CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP036249	Enterococcus faecalis R712 chromosome, complete genome	1 crisprs	csa3,cas3,RT,cas14j,DinG,DEDDh	4	12
NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	1 crisprs	RT	2	1
NZ_CP036247	Enterococcus faecalis R712 plasmid pR712_01, complete sequence	0 crisprs	DinG,csa3	0	2

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP036249_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP036249_1

1905368-1905733

Orphan

II-A,II-B

Consensus_repeat	Method
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRISPRCasFinder
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	CRT
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	PILER-CR

5 spacers

The CRISPR arrays of NZ_CP036249_1

>merge|NZ_CP036249|1|1905368-1905733|CRISPRCasFinder,CRT,PILER-CR
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAACAAATTTTTTGAACTTAATGCAATTTCTTGAGTTTTGGTACCATTCTAAACAACATGACTCTAAAACAAAACTTTTGACGGCTCTTTAGTCAACCCAGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTAGAACTGCATCTCTAAAGGCTCCGTATTCGTTTTGGTACCATTCTAAACAACATGACTCTAAAACTCGGACGAGGTTGCTACGATGGCGTAGTCCGTTTTGGTACCATTCTAAACAACATGACTCTAAAACATAAAGGTGTCTATACCGATTATAGTGGCGGTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_CP036249|1|1|1905368-1905733|CRISPRCasFinder
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAAC	AAATTTTTTGAACTTAATGCAATTTCTTGA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	AAAACTTTTGACGGCTCTTTAGTCAACCCA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TAGAACTGCATCTCTAAAGGCTCCGTATTC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCGGACGAGGTTGCTACGATGGCGTAGTCC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	ATAAAGGTGTCTATACCGATTATAGTGGCG
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_CP036249|1|1|1905368-1905733|CRT
GTGATAGTTTGTTTTTTAACAACATGGCTCTAAAAC	AAATTTTTTGAACTTAATGCAATTTCTTGA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	AAAACTTTTGACGGCTCTTTAGTCAACCCA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TAGAACTGCATCTCTAAAGGCTCCGTATTC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCGGACGAGGTTGCTACGATGGCGTAGTCC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	ATAAAGGTGTCTATACCGATTATAGTGGCG
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

>NZ_CP036249|1|1|1905434-1905733|PILER-CR
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	AAAACTTTTGACGGCTCTTTAGTCAACCCA
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TAGAACTGCATCTCTAAAGGCTCCGTATTC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	TCGGACGAGGTTGCTACGATGGCGTAGTCC
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC	ATAAAGGTGTCTATACCGATTATAGTGGCG
GTTTTGGTACCATTCTAAACAACATGACTCTAAAAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP036249.1\|WP_002356976.1\|1902532_1903546_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|376764
NZ_CP036249.1\|WP_002364371.1\|1905890_1906754_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP036249.1\|WP_002364369.1\|1900794_1902528_-\|thiol-reductant-ABC-exporter-subunit-CydD	unknown	unknown	gnl\|CDD\|274323
NZ_CP036249.1\|WP_002360017.1\|1895704_1896916_-\|NAD(P)/FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224172
NZ_CP036249.1\|WP_002360007.1\|1913928_1915074_-\|cysteine-desulfurase	unknown	unknown	gnl\|CDD\|224029
NZ_CP036249.1\|WP_100781779.1\|1905120_1905219_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036249.1\|WP_002360009.1\|1912166_1913291_-\|tRNA-2-thiouridine(34)-synthase-MnmA	unknown	unknown	gnl\|CDD\|234664
NZ_CP036249.1\|WP_002369162.1\|1897971_1898952_+\|polyprenyl-synthetase-family-protein	unknown	unknown	gnl\|CDD\|223220
NZ_CP036249.1\|WP_002369164.1\|1892967_1895391_-\|DNA-translocase-FtsK	unknown	unknown	gnl\|CDD\|224588
NZ_CP036249.1\|WP_002364246.1\|1899031_1900798_-\|thiol-reductant-ABC-exporter-subunit-CydC	unknown	unknown	gnl\|CDD\|227320
NZ_CP036249.1\|WP_002356959.1\|1913516_1913861_-\|DUF1831-domain-containing-protein	unknown	unknown	gnl\|CDD\|370163
NZ_CP036249.1\|WP_002356974.1\|1903542_1904961_-\|cytochrome-ubiquinol-oxidase-subunit-I	unknown	unknown	gnl\|CDD\|376587
NZ_CP036249.1\|WP_002369152.1\|1910747_1911980_+\|multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|340949
NZ_CP036249.1\|WP_002360016.1\|1896944_1897850_-\|prenyltransferase	unknown	unknown	gnl\|CDD\|235695
NZ_CP036249.1\|WP_033591434.1\|1895496_1895628_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036249.1\|WP_002356965.1\|1909513_1910083_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP036249.1\|WP_002356963.1\|1910215_1910731_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
NZ_CP036249.1\|WP_002369154.1\|1906838_1908920_-\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP036249.1\|WP_002356966.1\|1909050_1909416_-\|DUF1033-family-protein	unknown	unknown	gnl\|CDD\|336361
NZ_CP036249.1\|WP_048950972.1\|1911924_1912110_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP036249.1\|WP_002356976.1\|1902532_1903546_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|376764	pfam02322, Cyt_bd_oxida_II, Cytochrome bd terminal oxidase subunit II. This family consists of cytochrome bd type terminal oxidases that catalyze quinol-dependent, Na+-independent oxygen uptake. Members of this family are integral membrane proteins and contain a protohaem IX centre B558. One member of the family, Klebsiella pneumoniae CydB, is implicated in having an important role in micro-aerobic nitrogen fixation in the enteric bacterium Klebsiella pneumoniae. The family forms an integral functional unit with subunit I, family Bac_Ubq_Cox, pfam01654.	9.60464e-103
NZ_CP036249.1\|WP_002364371.1\|1905890_1906754_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	7.37187e-27
NZ_CP036249.1\|WP_002364369.1\|1900794_1902528_-\|thiol-reductant-ABC-exporter-subunit-CydD	gnl\|CDD\|274323	TIGR02857, transport_ATP-binding_protein, thiol reductant ABC exporter, CydD subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex. Unfortunately, the gene symbol nomenclature adopted based on this operon in B. subtilis assigns cydC to the third gene in the operon where this gene is actually homologous to the E. coli cydD gene. We have chosen to name all homologs in this family in accordance with the precedence of publication of the E. coli name, CydD.	0
NZ_CP036249.1\|WP_002360017.1\|1895704_1896916_-\|NAD(P)/FAD-dependent-oxidoreductase	gnl\|CDD\|224172	COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion].	1.24993e-121
NZ_CP036249.1\|WP_002360007.1\|1913928_1915074_-\|cysteine-desulfurase	gnl\|CDD\|224029	COG1104, NifS, Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism].	5.37018e-179
NZ_CP036249.1\|WP_002360009.1\|1912166_1913291_-\|tRNA-2-thiouridine(34)-synthase-MnmA	gnl\|CDD\|234664	PRK00143, mnmA, tRNA-specific 2-thiouridylase MnmA; Reviewed.	0
NZ_CP036249.1\|WP_002369162.1\|1897971_1898952_+\|polyprenyl-synthetase-family-protein	gnl\|CDD\|223220	COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism].	2.55217e-80
NZ_CP036249.1\|WP_002369164.1\|1892967_1895391_-\|DNA-translocase-FtsK	gnl\|CDD\|224588	COG1674, FtsK, DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning].	1.01564e-174
NZ_CP036249.1\|WP_002364246.1\|1899031_1900798_-\|thiol-reductant-ABC-exporter-subunit-CydC	gnl\|CDD\|227320	COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones].	0
NZ_CP036249.1\|WP_002356959.1\|1913516_1913861_-\|DUF1831-domain-containing-protein	gnl\|CDD\|370163	pfam08866, DUF1831, Putative amino acid metabolism. Solution of the structure of the Lactobacillus plantarum protein from this family has indicated a potential new fold with remote similarities to TBP-like (TATA-binding protein) structures. This similarity, in combination with genomic context analysis, leads us to propose an involvement in amino-acid metabolism. The potentially novel fold is an alpha + beta fold comprising two beta sheets packed against a single helix. The enzyme is present in the cytosol.	1.33245e-53
NZ_CP036249.1\|WP_002356974.1\|1903542_1904961_-\|cytochrome-ubiquinol-oxidase-subunit-I	gnl\|CDD\|376587	pfam01654, Cyt_bd_oxida_I, Cytochrome bd terminal oxidase subunit I. This family are the alternative oxidases found in many bacteria which oxidize ubiquinol and reduce oxygen as part of the electron transport chain. This family is the subunit I of the oxidase E. coli has two copies of the oxidase, bo and bd', both of which are represented here In some nitrogen fixing bacteria, e.g. Klebsiella pneumoniae this oxidase is responsible for removing oxygen in microaerobic conditions, making the oxidase required for nitrogen fixation. This subunit binds a single b-haem, through ligands at His186 and Met393 (using SW:P11026 numbering). In addition His19 is a ligand for the haem b found in subunit II.	0
NZ_CP036249.1\|WP_002369152.1\|1910747_1911980_+\|multidrug-efflux-MFS-transporter	gnl\|CDD\|340949	cd17391, MFS_MdtG_MDR_like, Multidrug resistance protein MdtG and similar multidrug resistance (MDR) transporters of the Major Facilitator Superfamily. This subfamily is composed of Escherichia coli multidrug resistance protein MdtG, Streptococcus pneumoniae multidrug resistance efflux pump PmrA, and similar multidrug resistance (MDR) transporters from bacteria. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. MdtG confers resistance to fosfomycin and deoxycholate. PmrA serves as an efflux pump for various substrates and is associated with fluoroquinolone resistance. MdtG-like MDR transporters belong to the bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.02154e-172
NZ_CP036249.1\|WP_002360016.1\|1896944_1897850_-\|prenyltransferase	gnl\|CDD\|235695	PRK06080, PRK06080, 1,4-dihydroxy-2-naphthoate octaprenyltransferase; Validated.	8.82053e-105
NZ_CP036249.1\|WP_002356965.1\|1909513_1910083_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	2.91104e-15
NZ_CP036249.1\|WP_002356963.1\|1910215_1910731_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	5.73504e-32
NZ_CP036249.1\|WP_002369154.1\|1906838_1908920_-\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP036249.1\|WP_002356966.1\|1909050_1909416_-\|DUF1033-family-protein	gnl\|CDD\|336361	pfam06279, DUF1033, Protein of unknown function (DUF1033). This family consists of several hypothetical bacterial proteins. Many of the sequences in this family are annotated as putative DNA binding proteins but the function of this family is unknown.	4.62165e-64

