023225

Orphan

Consensus_repeat	Method
TTTTCATAATGTCAACCGGTTGACATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP045915_3

>merge|NZ_CP045915|3|4023122-4023225|CRISPRCasFinder
TTTTCATAATGTCAACCGGTTGACATTATGTTTAAATCGGGGTCTTACTTTATTATAAAACCAATAGTATAGTAAGCGTTTTCAAATGTCAACCGGTTGACATT

>NZ_CP045915|3|3|4023122-4023225|CRISPRCasFinder
TTTTCATAATGTCAACCGGTTGACATT	ATGTTTAAATCGGGGTCTTACTTTATTATAAAACCAATAGTATAGTAAGC
GTTTTCAAATGTCAACCGGTTGACATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP045915.1\|WP_100359215.1\|4023260_4024232_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NZ_CP045915.1\|WP_100359208.1\|4036432_4037398_-\|LacI-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380514
NZ_CP045915.1\|WP_153792231.1\|4011361_4012252_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472
NZ_CP045915.1\|WP_100359209.1\|4034962_4036315_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270451
NZ_CP045915.1\|WP_153792235.1\|4024614_4024773_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP045915.1\|WP_153793020.1\|4019219_4022921_-\|DUF1080-domain-containing-protein	unknown	unknown	gnl\|CDD\|350134
NZ_CP045915.1\|WP_091481080.1\|4012268_4013243_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|226666
NZ_CP045915.1\|WP_153792233.1\|4015605_4017207_-\|response-regulator	unknown	unknown	gnl\|CDD\|227095
NZ_CP045915.1\|WP_153792230.1\|4009730_4011341_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270299
NZ_CP045915.1\|WP_153792232.1\|4014260_4015592_-\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270451
NZ_CP045915.1\|WP_091481101.1\|4033991_4034897_-\|sugar-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224096
NZ_CP045915.1\|WP_153792234.1\|4017184_4018996_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225519
NZ_CP045915.1\|WP_153792238.1\|4030928_4033139_-\|glycoside-hydrolase	unknown	unknown	gnl\|CDD\|214757
NZ_CP045915.1\|WP_153792236.1\|4024912_4025125_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|350134
NZ_CP045915.1\|WP_153792237.1\|4029417_4030926_-\|sucrose-6-phosphate-hydrolase	unknown	unknown	gnl\|CDD\|224536
NZ_CP045915.1\|WP_153792229.1\|4008276_4009725_-\|glycoside-hydrolase-family-32-protein	unknown	unknown	gnl\|CDD\|350134
NZ_CP045915.1\|WP_100359219.1\|4013476_4014097_-\|DUF624-domain-containing-protein	unknown	unknown	gnl\|CDD\|227865
NZ_CP045915.1\|WP_153792228.1\|4007154_4008120_-\|carbohydrate-kinase	unknown	unknown	gnl\|CDD\|238572
NZ_CP045915.1\|WP_153793021.1\|4025253_4028889_-\|endo-inulinase	unknown	unknown	gnl\|CDD\|350110
NZ_CP045915.1\|WP_153792239.1\|4033152_4033995_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472

Protein	Function_ID	Function_description	E-value
NZ_CP045915.1\|WP_100359215.1\|4023260_4024232_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	3.57515e-103
NZ_CP045915.1\|WP_100359208.1\|4036432_4037398_-\|LacI-family-transcriptional-regulator	gnl\|CDD\|380514	cd06291, PBP1_Qymf-like, ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs. This group includes the ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus metalliredigens (strain Qymf) and its close homologs. Qymf is a strict anaerobe that could be grown in the presence of borax and its cells are straight rods that produce endospores. This group is a member of the LacI-GalR family repressors that are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the sugar-binding domain of ABC-type transport systems that contain the type 1 periplasmic binding protein-like fold. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding which in turn changes the DNA binding affinity of the repressor.	2.2509e-97
NZ_CP045915.1\|WP_153792231.1\|4011361_4012252_-\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	3.9437e-63
NZ_CP045915.1\|WP_100359209.1\|4034962_4036315_-\|extracellular-solute-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.18067e-55
NZ_CP045915.1\|WP_153793020.1\|4019219_4022921_-\|DUF1080-domain-containing-protein	gnl\|CDD\|350134	cd18622, GH32_Inu-like, glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	3.78474e-118
NZ_CP045915.1\|WP_091481080.1\|4012268_4013243_-\|sugar-ABC-transporter-permease	gnl\|CDD\|226666	COG4209, LplB, ABC-type polysaccharide transport system, permease component [Carbohydrate transport and metabolism].	2.17096e-120
NZ_CP045915.1\|WP_153792233.1\|4015605_4017207_-\|response-regulator	gnl\|CDD\|227095	COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms].	1.36446e-73
NZ_CP045915.1\|WP_153792230.1\|4009730_4011341_-\|extracellular-solute-binding-protein	gnl\|CDD\|270299	cd13581, PBP2_AlgQ_like_2, Periplasmic-binding component of alginate-specific ABC uptake system-like; contains the type 2 periplasmic binding fold. This subgroup includes uncharacterized periplasmic-binding proteins that are closely related to high molecular weight (HMW) alginate bining proteins (AlgQ1 and AlgQ2) found in gram-negative soil bacteria. The HMW alginate uptake system is composed of a novel pit formed on the cell surface and a pit-dependent ATP-binding cassette (ABC) transporter in the inner membrane. The transportation of HMW alginate from the pit to the ABC transporter is mediated by periplasmic HMW alginate-binding proteins (AlgQ1 and AlgQ2). Alginate is an anionic polysaccharide that is made up of alpha-L-mannuronate and its 5'-epimer, alpha-L-guluronate. Alginate is present in the cell walls of brown seaweeds, where it forms a viscous gum by binding water. Alginate is also produced by two bacteria genera Pseudomonas and Azotobacter. AlgQ1 and AlgQ2 belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. However, unlike other bacterial periplasmic-binding proteins that deliver small solutes to ABC transporters, AlgQ1/2 can bind a macromolecule and may have specificity for either sugar or a certain type of polysaccharide.	1.6118e-163
NZ_CP045915.1\|WP_153792232.1\|4014260_4015592_-\|extracellular-solute-binding-protein	gnl\|CDD\|270451	cd14748, PBP2_UgpB, The periplasmic-binding component of ABC transport system specific for sn-glycerol-3-phosphate; possesses type 2 periplasmic binding fold. This group includes the periplasmic component of an ABC transport system specific for sn-glycerol-3-phosphate (G3P) and closely related proteins from archaea and bacteria. Under phophate starvation conditions, Escherichia coli can utilize G3P as phosphate source when exclusively imported by an ATP-binding cassette (ABC) transporter composed of the periplasmic binding protein, UgpB, the transmembrane subunits, UgpA and UgpE, and a homodimer of the nucleotide binding subunit, UgpC. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 proteins are comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.64207e-94
NZ_CP045915.1\|WP_091481101.1\|4033991_4034897_-\|sugar-ABC-transporter-permease	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	8.92875e-80
NZ_CP045915.1\|WP_153792234.1\|4017184_4018996_-\|HAMP-domain-containing-protein	gnl\|CDD\|225519	COG2972, COG2972, Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms].	1.90483e-42
NZ_CP045915.1\|WP_153792238.1\|4030928_4033139_-\|glycoside-hydrolase	gnl\|CDD\|214757	smart00640, Glyco_32, Glycosyl hydrolases family 32.	3.5025e-89
NZ_CP045915.1\|WP_153792236.1\|4024912_4025125_-\|hypothetical-protein	gnl\|CDD\|350134	cd18622, GH32_Inu-like, glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	5.4524e-18
NZ_CP045915.1\|WP_153792237.1\|4029417_4030926_-\|sucrose-6-phosphate-hydrolase	gnl\|CDD\|224536	COG1621, SacC, Beta-fructosidases (levanase/invertase) [Carbohydrate transport and metabolism].	8.40599e-145
NZ_CP045915.1\|WP_153792229.1\|4008276_4009725_-\|glycoside-hydrolase-family-32-protein	gnl\|CDD\|350134	cd18622, GH32_Inu-like, glycoside hydrolase family 32 protein such as Aspergillus ficuum endo-inulinase (Inu2). This subfamily of glycosyl hydrolase family GH32 includes endo-inulinase (inu2, EC 3.2.1.7), exo-inulinase (Inu1, EC 3.2.1.80), invertase (EC 3.2.1.26), and levan fructotransferase (LftA, EC 4.2.2.16), among others. These enzymes cleave sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.83808e-161
NZ_CP045915.1\|WP_100359219.1\|4013476_4014097_-\|DUF624-domain-containing-protein	gnl\|CDD\|227865	COG5578, COG5578, Predicted integral membrane protein [Function unknown].	1.40929e-36
NZ_CP045915.1\|WP_153792228.1\|4007154_4008120_-\|carbohydrate-kinase	gnl\|CDD\|238572	cd01167, bac_FRK, Fructokinases (FRKs) mainly from bacteria and plants are enzymes with high specificity for fructose, as are all FRKs, but they catalyzes the conversion of fructose to fructose-6-phosphate, which is an entry point into glycolysis via conversion into glucose-6-phosphate. This is in contrast to FRKs [or ketohexokinases (KHKs)] from mammalia and halophilic archaebacteria, which phosphorylate fructose to fructose-1-phosphate.	1.10683e-97
NZ_CP045915.1\|WP_153793021.1\|4025253_4028889_-\|endo-inulinase	gnl\|CDD\|350110	cd08996, GH32_FFase, Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.	1.64579e-92
NZ_CP045915.1\|WP_153792239.1\|4033152_4033995_-\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	1.18594e-63