>NZ_CP036249.1|WP_100781779.1|1905120_1905219_-|hypothetical-protein
MIEEREEILGAPKKIVRNASVLFGFCLRKLYT
>NZ_CP036249.1|WP_002356974.1|1903542_1904961_-|cytochrome-ubiquinol-oxidase-subunit-I
MFDIVTLARIQFAMTTVFHFFFVPFSIGLALVVAIMETMYVVKKEERYRKMAKFWGNIFLLSFAVGVVTGIIQEFQFGMNWSDYSRFVGDIFGAPLAVEALLAFFLESTFLGLWIFTWDKMNPKVHVTFIWLVVFGSMMSAFWILVANSFMQHPVGYVINNGRAEMVDFVAVISNPKVWYEFSHVIMGAFTLGGMAVAGMAAFQLLKKRDISFHKASMRIGLWVTLFGSIGVLLAGDLQMKALIEGQPMKFAAMEGAYEDSDDPAAWTLIAWADEREHKQVFGIDIPYMLSILSYNKLSGSVDGMDTVNKRLVEKYGDDKNYYPPVNTLFWSFRIMAGFGALMLLVAALGLFFTRKKKPSLYEKKWMLWIVALCTFAPFLANTTGWLVTELGRYPWTVYGLFTIEQSVSPNVSVASLITSNVIYFLLFAGLGSVMVYLVILELRKGPDYEAKKLAKENEPALDPFDKGVFGE
>NZ_CP036249.1|WP_002356976.1|1902532_1903546_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MSTLQLLWFVLIGVLFSGFFFLEGFDFGVGMAVQTLAHNDDEKDQVVATIGPVWDGNEVWLLTAGGAMFASFPYWYASLFSGYYLILFTILFGLIIRGVSFEFRHNMPEGKRRRMWNWTLSIGSFLVPFFFGILFISLVQGMPLDANGNMHAQFTDYFNLFSIVGGVALTLLCYLHGMNYIALKTEGPIRERARNYAEILYGVLYVGLVVFAVLMYFKTDFYEKNFAVTLILTLAIVVLTVIANVGVFKRKEMLAFLASGLTLVVLVALLFSGLFPRVMIGSEGFDLLIKDATSTPYTLKIMTWISLSILPFVLAYTAWSYYIFRKRISQTAVPEGY
>NZ_CP036249.1|WP_002364369.1|1900794_1902528_-|thiol-reductant-ABC-exporter-subunit-CydD
MIDKDILQMPKIKKILVLLAGFSFLQAVFIIGQAFFLSKAIVGLWSGGHLNQQLQSILLFFIFYLGRHVITYFRERMLDTFSYERSKELREQLLTKIFRLGPNVVQKNGTGNMVTMALEGISQTENYLQLILTKMMNMMIIPWIILAFVFTQDIRSGVTLLIVFPIIIIFMIVLGYAAQSKADKQYAAFQMLSNHFIDSLRGIDTLKLFGLSKKYAGSIYHTSERFRKATMSTLKIAILSTFALDFFTTLSVAVVAVFLGLSLLNGTILLFPALVTLILAPEFFLPIRDFSSDYHATLDGKNSFQAIQAVLALPEAEQTDVLTLDDWHQESQLSVTALNFSYEDATQEAIQSLQFSVDGRKKIGIIGASGSGKSTLINLLSGFLLPTEETSQLAINGQTIPHFLQKDWQKQILYIPQAPYIFQDTLANNIRFYTPEATDEAIQQAIQLVGLDELVKDLPEGIHTLIGESGRMLSGGQAQRVALARAFVDQKRHVLLFDEPTAHLDIETEVEMKERMLPLMNNHLVFFATHRLHWMEEMDYILVMEKGQLVEQGTLAELIEKDGYYVQLMKQMRGGRQ
>NZ_CP036249.1|WP_002364246.1|1899031_1900798_-|thiol-reductant-ABC-exporter-subunit-CydC
MMEKQPTTKDVWKNDQWVRPFLKRYKKTLYFALLLGFLTFFSAGALMFTSGYLISRAASLPENILLIYIPIVLTRAFGIGRPVFRYVERLTSHNWVLKMTSDLRLKLYNVLEKDAIFFKTKYRTGDILGLLSEDINHIQNLYLRTIFPTVIAWILYIFLVIALGFFSWWFALCMLLMLGVVVFLLPLVSVLVNGARQEKHKYAKNELYQTLTDNILGVSDWVFSQRGSEFVARYETDEANVRALDEKMKQFNRGRDFVLQLLFGVIAIAVLAWTSVRFPGNHGGAANWIGAFVLTVFPLIDAFAPLPAAAQETTIYKDSIRRFNELPEGEDDSTEAPVQPNGTSLSIEHLSFAYENQEKKVLNDLSLTIPEKQKLAILGRSGSGKSTLASLIRGDLRPTSGEILLGNIPTEAFGETMTEYIGVMHQAPYLFRTTILNNIRIGREEASEAEVWAVLEKVGLKEMVAQLPEGLQTMVDEAGLRFSGGERHRLALARILLQDTPIVLLDEPTTGLDPITEQQLLETFFEALKDKTVIWITHHLQGVTLMDQVIFIEDGQLEMSGTPEELLATNAHYQKLYRIDRGISSFEE
>NZ_CP036249.1|WP_002369162.1|1897971_1898952_+|polyprenyl-synthetase-family-protein
MNTFWKSFPDVERSLTETCELIEQTLQTRNEDIEEALVTLARSGGKLLRPAFFFLFAQLGDEEKQEKQQLLKIAASLEILHMATLIHDDIIDDSPLRRGAVTIQSQYGKDVAVYTGDLLFTEFFTLIADAMNGSEFMKINAQGMKRLLLGELDQMSHRFDRRMSIPAYLRSVNGKTAELFSLSCLEGAYFGHSSKEVQRLAKRIGRHIGIAFQVYDDILDYTADTETLKKPALEDLSQGVYTLPLLFAYQAAPHVFSPYLDKGRAITLEEAAEVAALVNDYHGVTEAQAFAKKVTNKAITDIQQLPDGTAKETLLSLTELLLHRSF
>NZ_CP036249.1|WP_002360016.1|1896944_1897850_-|prenyltransferase
MNREIFFELVELKAKTASVLPFLLGICFSWYQYGRLHVGYVLIFFIAMFIFNMAVDILDNYNDYHHATEVHDYKEKTNIIGRENLSLPLIRKMIFWMILVSALMGIGLSFIVGWPLLIMGLYCYLIGIFYSSGPKPLSSLPLGEVFSGFTMGFMITLICVYINTFEVFNWSAANLWGIFLVALPNTCYIANLMLANNICDLEEDENNKRYTLVHYLGKASSLKLFVGLNTIAMLAILLAVGLGLTPPTMLLMLLTLPFVRKQTQALLKEQVKSKTFVCAVKILAVGATAQVLFFAIGLWWL
>NZ_CP036249.1|WP_002360017.1|1895704_1896916_-|NAD(P)/FAD-dependent-oxidoreductase
MNKKHVVILGAGYAGLKTLRELQKGAKDVEITLVDRNNYHYEATDLHEVAAGTQPAEKITYNIMDVVDEKMTTFIQGTVKTIDAATQTVALEDGQTINYDYLVVSLGFESESFGIPGVQEHALQMVDVKTALNVYEHIQEQMRQYKATQNEEFLKIVVCGAGFTGIELLGSLVENKPKFAEIAGVSADQIQIYCVEAVTRLLPMFNEKLANYGVQLLKDSAIHLLLGKPIKEIKPGAVVYQDNEAGDLAELSAKTIIWTTGVSGSHVVGDSGFEARRGRVMVQPDLTDANHSNVYIIGDCSAVMDTETNRPYPTTAQIALKMGAHAAKNIQAQLKGEATKPFSFKSQGSVCSVGNTRALGIVGKTDIKGYPASFMKKIIMNKALFETGGTKEMMAKGRFDLYH
>NZ_CP036249.1|WP_033591434.1|1895496_1895628_-|hypothetical-protein
MLFNFWRISAYFRRCWFCSRRLSVFERGAKIQSDFCPTLIFLK
>NZ_CP036249.1|WP_002369164.1|1892967_1895391_-|DNA-translocase-FtsK
MAQKRATNKKKSTTKKKTKKQQQQQERLNYMFLGLIFILFGVFGLFRLGFLGTLLANCLRLVVGNTFPFAAILLILYGLLVMIYGKDFPLKRGRPIFGAVLIYISVLLFFHAFMFRNVSGSQPDILGNTWEFLQSDLKANQVTQNVGGGMIGALLYQGTYFLVAQFGSYLIATLLLLAGIFLMSMWDFQQIVDHFQSIQDRLSHVSAKSQARQEEKEAKRAAKKEAKAAERQAKIEAAAQQKLQERERMEQAAAERLTKTPVETHQPMVEEPAAPTPVQIDSFQQQNQAMPVPPIAATKPQREQEEEAADEAGVLEFEISEEAEDRDYQLPPTDLLDTIQATDQSGEYEKIEKNIGVLEQTFKSFGVDAKVVKASLGPSVTKFEVQPAVGVKVSKIVNLTDDIALALAAKDVRMEAPIPGKSLIGIEVPNSAISTVSFRDIVEAQPSHPDKLLEVPLGRDISGMVQTADLSKMPHLLIAGSTGSGKSVAINGIITGILMQAKPHEVKLMMIDPKMVELNVYNGIPHLLTPVVTNPRKAAQALQKVVQEMEFRYEKFAATGVRNITGYNQLIQQKNAEDGENRPILPFIVVIVDELADLMMVASNEVEDAIIRLAQMARAAGIHMILATQRPSVDVITGIIKANVPSRMAFAVSSGTDSRTIIDTNGAEKLLGRGDMLFLPMGENKPIRIQGAFISDQEVERVVAFVTDQQEAEYQESMMPTDEPTTSGGGEAPQDELFEEAKNLVVEMQTASISLLQRRFRIGYNRAARLVDELEAHGVIGPSEGSKPRKVFLQAESEEAAPETPEQ
>NZ_CP036249.1|WP_002364371.1|1905890_1906754_-|AraC-family-transcriptional-regulator
MLANLNQAMDYIEEHLTEEVSFDELAKKTGISVYHFKRTFSFITGMSLAEYIKKRRLAEANLALLAGEKVTDVAFKYGYQSIEGFSRAFRDWSGQAPSEVMKTQIQKTFPKFSFYIDIKGGQSMDVKLIEKPAFQIVGVSQKVPLQYQGENQAIMELAQRITPQQRAEMHTFDDIYPHQVVNASFDFQEGRTTEGGEMTHMIGFATSQENTYEDLEQLSVPAHTWAVFPNEGPFPQTLQETWARIFSEWLPSSGYQVVAAPEISFTQYQGPAEAKYSEIWLAVTATK
>NZ_CP036249.1|WP_002369154.1|1906838_1908920_-|DNA-topoisomerase-III
MVAKQLIIAEKPSVAKDLSRVLGANQKNKNYYEGPNVIVTWALGHLLGLKMPEDLNKEWQTWQMETLPMIPKNLGIKPLPKTGHQLKAIKQLANRKDVSEAVIATDAGREGELVARWILEYVRFNKPVKRLWISSQTDKAIKDGFKKIRPAKDYDNLYYSALARAKADWLVGLNVTRALTVKYQDNLSAGRVQTPTLAMVRQQEKTIEQFKPQTYFTISLTVESEKAKMTQKNPYALKERQEAEQLVKELSKQKGLVTDIQEKVKTENAPLPYDLTEIQREANQRFQFSAKKTLSLVQSLYETHKIVSYPRTDSKYLTTDMKGTMKERLQAIADFSPEVKGYLKNGAVVKQQKVFQNAKVTDHHGLIPTEQRPRYEKLSNDEQKIYQMIVQRFLGLFAEPNQTKQTKVTVAFGKETFVFHQNKVVVAGWKTTAEQPLSIVQWQKGMTVAPNFTINKELTSPPKPLTEGTLLGKMEKHSLGTPATRAEIIEKLIKSELMERTNSGLSVSAKGKQLLDLVNPSLVTPELTEKWEKSLEAISSGQQKSQLFLKDIEEDTKKLVREIKQSEKKYQDFSITQKKCPDCGSNLREKNTKDGKIYVCTNQECSYRRRKDPKVSNHRCPQCHKKMVIIEGKNGRSFKCKFCSITEKIPDKKERKQKMTKHEERRLMKKYSQPDEPEESALAQALKAAMNQE
>NZ_CP036249.1|WP_002356966.1|1909050_1909416_-|DUF1033-family-protein
MYQVITMYGDNEPWWFFDDWQEDIVQEKTFDNLTDAETYYVEVWQKLSQNYTYVNTKPNYLTAFWNDGEERWCEECDEDLQQYFGLALLENHHAVTFENKAEFTTISNHFGKTKFCKRKVI
>NZ_CP036249.1|WP_002356965.1|1909513_1910083_-|TetR/AcrR-family-transcriptional-regulator
MAKKRNLTKAKILESARNLAEELGVQQLTFQNLAVDLGIKYPSLYNHFKNIAEVKNALVDLLIQELNDALRRALVGKSGAEAIRIYAETYQQFAFENSAVYELLISVPKTQNQQLIEGIHETNQIILQLLAFYPFNNEERLHKSRELRSLIHGYITLRFLGYFQREEATPEESYRRMIEDFIASLEVAG
>NZ_CP036249.1|WP_002356963.1|1910215_1910731_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MHITNRSHLADRYGKRTSAEFLLHERPILSFPISLAAIPKEARYLSWELIDYDTIPLIGFPFIHWLAANVPVTNEIPEDFSRTALKPTIQGKNSLASPLGKQMIPALATETLPELTERYLGLSPRSGVHTYTLYVYATKNPLNLKEGFFANELHQALNDQLLAKAKFEFLY
>NZ_CP036249.1|WP_002369152.1|1910747_1911980_+|multidrug-efflux-MFS-transporter
MYELIKSKIFRPRQPWEKNLLVLWFGTFMAGIGFSLVMPFMPLYINTLGTFTHQQLNFWSGITFSSTFLVTTIVSPWWGRLADRKGRKLMLLRASLGMAIVISLMGAVTSVYQLIGLRLLQGVFSGYISNATALVATGTPKEKSGQVLGTLATGSVTGTLLGPLLGGVTASIFGYRPTFFITGTILLLVFVLSLVFVHEEFVPIEKNQAASGKQILKKLEHPHVILGMFITTLIIQASNNSISPIISLYIQQLLGGHGNVTLISGVIASIPGIATLIAAPRFGRLGDRIGSERILTIGLILAIFVYLPMAFVQNVWQLAMLRFLVGISDACLLPAVQTLITRYSPSDAAGRIFSYNQSFQATGNVIGPMIGSSVSAAFGYRGVFISTSCLVLLNLLWVRRSTAELKKREK
>NZ_CP036249.1|WP_048950972.1|1911924_1912110_-|hypothetical-protein
MLVIKPVNIRFSFLFYRPIFFKIRKREKLKIQIVDNFSVYNLVIIFLFFLIRRCFDEPIEG
>NZ_CP036249.1|WP_002360009.1|1912166_1913291_-|tRNA-2-thiouridine(34)-synthase-MnmA
MADNSKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTDENGVCTATEDYKDVAKVADQIGIPYYSVNFEKEYWDRVFEYFLAEYRLGRTPNPDVMCNKEIKFKAFLDYAMQLGADYVATGHYAQVETDENGVVHMLRGIDNNKDQTYFLSQLSQTQLAKTMFPLGGMEKSEVRAIAERAGLATAKKKDSTGVCFIGEKNFKEFLSNYLPAKKGNMVTEDGEIKGQHDGLMYYTIGQRQGLGIGGGGKTQEPWFVIGKDLTTNTLYVGQGFHHEKLYATHLEASEVHFTVDTPMPKEFDCTAKFRYRQADIPVHVSLSEDGTKATVTFKEPARAVTPGQAVVFYDGMECLGGGLIDRAYQDEKELQYV
>NZ_CP036249.1|WP_002356959.1|1913516_1913861_-|DUF1831-domain-containing-protein
MAFTTTAAVEGSTVFYKVHPSAKRYTLKDNGFTETKSGNFQLIRSLDPTPQRNEGFKLKITITADLKELKMSITTANGLKPMNIFKNEQHEMSKEKYFFLMDGLISRGVLEKVE
>NZ_CP036249.1|WP_002360007.1|1913928_1915074_-|cysteine-desulfurase
MEPIYLDHAATTPLHPTVIQAMTENMQTTFGNPSSIHQFGRKAHGLLEEVRQTIAESLQAKPHEIIFNSGGTEGDNTAILAVAFSRQKEGKHIITTAIEHPAVLRTMEYLETLGFEVTYLPVNENGQISMDQFKKSLREETILVSMMYGNNEIGNRLPIAEVGAILKNHSAIFHTDAVQAYGSEVILPHELGIDLLSISAHKINGPKGVGFLFKSDAIQLPPLLHGGEQEEKRRAGTENLAGIIGMGTAVSLLTSAEKQARKTAYQSFQTIILKALEEANIDFSINGEPTNRLAHVLNLHLKGIPSDLLLMHLDLRGIAISTGSACTAGTVDPSHVLTAMYGENSSAIKESIRISFGYGNTPEEIATFSEVLVAVIQQLKK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP036249_1	1.3\|1905536\|30\|NZ_CP036249\|CRISPRCasFinder,CRT,PILER-CR	1905536-1905565	30	MN855775	Siphoviridae sp. isolate 255, complete genome	38929-38958	2	0.933
NZ_CP036249_1	1.1\|1905404\|30\|NZ_CP036249\|CRISPRCasFinder,CRT	1905404-1905433	30	NZ_LR214986	Mycoplasma cynos strain NCTC10142 plasmid 13	726854-726883	5	0.833
NZ_CP036249_1	1.1\|1905404\|30\|NZ_CP036249\|CRISPRCasFinder,CRT	1905404-1905433	30	NC_019526	Enterobacteria phage vB_KleM-RaK2, complete genome	41998-42027	6	0.8
NZ_CP036249_1	1.1\|1905404\|30\|NZ_CP036249\|CRISPRCasFinder,CRT	1905404-1905433	30	MT708547	Klebsiella phage Muenster, complete genome	164106-164135	6	0.8
NZ_CP036249_1	1.1\|1905404\|30\|NZ_CP036249\|CRISPRCasFinder,CRT	1905404-1905433	30	AB897757	Klebsiella phage K64-1 DNA, complete genome	42006-42035	6	0.8
NZ_CP036249_1	1.2\|1905470\|30\|NZ_CP036249\|CRISPRCasFinder,CRT,PILER-CR	1905470-1905499	30	NC_009453	Arthrobacter sp. Rue61a plasmid pAL1, complete sequence	17952-17981	8	0.733
NZ_CP036249_1	1.5\|1905668\|30\|NZ_CP036249\|CRISPRCasFinder,CRT,PILER-CR	1905668-1905697	30	NZ_CP019235	Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence	82941-82970	8	0.733