>NZ_CP045915.1|WP_153793020.1|4019219_4022921_-|DUF1080-domain-containing-protein
MEALPTEQVVSTNEDKEVSVINANTNLANWIVHGEGTLEDTEQGLKLTSEPNENVMAISSVQSEDFIYEADIKILDQSADATLIFRSGEDGWDSYMVQIAPDAGIIRLRDARDEGRLKEETHVNIQEGEIYHLKVKVVADNIKVYWEDQYTPVIDSNVSLYHNGYLGLNVWNGSALFQNVEVSEVTTNLGSTLVEEGNWEPNIKGLKGLADENEIAKKVYETQASDFVLEGNVSLDDEQAEAGLTFRMNEDGTDGYQAILMKHGEEMEVRLQKTDGTVIGKSTRSFKSPNGTKHHLEIIVNKEQITLYLDGYADPAVQVTDSSYSDGLTGLTVLKGEGYFQDVYVVPTNSYYKENYRPDYHYTPARGSASDPNGLVYFEGEYHLFHQDGGKWAHAVSEDLINWKHLPIALPWNDYGHVWSGSAVADLHNDSGLFTDSGGKGLIAYYTSFNPDAHNGNQRIGLAYSKDKGRTWEYSTEHPIVIENPGKNEEDPGGWDFRDPKVVRDEANDRWIMVVSGGDHIRFFTSKDLIQWEHTDNFGYGDYIRGGVWECPDLFELQVEDTDVKKWVLMISTGANPNTEGSDAEYFIGELTPDGKFINDNPVGEELKTDYGKEFYASMSFANMPDNRRITMAWMTNWDYPFDFPTEGWQGQLTIPRELRLIQTDEGIRLAQAPIEELQMIRKTVFETENKHIKPEDALNLLKKVNEGSYEIEAELEIPSNSDVTEFGFQLREGTEEKTLVGYNITDNLMFIDRSNSGYTDFSNQFTTLHEAPLLPENKRIKLNIFVDNASVEVFANDGKSVFSDVIFPKATSRGVSFYTEDGAVNIVSLKVHTLNDIWNRDINEKASIVTNTKEIEMNIGDTHSVYAAIDGSKENEMQPIKWETSNADIVKIESVNNRNAVIKAIGDGEATITASTPDKKVSEEINVSVYDGEFHSNLTGWTSDISGATWITTEDGIRGSHNSDANYMAKENGGNFIYESDMMLDEAGGAGSILFRASKDGRSGYYFNLDPNMKAFRLFYKMDGRFEERMIIKEVPAFIQPGKIYKVKIEANGPQIRINVGGENIINIKDGTFAEGHFGLNVFGGRATYQNVKISNVTEADLMETSFINSHTGQTIYAATSNNGELVTVGKEDELTNWTLIPTGDEHDSYSIRNEEGKTIDLDTGENKIQLYDYLGYDNQRWIIKENENATVSIISVFNSQAMEVTEEGELTLQEYDPSKLHQQWTLSSEVD
>NZ_CP045915.1|WP_153792234.1|4017184_4018996_-|HAMP-domain-containing-protein
MFFSLRNKLFLVFSCLLTIPFLVLSLVIPSLFTIYIKDQTQELTVEMMDQFSLYIDSITKQAEDVGQQVLVNPITQEWLQLETKQKGDDTLTTARLLVRNELNALLSSMMVNNSNNISVSIFTHDGEGIWGDYADLENNTWYSEFENHNKTYTRSHIDPNQQSAVMRDLHINSHLIPLVDMNSFGDSGVIKVNFSTELIENALDKIKIGEQGNTFIVNEQGANVLTGEIKTPQEIVTDSLEEMKDRQNEQGLLEIEGDNEKYLLFYQHLSVGDWILMSEVTEADLFAHPYQIQKSMLLLSFGVFLITIIASFVFSSSITNPLRELTKAMNYLEKGDFNSAKQIMPTIKSENNEVRYVLRVFAHTLEQLKSLIDNEYKANIRRRNAEYKALLLQINPHFLNNTLEIMGGLAAQGKNKDVMNVSVYLGKMLRYSLDTKSNTVTLGEEIQYIRNYATILQLRYEDALHISIDEDPESKNLPIIKFIIQPLVENAVKYSFIAKNHAKVYIKTSYQSNHLTIVIEDDGIGMSEEVIYHLIDNDDNKTKSSTLESSGNSIGLKNVLDRLQLYYEEQFSYQIDSEINKGTRITLGINYEGREMNEESHNR
>NZ_CP045915.1|WP_153792233.1|4015605_4017207_-|response-regulator
MRKVIIVDDEAQVRKGLHWKVDWEEEGFQIVAEAPNGKEALALIAENRIDLVLTDVRMPIMGGIELAKQCQENYRNTKVIVLSGYSDFEYVKNSMKEGVRDYLLKPVDPDELQEVLKRMRQEIENDKSKQLELERVQRLVRTQLQEVQEQYLLYLVKEEWLQHSIVKERLKQLKLHSLLQENVKVQFITVEVRDLIEHSNRVKQLQMTFQMLCKEIAEKQSGVLSFYDPNYTNMIHFLRLVDDSNNPSYLVKSVQHNVKVLLKLEAVIGIGNIVTGITEFKMGYISSLLSWSQSQLGTHSQVIDETVKKEGIADFSPELEKRITNAIEQTNLERFKSELELLLGETNKQSVLSFSIMSNRILFSLSAIAKKYDMETTQTQRFIWESQQAIWELNSQKRVMDHLVQLARIIIERVSNTRITDGKLIVDGVKRYLDQHYGNDVSLTALSELFHINSAYLSEIFKLQVGQNFSEYLVERRMKEAKKFLKDRHLKIIDVANLVGFSSSAYFSTVFKKHVGQTPAEYRKSLTVFSDFE
>NZ_CP045915.1|WP_153792232.1|4014260_4015592_-|extracellular-solute-binding-protein
MKKIVYILVFILLISIVTCYLLMVVKPLTSDRGRHSAEEVMNEEDKVHLTFWRNFGNSAENEAYNELISDFETAHPNININMEEIEYSNYEVKLRTEIVTGTGPDIMAIDSPNLALYANSGILLSLDPFVEEDVDIKGDFPESTIEGLTYQNEIYLMPIVESSIALYYNRHIFEEAGVPFPEKSPVKPMTWEETLEIAKAVQNKEQGVYGIDPAQGFGNGESPAYFKLPLLWQFGASVLSPDGSTVSGYLDSEEALAALQFYQDLYHKEGVAALELPDKAFETNQLAMTVLGSWALTDLEKNGFILGEDFGVAPLPKADKQVVPNGSWALGISSKTEHPEEAWKFIRYVTSYEGMKKYVTITGDIPARYSVAEALPVFDEYPYNIFLHQAYYYSRNRPVTPAYPDISTAVKELFEDIGIANKDVGSSVDEAVETINKRLKEIE
>NZ_CP045915.1|WP_100359219.1|4013476_4014097_-|DUF624-domain-containing-protein
MLEKRWYIRLGNLGFNLILLNILWITFSLLGLIVFGFFPSTVALFAVIRKFILEDEDIPVLPEFIKQFKNEFMKSNLMGYSVTFIGVFLFLDFKIVQQISNDYLQMMMFNLILVIGIFYAISILYIFPLYVHFDFKLIQYFRYACILTIARPFHTIMLIAFLGAILFIYMYIPALILLFGISLFCFVVMKIAALSFPRKQGLKESY
>NZ_CP045915.1|WP_091481080.1|4012268_4013243_-|sugar-ABC-transporter-permease