1. spacer 1.3|1905536|30|NZ_CP036249|CRISPRCasFinder,CRT,PILER-CR matches to MN855775 (Siphoviridae sp. isolate 255, complete genome) position: , mismatch: 2, identity: 0.933

tagaactgcatctctaaaggctccgtattc	CRISPR spacer
tagaactgcatctctaaaagccccgtattc	Protospacer
******************.**.********

2. spacer 1.1|1905404|30|NZ_CP036249|CRISPRCasFinder,CRT matches to NZ_LR214986 (Mycoplasma cynos strain NCTC10142 plasmid 13) position: , mismatch: 5, identity: 0.833

aaattttttgaacttaatgcaatttcttga	CRISPR spacer
aaattttttgctcttaatgcaattacatta	Protospacer
**********  ************ * * *

3. spacer 1.1|1905404|30|NZ_CP036249|CRISPRCasFinder,CRT matches to NC_019526 (Enterobacteria phage vB_KleM-RaK2, complete genome) position: , mismatch: 6, identity: 0.8

aaattttttgaacttaatgcaat--ttcttga	CRISPR spacer
aaattttttgaacgtaatgccataatcgtt--	Protospacer
************* ****** **  *. **

4. spacer 1.1|1905404|30|NZ_CP036249|CRISPRCasFinder,CRT matches to MT708547 (Klebsiella phage Muenster, complete genome) position: , mismatch: 6, identity: 0.8

aaattttttgaacttaatgcaat--ttcttga	CRISPR spacer
aaattttttgaacgtaatgccataatcgtt--	Protospacer
************* ****** **  *. **

5. spacer 1.1|1905404|30|NZ_CP036249|CRISPRCasFinder,CRT matches to AB897757 (Klebsiella phage K64-1 DNA, complete genome) position: , mismatch: 6, identity: 0.8

aaattttttgaacttaatgcaat--ttcttga	CRISPR spacer
aaattttttgaacgtaatgccataatcgtt--	Protospacer
************* ****** **  *. **

6. spacer 1.2|1905470|30|NZ_CP036249|CRISPRCasFinder,CRT,PILER-CR matches to NC_009453 (Arthrobacter sp. Rue61a plasmid pAL1, complete sequence) position: , mismatch: 8, identity: 0.733

aaaacttttgacggctctttagtcaaccca	CRISPR spacer
gcattttttgacggctctgaagtcaaccgt	Protospacer
. * .*************  ********

7. spacer 1.5|1905668|30|NZ_CP036249|CRISPRCasFinder,CRT,PILER-CR matches to NZ_CP019235 (Bacillus thuringiensis strain YGd22-03 plasmid pYGD98, complete sequence) position: , mismatch: 8, identity: 0.733

ataaaggtgtctataccgattatagtggcg	CRISPR spacer
ataaaggtgtctatactgcttattatcaaa	Protospacer
****************.* **** .* . .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

367108 : 407774

Streptococcus_phage(22.22%)

transposase,integrase

attL 363813:363828|attR 374857:374872

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
363813:363828	attL	NA	NA	NA	NA
WP_002358446.1\|367108_368278_-\|integrase	site-specific integrase	A0A1B0T6A8	Bacillus_phage	4.6e-31	28.6
WP_002355366.1\|368321_368552_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_033591375.1\|369469_369721_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002364925.1\|369707_370109_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_099434223.1\|372060_373223_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	5.9e-79	50.9
WP_002367912.1\|373459_377353_+	LPXTG-anchored aggregation substance	NA	NA	NA	NA
374857:374872	attR	NA	NA	NA	NA
WP_002367913.1\|377414_377768_+	pheromone response system RNA-binding regulator PrgU	NA	NA	NA	NA
WP_002367914.1\|377795_378653_+	pheromone response LPXTG-anchored adhesin PrgC	NA	NA	NA	NA
WP_002367915.1\|378694_379594_+	hypothetical protein	NA	NA	NA	NA
WP_002367916.1\|379613_380048_+	hypothetical protein	Q38339	Lactococcus_phage	5.9e-16	37.5
WP_002365858.1\|380094_380322_+	hypothetical protein	NA	NA	NA	NA
WP_002367917.1\|380335_380632_+	hypothetical protein	NA	NA	NA	NA
WP_002367918.1\|380646_381447_+	PrgH	NA	NA	NA	NA
WP_002367919.1\|381448_381802_+	PrgI family protein	NA	NA	NA	NA
WP_002367920.1\|381908_384146_+	hypothetical protein	NA	NA	NA	NA
WP_002367921.1\|384157_386671_+	CHAP domain-containing protein	NA	NA	NA	NA
WP_002367922.1\|387394_389329_+	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	1.7e-30	28.2
WP_002367923.1\|389601_390228_+	hypothetical protein	NA	NA	NA	NA
WP_011109622.1\|390205_390460_+	hypothetical protein	NA	NA	NA	NA
WP_002367924.1\|390443_391052_+	hypothetical protein	NA	NA	NA	NA
WP_002367690.1\|391206_391695_+	PcfB family protein	NA	NA	NA	NA
WP_002367925.1\|391694_393518_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_002367926.1\|393534_393870_+	hypothetical protein	NA	NA	NA	NA
WP_002367927.1\|393847_394144_+	hypothetical protein	NA	NA	NA	NA
WP_002390232.1\|394200_396360_+	DUF3991 domain-containing protein	NA	NA	NA	NA
WP_002367930.1\|396392_396665_+	LtrD	NA	NA	NA	NA
WP_002362408.1\|396910_397267_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_002367932.1\|397267_398953_+	relaxase/mobilization nuclease domain-containing protein	NA	NA	NA	NA
WP_002390234.1\|398985_399336_+	hypothetical protein	NA	NA	NA	NA
WP_002370345.1\|399851_401195_-	hypothetical protein	A8ATM0	Listeria_phage	2.0e-102	42.6
WP_153916981.1\|401254_401941_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.2e-126	98.7
WP_002389752.1\|402279_402819_+	hypothetical protein	NA	NA	NA	NA
WP_002367936.1\|403034_404252_+	amidohydrolase	NA	NA	NA	NA
WP_002367937.1\|404301_405558_+	amidohydrolase family protein	NA	NA	NA	NA
WP_002367814.1\|405784_406471_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002370911.1\|407081_407393_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	1.6e-23	65.6
WP_002367939.1\|407498_407774_-\|transposase	transposase	A0A0N9S8A3	Staphylococcus_phage	1.1e-10	40.9

DBSCAN-SWA_2

769431 : 777354

Planktothrix_phage(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002355794.1\|769431_770490_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.0e-17	30.1
WP_002361357.1\|770489_771446_+	ATP-binding cassette domain-containing protein	A0A1J0FA64	Only_Syngen_Nebraska_virus	4.2e-06	23.9
WP_002368159.1\|771486_772557_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A288TXV8	Enterococcus_phage	7.6e-89	49.0
WP_002368160.1\|772957_773479_+	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	3.9e-14	33.3
WP_002355798.1\|773592_773793_+	50S ribosomal protein L35	NA	NA	NA	NA
WP_002355799.1\|773853_774213_+	50S ribosomal protein L20	NA	NA	NA	NA
WP_002361360.1\|774260_774611_-	hypothetical protein	NA	NA	NA	NA
WP_002368163.1\|774708_775068_+	DUF1304 domain-containing protein	NA	NA	NA	NA
WP_002361364.1\|775195_775630_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_002361365.1\|775647_776163_+	GrpB family protein	A0A2K5B2B6	Erysipelothrix_phage	7.7e-39	48.8
WP_002368165.1\|776178_777354_-	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.9e-86	48.0

DBSCAN-SWA_3

822924 : 860919

Enterococcus_phage(58.97%)

protease,integrase,portal,tail,terminase

attL 817346:817362|attR 850368:850384

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
817346:817362	attL	NA	NA	NA	NA
WP_002355867.1\|822924_823269_+\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_002355868.1\|823281_823569_+	50S ribosomal protein L27	NA	NA	NA	NA
WP_002390381.1\|823656_824811_-\|integrase	site-specific integrase	Q9AZK8	Lactococcus_phage	2.8e-65	36.1
WP_002366325.1\|824876_825344_-	hypothetical protein	NA	NA	NA	NA
WP_002364671.1\|825385_825841_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_002363332.1\|825876_826302_-	helix-turn-helix transcriptional regulator	Q5YAA4	Bacillus_phage	7.8e-29	49.3
WP_002363333.1\|826536_826737_+	helix-turn-helix transcriptional regulator	A0A1S5SDM7	Streptococcus_phage	5.0e-10	50.0
WP_002363334.1\|826749_827034_+	hypothetical protein	NA	NA	NA	NA
WP_002366327.1\|827048_827771_+	phage regulatory protein	D2IYT0	Enterococcus_phage	7.3e-43	63.3
WP_002364224.1\|827804_827987_-	YegP family protein	NA	NA	NA	NA
WP_002368198.1\|828039_828234_+	hypothetical protein	D2IYT3	Enterococcus_phage	1.4e-17	75.4
WP_002363338.1\|828306_828714_+	hypothetical protein	A0A097BY30	Enterococcus_phage	2.3e-17	39.4
WP_002368200.1\|828726_829470_+	hypothetical protein	U4KJ90	Streptococcus_phage	3.7e-42	41.3
WP_002368201.1\|829542_829866_+	hypothetical protein	D2IYT5	Enterococcus_phage	2.6e-45	88.8
WP_010707359.1\|829865_829979_+	hypothetical protein	C9E2M6	Enterococcus_phage	4.9e-07	79.4
WP_002368203.1\|830045_830300_+	hypothetical protein	A0A0S2MYD6	Enterococcus_phage	2.9e-23	74.4
WP_002368205.1\|830283_830961_+	ERF family protein	A0A0S2MYH3	Enterococcus_phage	2.5e-114	92.9
WP_002390931.1\|830945_831884_+	DUF1351 domain-containing protein	A0A0S2MYB3	Enterococcus_phage	5.8e-93	65.8
WP_002368210.1\|831880_832561_+	hypothetical protein	C9E2N1	Enterococcus_phage	2.1e-100	77.0
WP_002368212.1\|832564_833371_+	helix-turn-helix domain-containing protein	A0A2D1GQ66	Lysinibacillus_phage	7.1e-23	52.1
WP_002368214.1\|833367_833670_+	hypothetical protein	D2IZR3	Enterococcus_phage	1.6e-47	99.0
WP_002368215.1\|833670_833970_+	hypothetical protein	D2IZY1	Enterococcus_phage	6.0e-44	91.9
WP_010783303.1\|833987_834413_+	RusA family crossover junction endodeoxyribonuclease	D2IYU2	Enterococcus_phage	1.1e-59	82.3
WP_002368217.1\|834412_834598_+	hypothetical protein	NA	NA	NA	NA
WP_002390933.1\|834804_835560_+	SAM-dependent DNA methyltransferase	A0A2K9V411	Faecalibacterium_phage	9.6e-30	34.2
WP_002368221.1\|835709_836060_+	hypothetical protein	D2IYU9	Enterococcus_phage	1.7e-29	88.9
WP_002368222.1\|836060_836339_+	hypothetical protein	A0A0S2MYC7	Enterococcus_phage	3.0e-37	84.8
WP_002368223.1\|836350_836563_+	hypothetical protein	NA	NA	NA	NA
WP_002368224.1\|836565_837102_+	DUF1642 domain-containing protein	D2IYV1	Enterococcus_phage	4.6e-42	55.7
WP_002366352.1\|837622_838039_+	autolysin	D2IZ85	Enterococcus_phage	5.4e-67	97.8
WP_002390186.1\|838926_839094_+	hypothetical protein	NA	NA	NA	NA
WP_002366356.1\|839096_840431_+	chromosome partitioning protein ParB	D2IZZ5	Enterococcus_phage	8.6e-215	81.8
WP_002363360.1\|840468_840660_+	hypothetical protein	D2IZZ6	Enterococcus_phage	1.5e-24	95.2
WP_010783305.1\|840796_840985_+	hypothetical protein	D2IZZ7	Enterococcus_phage	7.4e-24	90.3
WP_002368225.1\|841004_841745_+	hypothetical protein	NA	NA	NA	NA
WP_002366360.1\|841791_842649_+\|terminase	small subunit of terminase	D2J000	Enterococcus_phage	5.2e-88	72.2
WP_002390185.1\|842626_843919_+\|terminase	PBSX family phage terminase large subunit	V5UQR5	Oenococcus_phage	4.6e-173	69.1
WP_002366362.1\|843918_845403_+\|portal	phage portal protein	A0A097QPZ5	Enterococcus_phage	1.1e-138	99.2
WP_002366363.1\|845395_846322_+	hypothetical protein	A0A097QPZ9	Enterococcus_phage	1.2e-127	94.3
WP_002366364.1\|846426_847080_+	hypothetical protein	NA	NA	NA	NA
WP_002366365.1\|847093_847990_+	hypothetical protein	U3PDP8	Lactobacillus_phage	3.5e-71	50.8
WP_002366366.1\|848060_848393_+	hypothetical protein	A0A1W6JNH7	Staphylococcus_phage	1.8e-09	40.6
WP_002366368.1\|848389_848665_+	hypothetical protein	NA	NA	NA	NA
WP_002363372.1\|848661_849000_+	hypothetical protein	A0A1L2K255	Streptococcus_phage	1.8e-12	38.7
WP_002363373.1\|848996_849389_+	DUF3168 domain-containing protein	NA	NA	NA	NA
WP_002364302.1\|849407_850013_+\|tail	phage major tail protein, TP901-1 family	NA	NA	NA	NA
WP_002366369.1\|850015_850324_+	hypothetical protein	L0P8M2	Lactobacillus_phage	2.7e-07	77.1
WP_002366370.1\|850386_850785_+	hypothetical protein	NA	NA	NA	NA
850368:850384	attR	NA	NA	NA	NA
WP_002366371.1\|850853_851159_+	hypothetical protein	NA	NA	NA	NA
WP_002368227.1\|851145_855600_+\|tail	phage tail tape measure protein	M1PKM6	Streptococcus_phage	8.6e-86	47.9
WP_002366374.1\|855596_856319_+	hypothetical protein	C5IUK4	Streptococcus_phage	3.6e-42	38.8
WP_002366375.1\|856318_857764_+	peptidase M23	A0A1X9IGI5	Lactococcus_phage	9.0e-77	39.2
WP_002366376.1\|857769_858510_+	hypothetical protein	A0A1X9IGH6	Lactococcus_phage	2.1e-29	35.0
WP_002390183.1\|858527_859007_+	hypothetical protein	Q1RNC2	Lactococcus_phage	5.6e-07	31.7
WP_010717882.1\|859020_859416_+	hypothetical protein	NA	NA	NA	NA
WP_002368228.1\|859417_859540_+	XkdX family protein	NA	NA	NA	NA
WP_002364623.1\|859550_859760_+	hypothetical protein	NA	NA	NA	NA
WP_002390181.1\|859812_860919_+	N-acetylmuramoyl-L-alanine amidase	V5URN7	Enterococcus_phage	2.9e-91	50.8