MGQGWDTSPKSDALTKQINEGREKKKSSLEYIKKNYILYLFLLPAVILVFIFNYIPMYGVTIAFKDFSPLKGIMGSEWVGFKHFIKFLESPNFHQIFMNTIKLSTFELLIGFPVPVILALMLNQVRRANIKKNIQLVLYAPHFISVVVIAGMTFIFLSPAGPLNVLLTLVIDRPISFMSEPEYFRTIFIASGIWQSAGFASIIYVAALSNVDPQLHDAATIDGASLFQRIRHIDLQTLKPTMAVLFILAVGGIMTIGFEKAYLLQTSMNLPASEIIDTYVYKRGLQAADWSFGAAIGLFNSIISLVLLVTVNTVVKKANGETLY
>NZ_CP045915.1|WP_153792231.1|4011361_4012252_-|ABC-transporter-permease-subunit
MNNNLINNSKTDKVLLFINKILLVVVVLIVTLPLLYVLLGSFLQPDVLLTKGLSFDPKHWTVDGYVRIFNDGSIVRGFINSILYSTGFTLVSVGFTILAGYSLSIDNLVGKKIIMLYFLFTMFFNGGMVPVYLLVKDLGLLNSPWAIILPGAITVWNIILARTFFKGLPNELKEAARIDGASDAKIFISIILPLAKPIIFVLALYSFIGQWNAYFDAMIYLEDKSLYPLQLVLRDILIQNEIEPGMIGDQLARAELQRIAEMIKYSAIVIASLPLMIMYPFFQKYFEKGVMVGSLK
>NZ_CP045915.1|WP_153792230.1|4009730_4011341_-|extracellular-solute-binding-protein
MKNMYRSLLTLTSVLLGILLIAGCGNSEKASSENYELNDITFPLEEEVTLKFMTESSPMAPEDPNDKLILQRLEEETGVHIEWKNYTGESFAEKRNLAVASGELPDAIMNAGYSDYELLDLANDEAIIPVEDLIDQYMPNLQAVLEQAPEYRAMMTAPDGHIYAFPWIEELGAGKESIHSLDATGWINVEWLDELGLDMPSTTEELKEALVAFKENDMAGDGQTIPMSFIINHGGEDLSFLFSPFGEGDNWDHTVVSNDDEVIFTTAQEGYREGINYLHELYELDLMDVEAFEQDWNSYLAKGKEERYGLYFTWDKANITGQNDKYQLLPPLEGPDGRKHVARSNGMGFDRARMVITSANENLELTAKWIDQLYDPHQSVQNNWGTYGDEEKQNIFEYDESENMLRHLSLEGTAPVELREETSVGGPLAILDGYYGDVTTMPDDAAWRLEILHEELVPYMNNDNIYPKVFMTLEELDDLSTIEADLFPYVERKKAEWISNGNVDEEWEEYLTELDRLGYQEWLEIKQTAYDRNAEE
>NZ_CP045915.1|WP_153792229.1|4008276_4009725_-|glycoside-hydrolase-family-32-protein
MSLCQVQKYRPHLHFSPQENWMNDPNGLIYFKGEYHLFFQYNPNDSKWGPMHWGHAVSKDLIKWTELPIALYPDENGTIFSGSAVVDWNNTTGFFPDEPGLVAIFTHHLENEVYIPPKQSQSLAYSYDNGRTWVKYQHNPVLEHDSNVDFRDPKVFWHHSSNKWMMVLATGQTISIYSSPNLIDWCFESEFGDNFGSHDGVWECPDLFELQVENSEESKWVLFVSIGDNPKFEKGSRTQYFVGTFNGSVFQAEHEDEKWLDYGKDNYAGVSFSDIPVEDGRRIYLGWMSNWRYANEVPTQGWRSQMTLPRELGIRKVKDSYSVIQQPVQELDVYFTRKEVINNKLIDKELRYDFDESYGMITLNIENMDATKYGVDIHHTQSNVTSIIIDTQKQLLILDRKNSGMNSFSDNFSMPQEIKLFDTQKIKLNLVIDSSSIEIFGNEGEFALTSLVYPDKACEEISLHALDGEMKVEEGYLLKPRT
>NZ_CP045915.1|WP_153792228.1|4007154_4008120_-|carbohydrate-kinase
MVDVTALGEILVDFTPNGVSEHGNPVYAANPGGAPGNLLVALSRLSKETSFIGCVGNDQFGNMLEDTLYNNGVSTSGMVYSDIHTTLAFVHIDESGDRSFSFCRNPGADTMLSKDDLKPESIAQTKIFHVGSISMTNEPSRKATRTALKVAKENGVTISYDPNLRRDLWDSLEGAKERIVELLYYADIVKLSEEELEFIAGTNEVEKGAKLIFQQYNVALLFITAGSTGSYCCNKHVILFKPGLSIKAIDTTGCGDAFFAGVLYKILENNMSYQNISEKEMSELLLFGNAMGAYVAQKQGGIPALPNLNEINKYISEVKEE
>NZ_CP045915.1|WP_100359215.1|4023260_4024232_-|LacI-family-transcriptional-regulator
MTIKLNDVAEVAGVSPTTVSRVINNRGYISEKTKQKVESAMKELSYYPNDVARSLYKKRTYLVGLIIPDISNPFYGELSLAIEGICSDMGYRVILCNSLGQPEKEEAYSVMLIRNQVDGIIVCSYNRDVETYKKSNLPIVAIDHYLAETIPVVGSDNYEGGKMAVQHLIERGCKSIIHINGPAELETPTQLRRKAYEDLIKKPITYVVKSPFDEEEIIQTIKKIFNEHPETDGIFASDDLMAASCLQIAEEMNIEVPKQLKIVGYDGTSTVNKLLPQLTTIKQPIEDIASTAVSQMMELIKHPDKELHRETFLLPQIIINKTT
>NZ_CP045915.1|WP_153792235.1|4024614_4024773_+|hypothetical-protein
MQHLLIQERWRADGGAQGGGGESSTEVDCSGIIDSNADYEIHDFQENGSVFL
>NZ_CP045915.1|WP_153792236.1|4024912_4025125_-|hypothetical-protein
MAYSTDKGRTWSKYSGNPVIHNTENPPVFGGPKVFWHESSSKWVMLLAAENVAQEQFVKTSAVWRTTSPT
>NZ_CP045915.1|WP_153793021.1|4025253_4028889_-|endo-inulinase
MKATGTGTDTYSRVEWDASSHIDTTVRIKIVDNSTEGHINLDDVNVPPTPSLHDHIEPSIYNHDFEYTALPPDEIRGWEIVSGDAFGPDSLVHENEWSQGDTFHHEGDYHLWSFQDGGDASTGELHSETFTLDGSGGIDFLISGGEDEENLYVALVRESDGEELFKETGRNTEKYQRVFWDASEYIGEAVYIKIVDHATGDWGHINVDDFHVYNSVYDQNLIGYWNLDEGTGKVTTEQVSSIQNPVDYHLNEGVFQDSQDPLWKSDGISNSALLFDGYSTWVTHTPDKFPAPDNAITVEAWVAPRNFEHGDEGRLSAIVNQHDREEKEGFILGNFRHGTWGLKFGTGSDWYEVMSDTLLPLKEWSYIAATYDSASGEAVLYQNGEKVASRDFPAGQQIKPSVKDLLIGKNNDGMWLYGYDLNMFSGLIDEVKIYNQTLSATEIQNAYDSYLSNLNGNLPTPDMKMDRSILAKDKHRPQFHMSPPNHWGNEPGGPIYFNGQYHVFYQSNPRGPFWNHIRWGHLVSDDMVHWRDVDDAVIPGKHDVDPDGAWAGGAVVDDNDVPVIFYTAGDDRDFPNQRINIARSTYPEDGDNDLNRWEKSQVVILEQQKGEGIQGEFRDPFVFKDEDTWYMLVTSGKEDENGDPIGGTALVYSTKDSSFENWTYQGDLFVGDYDQYPKTGRVWELPILLPLGDSGKYIFLINPAKTSRQEYQSRYTYYWIGTWDPETASFTPDNEEPTLLDVGEHFTGPAGMVTPDGRTIIHSITQGRRPGNDDYDAGFAHNYGLPVEVSYRSDGQLGIQPIQELEQLRGDQLVDITSDTSFDDANQILSSVHGDMLEIELEIDNGSANEAGISLRRSPNGEEETTIYYKESSKEFWVNRLKSSLDPDVEKWYQGGNVDIGTDNIKLHIYVDRSEINAYINGLKGLTTRAYPTRDDATGLKLWANDHSDTISVKSLKIWEMNSAYTPVQAAGVSLNPSSMDLIEGDSEWLTATVTPSHVTNKEVIWTSDDPSIATVVNGKVTAHAEGTVTITAKTRDGGLTATNTIDVVPEPEHDELVNHDFETPDLSGWTILSGDAFTDLDVTSANDWGWGGPFNHHRNYHLYSIYEGDDSQVGEIRSQKFILGGNGQIDFLVSGGDDIYHLYVALVRDADGKELMKVTGGDQEGYTRVHWDASEYIGEKVYIKVVDQATGSWGHINIDDVNAPVHPTEK