DBSCAN-SWA_4

957089 : 977506

Bacillus_phage(25.0%)

transposase,integrase

attL 952409:952462|attR 973660:973713

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
952409:952462	attL	NA	NA	NA	NA
WP_099434270.1\|957089_958495_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	1.5e-28	46.4
WP_002389746.1\|958591_958834_+\|integrase	tyrosine-type recombinase/integrase	H0UST3	Bacillus_phage	2.4e-06	36.4
WP_002389745.1\|958867_959215_+\|integrase	tyrosine-type recombinase/integrase	A0A1B2AQ00	Phage_Wrath	1.0e-10	40.2
WP_002389744.1\|959486_960185_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002389743.1\|960159_961122_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002369704.1\|961206_963309_+	AAA family ATPase	NA	NA	NA	NA
WP_002369703.1\|963287_965009_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	5.6e-17	23.5
WP_002369702.1\|965304_967137_+	hypothetical protein	NA	NA	NA	NA
WP_002369701.1\|967136_967859_+	hypothetical protein	NA	NA	NA	NA
WP_002389742.1\|967851_969126_+	hypothetical protein	NA	NA	NA	NA
WP_002369699.1\|969126_969870_+	hydrolase	NA	NA	NA	NA
WP_002369697.1\|970075_972151_+	RecQ family ATP-dependent DNA helicase	A0A2K9L3P7	Tupanvirus	2.0e-45	36.2
WP_002369696.1\|972140_973415_+	hypothetical protein	NA	NA	NA	NA
WP_002369695.1\|973872_974328_-\|transposase	IS200/IS605 family transposase	A0A0H3UZM0	Geobacillus_virus	1.8e-15	35.0
973660:973713	attR	NA	NA	NA	NA
WP_002369693.1\|974397_976125_-\|transposase	IS1182 family transposase	A0ZS58	Staphylococcus_virus	9.6e-126	46.2
WP_002369691.1\|976285_977506_-\|transposase	IS110 family transposase	A0A1X9I619	Streptococcus_phage	6.9e-70	39.1

DBSCAN-SWA_5

1208102 : 1225873

Enterococcus_phage(42.86%)

tail,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002357859.1\|1208102_1210499_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	1.7e-19	24.1
WP_002360497.1\|1210523_1210874_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_002357857.1\|1211246_1211720_-	toxin	A0A097BY56	Enterococcus_phage	1.1e-60	71.2
WP_002357856.1\|1211766_1212249_-	helix-turn-helix transcriptional regulator	R9QTP6	Staphylococcus_phage	1.2e-20	48.6
WP_002369529.1\|1212417_1212600_+	hypothetical protein	NA	NA	NA	NA
WP_002369528.1\|1212630_1213401_+	DnaD domain protein	A0A0K0MX39	Streptococcus_phage	2.5e-33	57.0
WP_002369527.1\|1213419_1214262_+	ATP-binding protein	A0A0P0I3L9	Lactobacillus_phage	4.8e-30	30.7
WP_010706586.1\|1214264_1214357_+	hypothetical protein	NA	NA	NA	NA
WP_002388056.1\|1214349_1214721_+	hypothetical protein	NA	NA	NA	NA
WP_002360491.1\|1214740_1215148_+	transcriptional regulator	NA	NA	NA	NA
WP_002381949.1\|1215392_1215785_+	hypothetical protein	NA	NA	NA	NA
WP_002369526.1\|1215797_1216310_+\|tail	phage major tail protein, TP901-1 family	W6LP72	Streptococcus_phage	8.8e-35	49.4
WP_002357848.1\|1216342_1216702_+	hypothetical protein	A0A0F6N4J9	Staphylococcus_phage	7.6e-09	32.2
WP_002361692.1\|1216719_1217088_+	hypothetical protein	A0A1P8BLR3	Lactococcus_phage	1.3e-08	33.3
WP_002390144.1\|1217077_1220011_+	hypothetical protein	W8EBC4	Geobacillus_phage	6.9e-15	41.2
WP_002365553.1\|1220012_1220939_+\|tail	phage tail family protein	C9E2K5	Enterococcus_phage	9.0e-147	78.6
WP_002369523.1\|1220951_1222409_+	hypothetical protein	C9E2K6	Enterococcus_phage	1.4e-173	47.4
WP_002369522.1\|1222441_1224211_+	hypothetical protein	A0A097BYA8	Enterococcus_phage	7.5e-142	71.8
WP_002357842.1\|1224234_1224630_+\|holin	phage holin family protein	F0PIJ6	Enterococcus_phage	2.8e-33	48.9
WP_079995065.1\|1224775_1225873_+	N-acetylmuramoyl-L-alanine amidase	A0A139ZVY1	Enterococcus_phage	1.2e-76	44.6

DBSCAN-SWA_6

1357275 : 1399696

Listeria_phage(51.35%)

head,terminase,tail,plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002390527.1\|1357275_1357872_-	hypothetical protein	A0A059T7Z1	Listeria_phage	1.5e-30	35.8
WP_002390528.1\|1357899_1358364_-	ImmA/IrrE family metallo-endopeptidase	R4IBK9	Listeria_phage	3.2e-20	36.6
WP_002377599.1\|1358380_1358689_-	helix-turn-helix transcriptional regulator	A0A1W6JQ26	Staphylococcus_phage	8.5e-09	36.3
WP_002377598.1\|1358831_1359101_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002377597.1\|1359079_1359226_+	hypothetical protein	NA	NA	NA	NA
WP_010717314.1\|1359288_1359849_+	hypothetical protein	NA	NA	NA	NA
WP_002390751.1\|1359829_1360060_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002386712.1\|1360071_1360242_+	hypothetical protein	NA	NA	NA	NA
WP_002377591.1\|1360238_1360454_+	hypothetical protein	NA	NA	NA	NA
WP_002390531.1\|1360509_1360800_+	hypothetical protein	NA	NA	NA	NA
WP_010717315.1\|1360804_1362919_+	AAA family ATPase	A0A1L2K2K3	Aeribacillus_phage	1.8e-49	26.1
WP_002390534.1\|1362919_1364089_+	hypothetical protein	NA	NA	NA	NA
WP_002390536.1\|1364088_1364790_+	MBL fold metallo-hydrolase	A0A1L2JY21	Aeribacillus_phage	6.0e-50	42.7
WP_002386717.1\|1364801_1365566_+	DnaD domain protein	A0A1B0Y2R2	Lactobacillus_phage	7.5e-14	61.4
WP_075575573.1\|1365578_1366079_+	recombinase RecU	A0A1L2JY30	Aeribacillus_phage	8.4e-14	35.4
WP_002390537.1\|1366099_1366414_+	hypothetical protein	NA	NA	NA	NA
WP_002390538.1\|1366497_1367247_+	hypothetical protein	D2IZY3	Enterococcus_phage	6.7e-116	84.1
WP_002390542.1\|1367271_1367499_+	hypothetical protein	C9E2N4	Enterococcus_phage	6.2e-33	92.0
WP_002390543.1\|1367519_1367747_+	hypothetical protein	NA	NA	NA	NA
WP_010717316.1\|1367752_1368157_+	hypothetical protein	A0A097BY34	Enterococcus_phage	4.2e-32	54.4
WP_002390547.1\|1368157_1368496_+	hypothetical protein	A8E2L3	Enterococcus_phage	2.9e-26	75.0
WP_002390548.1\|1368492_1368846_+	hypothetical protein	NA	NA	NA	NA
WP_002390551.1\|1369002_1369617_+	DUF3850 domain-containing protein	C9E2N9	Enterococcus_phage	5.0e-45	51.4
WP_002390554.1\|1369630_1369948_+	replicase	NA	NA	NA	NA
WP_002390555.1\|1369941_1370148_+	hypothetical protein	D2IZL5	Enterococcus_phage	4.6e-27	84.8
WP_002377565.1\|1370148_1370328_+	hypothetical protein	NA	NA	NA	NA
WP_011109490.1\|1370342_1370453_+	hypothetical protein	NA	NA	NA	NA
WP_010706619.1\|1370468_1370648_+	hypothetical protein	NA	NA	NA	NA
WP_002390556.1\|1370748_1371333_+	positive control factor	NA	NA	NA	NA
WP_002390559.1\|1371978_1372698_+	oxidoreductase	C9E2M3	Enterococcus_phage	9.3e-83	65.3
WP_002390561.1\|1372713_1373217_-	hypothetical protein	NA	NA	NA	NA
WP_002390562.1\|1373341_1374133_+	hypothetical protein	NA	NA	NA	NA
WP_002390565.1\|1374184_1374910_+\|terminase	terminase small subunit	NA	NA	NA	NA
WP_002390568.1\|1374890_1376327_+\|terminase	phage terminase large subunit	A5GYP8	Lactococcus_phage	2.4e-199	72.1
WP_002390569.1\|1376349_1377744_+	DUF1073 domain-containing protein	A8ATG1	Listeria_phage	1.5e-145	56.6
WP_002390570.1\|1377733_1378978_+	hypothetical protein	A8ATG2	Listeria_phage	4.9e-55	42.7
WP_002390571.1\|1378970_1379135_+	hypothetical protein	NA	NA	NA	NA
WP_002390572.1\|1379189_1379477_+	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	2.2e-27	68.3
WP_002386749.1\|1379469_1379679_+	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_002390574.1\|1379691_1380792_+	DUF2213 domain-containing protein	A8ATG4	Listeria_phage	1.5e-87	58.9
WP_002390575.1\|1380794_1381265_+	hypothetical protein	NA	NA	NA	NA
WP_002390577.1\|1381286_1382168_+	DUF2184 domain-containing protein	A8ATG6	Listeria_phage	3.9e-83	51.8
WP_002390578.1\|1382182_1382569_+	hypothetical protein	NA	NA	NA	NA
WP_002377536.1\|1382580_1382922_+	DUF4054 domain-containing protein	NA	NA	NA	NA
WP_079995052.1\|1382918_1383524_+	hypothetical protein	A8ATG9	Listeria_phage	6.1e-35	43.1
WP_002390583.1\|1383523_1383883_+	hypothetical protein	A0A2H4JDP3	uncultured_Caudovirales_phage	2.3e-13	43.7
WP_002390585.1\|1383869_1384346_+	hypothetical protein	A8ATH1	Listeria_phage	9.4e-23	42.1
WP_002390587.1\|1384342_1385380_+	DUF3383 family protein	A8ATH2	Listeria_phage	6.4e-101	56.4
WP_002377526.1\|1385395_1385794_+	hypothetical protein	A8ATH3	Listeria_phage	6.6e-30	54.0
WP_002386763.1\|1385846_1386179_+	hypothetical protein	A8ATH4	Listeria_phage	1.8e-25	56.9
WP_002377522.1\|1386159_1386360_+	hypothetical protein	A8ATH5	Listeria_phage	6.9e-12	62.1
WP_002390589.1\|1386362_1391531_+	peptidoglycan DD-metalloendopeptidase family protein	A8ATH6	Listeria_phage	1.3e-149	35.3
WP_002386767.1\|1391530_1392088_+	LysM peptidoglycan-binding domain-containing protein	A8ATH7	Listeria_phage	2.8e-34	43.2
WP_002390591.1\|1392097_1392460_+	hypothetical protein	A8ATH8	Listeria_phage	1.1e-28	45.8
WP_002390593.1\|1392460_1393291_+	hypothetical protein	A8ATH9	Listeria_phage	7.8e-65	45.8
WP_002377515.1\|1393290_1393623_+	hypothetical protein	A8ATI0	Listeria_phage	1.6e-21	50.0
WP_002390594.1\|1393622_1393970_+	DUF2634 domain-containing protein	A0A2H4J4S8	uncultured_Caudovirales_phage	2.9e-13	49.4
WP_002390596.1\|1393962_1395117_+\|plate	baseplate J/gp47 family protein	A8ATI2	Listeria_phage	1.3e-113	54.1
WP_002390597.1\|1395100_1395730_+	hypothetical protein	A8ATI3	Listeria_phage	3.1e-58	57.4
WP_010774208.1\|1395748_1397392_+\|head,tail	phage head-tail adapter protein	D2J018	Enterococcus_phage	7.5e-112	66.7
WP_002390600.1\|1397413_1397848_+	hypothetical protein	NA	NA	NA	NA
WP_002377507.1\|1397847_1397976_+	XkdX family protein	NA	NA	NA	NA
WP_002377506.1\|1397980_1398337_+	hypothetical protein	NA	NA	NA	NA
WP_002390601.1\|1398333_1398531_+	hypothetical protein	NA	NA	NA	NA
WP_002390604.1\|1398589_1399696_+	N-acetylmuramoyl-L-alanine amidase	V5URN7	Enterococcus_phage	6.2e-86	48.0

DBSCAN-SWA_7

1684421 : 1693065

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002369276.1\|1684421_1684994_-	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	4.1e-25	35.1
WP_002369275.1\|1684990_1686022_-	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3FGG1	Synechococcus_phage	8.2e-56	44.4
WP_002382407.1\|1686023_1687463_-	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-49	33.0
WP_002369272.1\|1687438_1689658_-	phosphoribosylformylglycinamidine synthase subunit PurL	A6N228	Microbacterium_phage	9.7e-147	39.9
WP_002369271.1\|1689654_1690329_-	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_002357271.1\|1690329_1690581_-	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_002369269.1\|1690594_1691308_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0E3ELR0	Synechococcus_phage	5.7e-48	43.0
WP_002379523.1\|1691459_1692584_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_002365766.1\|1692576_1693065_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	6.4e-19	42.0

DBSCAN-SWA_8

1723232 : 1765154

Clostridium_botulinum_C_phage(16.67%)

protease,transposase,integrase

attL 1763352:1763376|attR 1768417:1768441

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002369252.1\|1723232_1724087_-\|protease	trypsin-like serine protease	NA	NA	NA	NA
WP_002369251.1\|1724135_1725668_-	M4 family metallopeptidase coccolysin	NA	NA	NA	NA
WP_002390430.1\|1725902_1727174_-	GHKL domain-containing protein	NA	NA	NA	NA
WP_002369249.1\|1727170_1727899_-	protein FsrB	NA	NA	NA	NA
WP_011109506.1\|1727987_1728719_-	response regulator transcription factor	NA	NA	NA	NA
WP_002382428.1\|1729137_1731096_-	amidase domain-containing protein	Q332B8	Clostridium_botulinum_C_phage	1.4e-19	37.4
WP_079995071.1\|1731177_1736778_-	DUF5110 domain-containing protein	NA	NA	NA	NA
WP_010706477.1\|1737308_1737695_-	hypothetical protein	NA	NA	NA	NA
WP_002357219.1\|1737751_1738768_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	3.0e-26	25.3
WP_002369243.1\|1739282_1740263_+	nickel pincer cofactor biosynthesis protein LarC	NA	NA	NA	NA
WP_002357197.1\|1740277_1740988_+	aquaporin family protein	NA	NA	NA	NA
WP_002357196.1\|1741191_1742034_-	PTS system mannose/fructose/sorbose family transporter subunit IID	NA	NA	NA	NA
WP_002357194.1\|1742035_1742887_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002357192.1\|1742920_1743418_-	PTS mannose/fructose/sorbose transporter subunit IIB	NA	NA	NA	NA
WP_002369242.1\|1743432_1743864_-	PTS fructose transporter subunit IIA	NA	NA	NA	NA
WP_002369241.1\|1744444_1744732_+	hypothetical protein	NA	NA	NA	NA
WP_002369240.1\|1744977_1745493_-	galactose-6-phosphate isomerase subunit LacB	NA	NA	NA	NA
WP_002357188.1\|1745518_1745947_-	galactose-6-phosphate isomerase subunit LacA	NA	NA	NA	NA
WP_002357187.1\|1746169_1746664_+	PTS sugar transporter subunit IIA	NA	NA	NA	NA
WP_002357185.1\|1746665_1746968_+	PTS fructose transporter subunit IIB	NA	NA	NA	NA
WP_002357183.1\|1747062_1748466_+	PTS glucitol transporter subunit IIA	NA	NA	NA	NA
WP_002369238.1\|1748506_1749259_-	DeoR/GlpR transcriptional regulator	NA	NA	NA	NA
WP_002369236.1\|1749594_1750440_-	DUF4767 domain-containing protein	NA	NA	NA	NA
WP_002369235.1\|1750675_1751260_-	HD domain-containing protein	NA	NA	NA	NA
WP_002369233.1\|1751477_1752383_+	polysaccharide deacetylase	NA	NA	NA	NA
WP_002360100.1\|1752556_1752973_-	hypothetical protein	NA	NA	NA	NA
WP_002382439.1\|1753887_1753989_+	hypothetical protein	NA	NA	NA	NA
WP_002297659.1\|1754130_1755309_-\|integrase	site-specific integrase	S6C485	Thermus_phage	3.4e-29	30.5
WP_002297662.1\|1755411_1755723_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002360096.1\|1756071_1756317_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002297668.1\|1756310_1756712_-	sigma-70 family RNA polymerase sigma factor	NA	NA	NA	NA
WP_002369229.1\|1757279_1759115_-	beta-galactosidase	NA	NA	NA	NA
WP_002330923.1\|1759286_1760549_-	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002360092.1\|1760686_1760911_+	hypothetical protein	NA	NA	NA	NA
WP_002298159.1\|1760907_1761072_+	hypothetical protein	NA	NA	NA	NA
WP_002298157.1\|1761165_1762458_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.9e-31	40.4
WP_002313174.1\|1762731_1762992_-	hypothetical protein	NA	NA	NA	NA
1763352:1763376	attL	NA	NA	NA	NA
WP_099704284.1\|1763596_1764758_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.3
WP_077497620.1\|1764830_1765037_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	U5P429	Shigella_phage	2.0e-06	53.3
WP_002383094.1\|1765040_1765154_+\|transposase	IS3 family transposase	NA	NA	NA	NA
1768417:1768441	attR	NA	NA	NA	NA