>NZ_CP045915.1|WP_153792237.1|4029417_4030926_-|sucrose-6-phosphate-hydrolase
MTINTINTKNTNETYRHHYHLMPEYGWMNDPNGFSFFNNSYHLFYQYYPYDTVWGPMHWAHAVSDDLIKWDHEKIALRPDKSYDKNGVFSGSGLQVGNEHWLYYTGHNDSFLDFLYDQNLKKKEGVIESEEIVSPIRQVQCLAKSADGITYEKYEHNPVISSQQVPSNIRLEDFRDPKVWEHHDRFYMIVGAKSHENVGHVLFYCSNDGVTWEYLNQLSLGPEYGTAWECPDLFELDGKHVLIFSPQEIPRIGYRYENIHSTMALIGEFDYETGEFIVENEQELDQGFDFYAPQTILSEEGKRVMVAWMNMWDVEYPLHELGHGWNGSMTLPRELLLKDGKLIQKPYHTIDKYREERIEWSHFSIKDYFENDKLHGNCQKMEIQFCMNDSDYFNMEFFKGDREKLLLSFDKSRNEIVLDRRNAQFPIKNMAIHNDFTRSHSIDLSQKVKLNIFLDVSSIEIFVNDGEHVFTSLFFSKELGKQVLLHSEGHTHIDELIKWELR
>NZ_CP045915.1|WP_153792238.1|4030928_4033139_-|glycoside-hydrolase
MSLIYDLPFREGKGNQTKEAIRGNILPIHYVFNHAKYKASCSPNWVESPVSGYAVDFDGYSTYIKDQPLEVNGSFSISAFLAPRCFEACHGDVPTTIIDQINQSSQQGFALSIFRHGEVQFELGDGRNIYRFRTDRQLELLTKSFLTVSYNQEELSVTIYINGKKELESTNIKYFRPADIALSIGLNNHPFEISEVFKGGMFAGLIDFIKVYDHALTDKDIQKEYDKIRDKRSVPLEDIDLDEQKLLDDVHRPQYHAIPPQHWMNEPHAPFYYKGKYHLFYQKNASGPYFSHLHWGHWTSDDLVFWENEKTALFPQKGELSPSGVWSGSATIGPNNKPYLFYTFANFNKKYNQGVAIARPENVEDPHLVDWKMEPQGAIYQTDQQGIPSQFRDPFVWKDETEEKWYLIIGGGVKDKGPTVWIYTSTDCEHWDFKGELFSVDSSLYPYLGTNWELPVLLPVRDQQGQVKYAFIFMSFFDDESKYEVDTYYYLGEFDKQKVQFIPDTIEPELMDYGRFKFSGPSGFVDPVTNKTIVFSILQGDREEQEEYEAGWAHHAGLPIELFLENQELRIQPLENLASLREELLIHESNKSIEEANHKVKNIQDKMLEIMIEFEETENLVGLELKKDPANQEKTKLLFDKANDRVWLDRTESRKDKEGDIQGGSLKLDEGFKAHIFIDHSAMECYLNQKKMISSRASPVSSNSDYLSIVGNTDIRIKSIKIFRLQSIWKQKEMSD
>NZ_CP045915.1|WP_153792239.1|4033152_4033995_-|ABC-transporter-permease-subunit
MKGITVIRLLKYIVLIAFAILFLFPTVWMFVSSTKTVVEISEEIGSMQSFIPNFTNIQNWLVPYQEMFSRFNFSIHFFNSVYYTFIIVFGSLFVNSLAGYALAVFDVPFKKFITGALIILIIFPFQSVFIQIFIIINQWNLTNTVWGLALPHIGSAFYIYLFMVFFQKIPKELRESAYIDGASNWKIFTKIVVPISKPIFMTIGILVFVGAWNDYVWPLMVFTEESKYPLSVAVNIMNETKPAYLNQVMAGLTVTTIPILLIYILGQKYITPQNSSSGIK
>NZ_CP045915.1|WP_091481101.1|4033991_4034897_-|sugar-ABC-transporter-permease
MHNIKQKIKQNKTLDFIFSGKILFLLPAFALISIFVIYPLILAVGYSFTDYYLLKPNDISFVGFDNYMEIAYDKYAKKAFFNSAKYVIYIVPLQVILSLFLATLIAKKSKTNTLFRTAFFSPYILSIIVVSLLWKNILDPNSGIVNEFLASLGFAKQEFFSDPNLALPTISFIILWQGISFQMLILMAALQDIPSSLYEAASMEGANAWQKFKHITLPSIKGQVVFVLIVVTTGTFKIIIEPLVITNGGPQGSTSSILLYMFEQGTRYRQIGYASAITVIFAIILIMIAFVQRKLVKEEEG
>NZ_CP045915.1|WP_100359209.1|4034962_4036315_-|extracellular-solute-binding-protein
MWKRFLIKGGEVMKNIISFLVIPLIFLALAACSNSSNNTSENSDAEEDVKELEVWVHVPADEPEGENYDVRAKEFEEAHENVDVTVEHIVKTGGGSGYNDRLNAAITTGELPDIIALESVYAASYTDSDILLPLNEYLDQATLDSYLDTIISAGSVGDNIYALQSFDLSSPVYYNVDLFEEAGIEVPADENGNWTLDLAWSYEEFLENARKLKDHMGQEPVHMFTENNGWHMYAHSPIIFSNDARMVGENGLDTEGYLDSNNTMEALQFLDTLFRDGIVASTTREDAFALEEAAISFEGPWMVDVFQSEYPDLNWSIMPYPYGKDGHQSAPHGSWYIAATQNTEYPELSAELVAHLTNKDSAIKMEEAAGLIPGHKELLDSSETYSDYPRKLMLDQLVNTNHLKPKSPIFPVLEDALGDIMEGIALDNGSLESLINDAKEKVDREADRFK
>NZ_CP045915.1|WP_100359208.1|4036432_4037398_-|LacI-family-transcriptional-regulator
MATIKDVAKLAGVGISTASRVINKSGYVSESTKIKVQDAINKLGYVPNETARAFVTQDSKIVALFLPSIHHAFFSELAYYIEDALDKNGYKMLLCNSTGNIQKELSYISMLKQNKVSGIIGISYNEIESEIHNSMPIVLVDRHIGTIPYVSSDNYGGGKIAFQVLKDTGCQHLAYIGSYSNSVLTEVEKRQKGFEDAAKEDGMDYIIYTEEDPIKDQTAFLKRFLSQYKNVDGVFAENDLMALELFELAKEQNIKVPEELSIIGYDGIKVYEVLKSKLSSIRQPVEVMGRSLVELLIKRIKGSYVTPVIHPVEFVKGETTR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

784932 : 793133

Synechococcus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153790318.1\|784932_786228_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	6.5e-18	24.5
WP_100361925.1\|786241_786955_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	2.8e-39	39.4
WP_153790319.1\|786951_787203_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_100361923.1\|787199_787883_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_153790320.1\|787866_790095_+	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	2.9e-143	40.8
WP_100361921.1\|790070_791483_+	amidophosphoribosyltransferase	A0A1B1ISH6	uncultured_Mediterranean_phage	1.7e-48	31.0
WP_153790321.1\|791539_792568_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	6.4e-69	44.1
WP_153790322.1\|792560_793133_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.5e-27	38.8

DBSCAN-SWA_2

1906129 : 1913243

Streptococcus_phage(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100362504.1\|1906129_1906990_+	YitT family protein	M1Q1P6	Streptococcus_phage	9.3e-37	34.1
WP_100361043.1\|1907190_1907877_+	cell division ATP-binding protein FtsE	G9BWD6	Planktothrix_phage	2.2e-28	35.3
WP_100361042.1\|1907866_1908760_+	ABC transporter permease	NA	NA	NA	NA
WP_153791001.1\|1908798_1910208_+	peptidoglycan DD-metalloendopeptidase family protein	A0A2D0WXW0	Clostridium_phage	3.6e-14	42.6
WP_153791002.1\|1910389_1911868_+	PDZ domain-containing protein	A0A0R6PIZ1	Moraxella_phage	3.7e-25	32.2
WP_100361039.1\|1912026_1912320_+\|holin	holin	H9A0W5	Staphylococcus_phage	5.2e-16	50.5
WP_153791003.1\|1912319_1913243_+	N-acetylmuramoyl-L-alanine amidase	A0A0N6W8I1	Bacillus_phage	1.4e-54	58.7