DBSCAN-SWA_9

1781882 : 1793366

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002298830.1\|1781882_1782887_-	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	1.4e-121	66.3
WP_002330911.1\|1782883_1785007_-\|transposase	transposase	A0A1S5SF30	Streptococcus_phage	6.2e-175	58.7
WP_002330910.1\|1785011_1787459_-	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_002298826.1\|1787445_1787835_-	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	2.5e-42	66.7
WP_002330909.1\|1787898_1788627_+	hypothetical protein	NA	NA	NA	NA
WP_011109507.1\|1788633_1789461_-	abortive infection family protein	NA	NA	NA	NA
WP_002369218.1\|1789534_1790038_-	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	1.2e-55	60.6
WP_002298822.1\|1790050_1790272_-	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_002346915.1\|1790668_1791919_+\|transposase	IS110 family transposase	M1NSC9	Streptococcus_phage	6.1e-114	62.1
WP_002330905.1\|1792050_1792185_-	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002360076.1\|1792181_1793366_-	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.0e-142	62.1

DBSCAN-SWA_10

1991205 : 2032358

Enterococcus_phage(91.67%)

capsid,integrase,transposase,portal,holin,tail,terminase

attL 1990933:1990959|attR 2032433:2032459

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1990933:1990959	attL	NA	NA	NA	NA
WP_002369085.1\|1991205_1991787_+	DUF4950 domain-containing protein	C9E2L5	Enterococcus_phage	4.2e-65	100.0
WP_000195429.1\|1991993_1993166_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_002369084.1\|1993501_1995004_+	membrane protein	C9E2L4	Enterococcus_phage	8.6e-272	98.0
WP_002369083.1\|1995067_1996360_-	peptidoglycan DD-metalloendopeptidase family protein	C9E2L3	Enterococcus_phage	1.3e-252	100.0
WP_002369082.1\|1996421_1996802_-	hypothetical protein	C9E2L2	Enterococcus_phage	1.1e-63	100.0
WP_002369081.1\|1996814_1998074_-	LysM peptidoglycan-binding domain-containing protein	C9E2L1	Enterococcus_phage	5.6e-224	94.5
WP_002369080.1\|1998078_1998282_-\|holin	holin	A0A0S2MYF6	Enterococcus_phage	2.6e-30	100.0
WP_099434214.1\|1998278_1998506_-	hypothetical protein	A0A0S2MYL7	Enterococcus_phage	1.3e-30	98.6
WP_024041692.1\|1998567_2000526_-	hypothetical protein	A0A097BYA8	Enterococcus_phage	3.6e-137	82.5
WP_002389851.1\|2000711_2002730_-	phage minor structural protein	A0A0S2MYF5	Enterococcus_phage	1.3e-307	99.0
WP_002369075.1\|2002746_2003676_-\|tail	tail protein	A0A097BY64	Enterococcus_phage	3.7e-172	99.4
WP_002389852.1\|2003676_2007084_-	tape measure protein	A0A0S2MYN1	Enterococcus_phage	0.0e+00	92.4
WP_002369073.1\|2007099_2007357_-	hypothetical protein	A0A097BYA4	Enterococcus_phage	1.6e-40	98.8
WP_002389853.1\|2007449_2007800_-	hypothetical protein	A0A097BYB6	Enterococcus_phage	3.3e-57	100.0
WP_025186771.1\|2007854_2008313_-	hypothetical protein	A0A0S2MYH7	Enterococcus_phage	1.6e-75	97.4
WP_002369069.1\|2008390_2008921_-\|tail	phage major tail protein, TP901-1 family	A0A097BY59	Enterococcus_phage	1.4e-91	98.3
WP_002369068.1\|2008936_2009326_-	hypothetical protein	A0A0S2MYG3	Enterococcus_phage	8.6e-67	99.2
WP_002369067.1\|2009322_2009703_-	hypothetical protein	A0A0S2MYE9	Enterococcus_phage	7.9e-65	98.4
WP_002369066.1\|2009677_2010013_-	hypothetical protein	A0A097BYB2	Enterococcus_phage	2.9e-55	95.5
WP_002369063.1\|2010009_2010342_-	hypothetical protein	A0A097BY55	Enterococcus_phage	2.1e-53	99.1
WP_002369062.1\|2010415_2011348_-\|capsid	phage major capsid protein	A0A1B1V000	Enterococcus_phage	9.7e-173	99.4
WP_002369061.1\|2011360_2011960_-	DUF4355 domain-containing protein	A0A097BY91	Enterococcus_phage	1.5e-73	97.0
WP_025186770.1\|2012082_2012346_-	hypothetical protein	A0A0S2MYE7	Enterococcus_phage	1.2e-43	98.9
WP_002369058.1\|2012440_2012710_-	hypothetical protein	A0A0S2MYD1	Enterococcus_phage	2.1e-43	97.8
WP_002369057.1\|2012710_2013649_-	hypothetical protein	A0A097BY50	Enterococcus_phage	3.1e-171	99.4
WP_002369056.1\|2013653_2015192_-\|portal	phage portal protein	A0A097BY86	Enterococcus_phage	1.1e-282	98.0
WP_002389854.1\|2015209_2016529_-\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	1.4e-230	91.6
WP_002369054.1\|2016500_2017304_-\|terminase	small subunit of terminase	D2J000	Enterococcus_phage	1.3e-125	91.8
WP_002369053.1\|2017490_2018054_-	hypothetical protein	NA	NA	NA	NA
WP_002389855.1\|2018494_2019118_-	hypothetical protein	A0A090DC14	Clostridium_phage	4.2e-15	31.7
WP_002389856.1\|2019101_2020016_-	DUF4868 domain-containing protein	Q24LC1	Clostridium_phage	2.8e-31	30.7
WP_002369049.1\|2020390_2020807_-	autolysin	D2IZL7	Enterococcus_phage	3.5e-66	96.4
WP_002389926.1\|2021174_2021435_-	hypothetical protein	NA	NA	NA	NA
WP_002389931.1\|2022121_2023072_-	hypothetical protein	C9E2N2	Enterococcus_phage	2.7e-69	51.6
WP_002369045.1\|2023072_2023753_-	hypothetical protein	C9E2N1	Enterococcus_phage	4.9e-126	98.7
WP_002389933.1\|2023749_2024688_-	DUF1351 domain-containing protein	C9E2N0	Enterococcus_phage	3.9e-97	74.6
WP_002369043.1\|2024672_2025350_-	ERF family protein	A0A0S2MYH3	Enterococcus_phage	9.6e-114	93.8
WP_002369042.1\|2025342_2025588_-	hypothetical protein	A0A0S2MYD6	Enterococcus_phage	5.7e-32	92.3
WP_024041688.1\|2025800_2025911_-	hypothetical protein	C9E2M6	Enterococcus_phage	3.9e-09	94.1
WP_002369040.1\|2025907_2026081_-	hypothetical protein	C9E2M5	Enterococcus_phage	2.3e-24	100.0
WP_002369038.1\|2026092_2026278_-	hypothetical protein	D2IZW5	Enterococcus_phage	1.9e-19	86.7
WP_002369036.1\|2026459_2026951_+	hypothetical protein	NA	NA	NA	NA
WP_002369035.1\|2026937_2027171_-	hypothetical protein	A0A182BQC3	Lactococcus_phage	1.2e-07	42.9
WP_002369034.1\|2027184_2027481_-	hypothetical protein	NA	NA	NA	NA
WP_002369033.1\|2027482_2028238_-	Rha family transcriptional regulator	D2IYT0	Enterococcus_phage	2.4e-44	54.5
WP_002369032.1\|2028257_2028509_-	hypothetical protein	A0A0S2MYC6	Enterococcus_phage	4.4e-40	93.8
WP_002369031.1\|2028547_2028811_-	helix-turn-helix transcriptional regulator	A0A097BY21	Enterococcus_phage	1.6e-40	98.9
WP_002369030.1\|2028949_2029474_+	helix-turn-helix domain-containing protein	A0A097BY22	Enterococcus_phage	1.9e-85	94.3
WP_002389937.1\|2029448_2029964_+	hypothetical protein	A0A0S2MYA6	Enterococcus_phage	1.6e-84	98.1
WP_002369027.1\|2030053_2030938_+	hypothetical protein	A0A097BY58	Enterococcus_phage	3.1e-128	96.5
WP_002389940.1\|2030953_2031154_+	hypothetical protein	A0A097BY73	Enterococcus_phage	1.6e-29	100.0
WP_002369025.1\|2031221_2032358_+\|integrase	site-specific integrase	A0A0S2MYI6	Enterococcus_phage	2.7e-209	98.7
2032433:2032459	attR	NA	NA	NA	NA

DBSCAN-SWA_11

2439972 : 2449712

Streptococcus_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002389787.1\|2439972_2442156_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.2e-285	66.6
WP_002368804.1\|2442188_2442785_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	7.1e-52	56.9
WP_002362328.1\|2442829_2443948_-	DNA polymerase IV	NA	NA	NA	NA
WP_002356377.1\|2444073_2444832_-	iron export ABC transporter permease subunit FetB	NA	NA	NA	NA
WP_002368803.1\|2444815_2445478_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.3e-19	31.6
WP_002368802.1\|2445492_2446365_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	1.1e-80	57.2
WP_002368801.1\|2446476_2446824_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	2.1e-16	37.6
WP_002356371.1\|2446816_2447656_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_002389791.1\|2447772_2448723_-	DNA polymerase III subunit delta'	M1NSC1	Streptococcus_phage	6.2e-34