DBSCAN-SWA_3

1931680 : 1944496

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_100361024.1\|1931680_1932631_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	2.4e-86	53.6
WP_100361023.1\|1933028_1933910_+	RNase adapter RapZ	A0A0R8VB27	Thermobifida_phage	9.3e-08	28.2
WP_100361022.1\|1933912_1934866_+	YvcK family protein	A1IMD5	Streptococcus_phage	3.3e-59	38.5
WP_100361021.1\|1934900_1935848_+	DNA-binding protein WhiA	Q7AWZ3	Streptococcus_phage	1.1e-49	37.5
WP_100361020.1\|1935949_1936207_+	HPr family phosphocarrier protein	NA	NA	NA	NA
WP_100361019.1\|1937099_1937696_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.3e-53	53.9
WP_153791016.1\|1938323_1940120_+	aminotransferase class V-fold PLP-dependent enzyme	A0A0B5JD48	Pandoravirus	2.5e-12	23.1
WP_153791017.1\|1940145_1941153_+	aliphatic sulfonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_100361016.1\|1941184_1942042_+	ABC transporter permease	G3M9Y4	Bacillus_virus	4.8e-25	28.6
WP_100361015.1\|1942057_1942786_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-39	42.0
WP_153791018.1\|1942810_1944496_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	8.4e-159	58.8

DBSCAN-SWA_4

2585443 : 2595828

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153791393.1\|2585443_2588548_-	AAA family ATPase	G3MAB6	Bacillus_virus	2.9e-11	25.7
WP_153791394.1\|2588549_2589701_-	exonuclease subunit SbcD	NA	NA	NA	NA
WP_153791395.1\|2589779_2590142_+	hypothetical protein	O64030	Bacillus_phage	2.6e-09	32.2
WP_100360421.1\|2590172_2590394_-	YozE family protein	NA	NA	NA	NA
WP_100360420.1\|2590417_2591218_-	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	2.7e-14	26.8
WP_100360419.1\|2591250_2591424_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_100360418.1\|2591454_2591634_-	twin-arginine translocase TatA/TatE family subunit	NA	NA	NA	NA
WP_100360417.1\|2591728_2592220_-	dihydrofolate reductase	G3MBI7	Bacillus_virus	9.0e-37	49.4
WP_100360416.1\|2592270_2593224_-	thymidylate synthase	A0A0N9SH48	Staphylococcus_phage	1.4e-131	68.4
WP_153791396.1\|2593403_2594480_+	hypothetical protein	X5JAJ3	Clostridium_phage	2.7e-09	35.6
WP_153791397.1\|2594471_2595323_-	DUF72 domain-containing protein	A0A1S5XY79	Kurlavirus	5.1e-11	23.8
WP_100360413.1\|2595627_2595828_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-18	63.1

DBSCAN-SWA_5

2629683 : 2672716

Bacillus_phage(28.57%)

protease,coat,tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153791421.1\|2629683_2630877_-\|tRNA	CCA tRNA nucleotidyltransferase	H7BUW3	unidentified_phage	1.4e-38	46.1
WP_100360378.1\|2630857_2631994_-	N-acetyl-alpha-D-glucosaminyl L-malate synthase BshA	NA	NA	NA	NA
WP_100360377.1\|2632020_2632416_-	methylglyoxal synthase	NA	NA	NA	NA
WP_153791422.1\|2632429_2633230_-	4-hydroxy-tetrahydrodipicolinate reductase	NA	NA	NA	NA
WP_100360375.1\|2633222_2633573_-	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_153791423.1\|2633640_2634318_-\|protease	Zn-dependent protease	NA	NA	NA	NA
WP_153791424.1\|2634394_2635126_-	hypothetical protein	NA	NA	NA	NA
WP_153791425.1\|2635245_2635395_-	hypothetical protein	NA	NA	NA	NA
WP_153791426.1\|2635818_2636400_-	DUF1405 domain-containing protein	NA	NA	NA	NA
WP_100360371.1\|2636534_2637329_-	cytochrome C oxidase Cbb3	NA	NA	NA	NA
WP_018933723.1\|2637356_2638031_-	cytochrome b6	NA	NA	NA	NA
WP_100360370.1\|2638034_2638556_-	ubiquinol-cytochrome c reductase iron-sulfur subunit	NA	NA	NA	NA
WP_100360369.1\|2638698_2639157_-	DUF2487 family protein	NA	NA	NA	NA
WP_100360368.1\|2639280_2639841_-	IDEAL domain-containing protein	G3MAV7	Bacillus_virus	2.2e-31	42.8
WP_153791427.1\|2639858_2641130_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_153791428.1\|2641509_2642802_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_153791429.1\|2642814_2643918_-	prephenate dehydrogenase	NA	NA	NA	NA
WP_153791430.1\|2643929_2645018_-	histidinol-phosphate transaminase	A0A1X6WGT4	Pacmanvirus	1.0e-19	25.7
WP_100360363.1\|2645042_2645414_-	chorismate mutase	NA	NA	NA	NA
WP_153791431.1\|2645413_2646490_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_153791432.1\|2646489_2647656_-	chorismate synthase	NA	NA	NA	NA
WP_100360360.1\|2647741_2648512_-	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_100360359.1\|2648547_2648994_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	9.4e-25	45.0
WP_153791433.1\|2649007_2649979_-	heptaprenyl diphosphate synthase component II	NA	NA	NA	NA
WP_100360357.1\|2649991_2650708_-	demethylmenaquinone methyltransferase	NA	NA	NA	NA
WP_153791434.1\|2650704_2651487_-	hypothetical protein	NA	NA	NA	NA
WP_035721086.1\|2651657_2651930_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	1.5e-28	74.4
WP_100360355.1\|2652284_2653763_-	stage IV sporulation protein A	NA	NA	NA	NA
WP_153791435.1\|2654256_2654985_-	hypothetical protein	NA	NA	NA	NA
WP_100360353.1\|2655007_2655205_-	DUF2768 domain-containing protein	NA	NA	NA	NA
WP_100360352.1\|2655463_2655724_-	stage VI sporulation protein F	NA	NA	NA	NA
WP_153791436.1\|2655782_2656823_-	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_153791437.1\|2656834_2658145_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_100360349.1\|2658276_2658462_-	hypothetical protein	NA	NA	NA	NA
WP_100360348.1\|2658467_2659352_-	hypothetical protein	NA	NA	NA	NA
WP_100360347.1\|2659348_2659948_-	hypothetical protein	NA	NA	NA	NA
WP_100360346.1\|2660219_2661365_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_100360345.1\|2661463_2662042_-	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_100360344.1\|2662046_2662718_-	(d)CMP kinase	NA	NA	NA	NA
WP_153791438.1\|2662734_2663382_-	flagellar brake protein	NA	NA	NA	NA
WP_100360342.1\|2663490_2664828_-	germination protein YpeB	NA	NA	NA	NA
WP_100360341.1\|2664846_2665752_-	spore cortex-lytic enzyme	A0A172JHR8	Bacillus_phage	1.2e-21	46.0
WP_100360340.1\|2666114_2666771_-\|protease	intramembrane metalloprotease PrsW	NA	NA	NA	NA
WP_153791439.1\|2666876_2667839_+	asparaginase	NA	NA	NA	NA
WP_153791440.1\|2668066_2669059_-	YpdA family putative bacillithiol disulfide reductase	A0A2I2L5E1	Orpheovirus	4.4e-06	22.9
WP_153791441.1\|2669102_2670335_-	glutamate dehydrogenase	NA	NA	NA	NA
WP_100360336.1\|2670492_2670717_+\|coat	spore coat associated protein CotJA	NA	NA	NA	NA
WP_100360335.1\|2670713_2670983_+\|coat	spore coat protein CotJB	NA	NA	NA	NA
WP_100360334.1\|2671002_2671572_+\|coat	spore coat protein CotJC	NA	NA	NA	NA
WP_153791442.1\|2671647_2672136_-	hypothetical protein	NA	NA	NA	NA
WP_153791443.1\|2672125_2672716_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA

DBSCAN-SWA_6

2833800 : 2843805

Geobacillus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153791529.1\|2833800_2836071_-	DNA internalization-related competence protein ComEC/Rec2	Q0H255	Geobacillus_phage	5.8e-30	33.5
WP_100360168.1\|2836103_2836556_-	ComE operon protein 2	F8WPT6	Bacillus_phage	2.3e-31	51.5
WP_100360167.1\|2836624_2837221_-	competence protein ComEA	NA	NA	NA	NA
WP_100360166.1\|2837289_2838114_+	late competence protein ComER	NA	NA	NA	NA
WP_100360165.1\|2838224_2838590_-	PH domain-containing protein	A6N235	Microbacterium_phage	3.2e-31	50.4
WP_153791530.1\|2838604_2840152_-	diguanylate cyclase	G3MA91	Bacillus_virus	1.2e-10	28.6
WP_153791531.1\|2840266_2840479_-	hypothetical protein	NA	NA	NA	NA
WP_100360162.1\|2840527_2840710_-	H-type small acid-soluble spore protein	NA	NA	NA	NA
WP_100360161.1\|2840765_2840966_-	hypothetical protein	NA	NA	NA	NA
WP_100360160.1\|2841120_2841969_-	Ku protein	A0A249XRB2	Mycobacterium_phage	4.2e-42	39.7
WP_100360159.1\|2842071_2843805_+	DNA ligase D	A0A068CDF3	Rhizobium_phage	2.2e-13	29.6

DBSCAN-SWA_7

2934749 : 3023066

110

Bacillus_phage(48.39%)

capsid,integrase,coat,head,protease,tail,portal,terminase,transposase,holin,tRNA

attL 2962343:2962364|attR 3027656:3027677

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_153790978.1\|2934749_2935703_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	1.4e-62	48.2
WP_153791573.1\|2935743_2936415_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_153791574.1\|2936474_2937797_-	hypothetical protein	NA	NA	NA	NA
WP_100362471.1\|2937929_2938307_+	TIGR04086 family membrane protein	NA	NA	NA	NA
WP_100360078.1\|2938445_2938709_-	preprotein translocase subunit YajC	NA	NA	NA	NA
WP_153791575.1\|2938727_2939867_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.4e-87	46.6
WP_153791576.1\|2939882_2940911_-\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_100360075.1\|2940924_2941125_-	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_153791577.1\|2941121_2942123_-	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	5.6e-09	26.0
WP_100360073.1\|2942141_2942741_-	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_100360072.1\|2942914_2944072_+	MFS transporter	NA	NA	NA	NA
WP_153791578.1\|2944079_2944628_-	regulator	NA	NA	NA	NA
WP_100360070.1\|2945213_2945963_-	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_153791579.1\|2946106_2947183_-\|coat	SafA/ExsA family spore coat assembly protein	NA	NA	NA	NA
WP_153791580.1\|2947389_2948496_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_153791581.1\|2948492_2949338_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_153791582.1\|2949334_2950942_-	L-aspartate oxidase	NA	NA	NA	NA
WP_153791583.1\|2950965_2952135_+	aminotransferase class V-fold PLP-dependent enzyme	H7BUW1	unidentified_phage	2.0e-18	28.7
WP_153791584.1\|2952112_2952643_+	HTH domain-containing protein	NA	NA	NA	NA
WP_100360062.1\|2953453_2954017_+	hypothetical protein	NA	NA	NA	NA
WP_100360061.1\|2954178_2955060_-	prephenate dehydratase	NA	NA	NA	NA
WP_100360060.1\|2955079_2955532_-	ACT domain-containing protein	NA	NA	NA	NA
WP_100360059.1\|2955913_2957194_-	GTPase ObgE	NA	NA	NA	NA
WP_153791585.1\|2957213_2957726_-	hypothetical protein	NA	NA	NA	NA
WP_100360057.1\|2958006_2958285_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_100360056.1\|2958299_2958632_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_100360055.1\|2958644_2958953_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_153791586.1\|2959076_2960525_-	S1 RNA-binding domain-containing protein	NA	NA	NA	NA
WP_153791587.1\|2960538_2961399_-	stage IV sporulation protein FB	NA	NA	NA	NA
WP_100360052.1\|2961379_2962156_-	M23 family metallopeptidase	NA	NA	NA	NA
2962343:2962364	attL	NA	NA	NA	NA
WP_153791588.1\|2962759_2963557_-	septum site-determining protein MinD	F0PIG8	Enterococcus_phage	8.7e-05	28.9
WP_100360050.1\|2963549_2964233_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_100360049.1\|2964269_2964809_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_153791589.1\|2964805_2965684_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_153792979.1\|2965696_2966731_-	MreB/Mrl family cell shape determining protein	NA	NA	NA	NA
WP_153791590.1\|2967386_2968211_-	HNH endonuclease	NA	NA	NA	NA
WP_153791591.1\|2968189_2968594_-	NUDIX domain-containing protein	NA	NA	NA	NA
WP_153791592.1\|2968993_2969368_+	hypothetical protein	NA	NA	NA	NA
WP_153791593.1\|2969411_2970245_-	hypothetical protein	NA	NA	NA	NA
WP_153791594.1\|2970373_2971285_+	hypothetical protein	NA	NA	NA	NA
WP_153791595.1\|2971279_2971468_-	hypothetical protein	NA	NA	NA	NA
WP_153791596.1\|2971559_2972414_-	peptidoglycan DD-metalloendopeptidase family protein	Q9ZXD7	Bacillus_phage	9.9e-23	57.3
WP_153792980.1\|2972449_2972677_-\|holin	holin	A0A0A7RUX1	Clostridium_phage	2.5e-10	50.0
WP_153791597.1\|2972745_2973048_-	hypothetical protein	A0A0S2GM64	Bacillus_phage	2.8e-20	56.1
WP_153791598.1\|2973104_2973740_-	hypothetical protein	NA	NA	NA	NA
WP_153791599.1\|2974081_2974237_-	sporulation histidine kinase inhibitor Sda	NA	NA	NA	NA
WP_153791600.1\|2974361_2974574_-	hypothetical protein	NA	NA	NA	NA
WP_153791601.1\|2974573_2974954_-	hypothetical protein	NA	NA	NA	NA
WP_153791602.1\|2974955_2979680_-	hypothetical protein	A0A142F1N2	Bacillus_phage	2.0e-120	56.8
WP_153791603.1\|2979694_2981152_-	hypothetical protein	A0A142F1N1	Bacillus_phage	1.5e-92	45.0
WP_153791604.1\|2981167_2984626_-\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	1.2e-71	46.1
WP_153791605.1\|2984641_2984824_-	hypothetical protein	NA	NA	NA	NA
WP_153791606.1\|2984820_2985132_-	hypothetical protein	NA	NA	NA	NA
WP_153791607.1\|2985142_2985721_-\|tail	phage tail protein	NA	NA	NA	NA
WP_153791608.1\|2985753_2986086_-	hypothetical protein	NA	NA	NA	NA
WP_153791609.1\|2986082_2986484_-	hypothetical protein	NA	NA	NA	NA
WP_153791610.1\|2986483_2986816_-\|head	phage head closure protein	NA	NA	NA	NA
WP_153791611.1\|2986812_2987121_-\|head,tail	phage gp6-like head-tail connector protein	NA	NA	NA	NA
WP_153791612.1\|2987134_2987434_-	hypothetical protein	NA	NA	NA	NA
WP_153791613.1\|2987490_2988732_-\|capsid	phage major capsid protein	A0A1B1P7R4	Bacillus_phage	2.4e-126	61.2
WP_153791614.1\|2988733_2989522_-\|protease	Clp protease ClpP	A0A0K2CXQ5	Paenibacillus_phage	5.3e-79	66.0
WP_153791615.1\|2989572_2990790_-\|portal	phage portal protein	A0A0U3SQF0	Bacillus_phage	4.8e-140	61.4
WP_153791616.1\|2990834_2991020_-	hypothetical protein	NA	NA	NA	NA
WP_153792981.1\|2991048_2992833_-\|terminase	terminase large subunit	A0A1B1P7R3	Bacillus_phage	9.4e-209	59.6
WP_153791617.1\|2992807_2993125_-\|terminase	phage terminase small subunit P27 family	A0A0K2CZN8	Paenibacillus_phage	3.9e-41	80.0
WP_153791618.1\|2993253_2993616_-	HNH endonuclease	Q0H266	Geobacillus_phage	9.3e-15	47.8
WP_153791619.1\|2993612_2993864_-	hypothetical protein	NA	NA	NA	NA
WP_153791620.1\|2993870_2994308_-	hypothetical protein	Q2I8B8	Bacillus_phage	1.6e-16	45.5
WP_153791621.1\|2994304_2994535_-	hypothetical protein	NA	NA	NA	NA
WP_153791622.1\|2994531_2994966_-	hypothetical protein	NA	NA	NA	NA
WP_153791623.1\|2995033_2995255_-	hypothetical protein	NA	NA	NA	NA
WP_153791624.1\|2995357_2995549_-	hypothetical protein	NA	NA	NA	NA
WP_153791625.1\|2995666_2995891_+	DUF2188 domain-containing protein	NA	NA	NA	NA
WP_153791626.1\|2996040_2996844_-	hypothetical protein	NA	NA	NA	NA
WP_153791627.1\|2996836_2997067_-	hypothetical protein	NA	NA	NA	NA
WP_153791628.1\|2997110_2998382_-	hypothetical protein	NA	NA	NA	NA
WP_153791629.1\|2999112_2999562_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_153791630.1\|2999975_3000518_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	7.3e-64	65.6
WP_153791631.1\|3000514_3000964_-	ArpU family transcriptional regulator	S6AVV9	Thermus_phage	2.8e-37	50.4
WP_153791632.1\|3000947_3001178_-	hypothetical protein	NA	NA	NA	NA
WP_153791633.1\|3001297_3002074_-	site-specific DNA-methyltransferase	A0A0H3UZL7	Geobacillus_virus	2.3e-79	61.2
WP_153791634.1\|3002194_3002338_-	hypothetical protein	NA	NA	NA	NA
WP_153791635.1\|3002612_3002726_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_153791636.1\|3002844_3003123_-	hypothetical protein	NA	NA	NA	NA
WP_153791637.1\|3003135_3003465_-	HNH endonuclease	A0A1U9WQN8	Geobacillus_phage	1.3e-20	51.0
WP_153791638.1\|3003486_3004437_-	DnaD domain protein	D2XR43	Bacillus_phage	3.9e-60	49.5
WP_153791639.1\|3004510_3005170_-	phage regulatory protein	W8CYS3	Bacillus_phage	4.0e-32	38.2
WP_153791640.1\|3005141_3005378_-	hypothetical protein	NA	NA	NA	NA
WP_153791641.1\|3005423_3006143_-	hypothetical protein	A0A1L2JZ42	Aeribacillus_phage	4.4e-64	54.4
WP_153791642.1\|3006142_3006535_-	replication terminator protein	A0A0S2MVH3	Bacillus_phage	1.5e-21	45.8
WP_153791643.1\|3006826_3007114_-	hypothetical protein	NA	NA	NA	NA
WP_153791644.1\|3007225_3007468_-	hypothetical protein	NA	NA	NA	NA
WP_153791645.1\|3007534_3008044_+	hypothetical protein	NA	NA	NA	NA
WP_153791646.1\|3008035_3008230_-	hypothetical protein	NA	NA	NA	NA
WP_153791647.1\|3008235_3008373_-	hypothetical protein	NA	NA	NA	NA
WP_153791648.1\|3008380_3008560_-	hypothetical protein	NA	NA	NA	NA
WP_153791649.1\|3008576_3008810_-	helix-turn-helix domain-containing protein	E5DV75	Deep-sea_thermophilic_phage	1.1e-16	58.2
WP_153791650.1\|3008967_3009576_+	helix-turn-helix domain-containing protein	E5DV74	Deep-sea_thermophilic_phage	3.6e-51	49.5
WP_153791651.1\|3009644_3010787_+\|integrase	tyrosine-type recombinase/integrase	A0A0K2CZ62	Paenibacillus_phage	7.2e-45	30.2
WP_153791652.1\|3010808_3011336_-	DNA repair protein RadC	NA	NA	NA	NA
WP_100360040.1\|3011499_3012411_-	hypothetical protein	NA	NA	NA	NA
WP_153791653.1\|3012562_3012808_-	hypothetical protein	NA	NA	NA	NA
WP_153791654.1\|3012843_3013599_-	prepilin peptidase	NA	NA	NA	NA
WP_153791655.1\|3014044_3015298_-	bifunctional folylpolyglutamate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_153791656.1\|3015468_3015663_+	hypothetical protein	NA	NA	NA	NA
WP_100360037.1\|3015664_3018319_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	7.8e-159	42.0
WP_100360036.1\|3018762_3019542_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_153791657.1\|3019538_3020177_-	ATP-binding cassette domain-containing protein	NA	NA	NA	NA
WP_153791658.1\|3020392_3021607_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_153791659.1\|3021902_3023066_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.3e-37	38.6
3027656:3027677	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP045915

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection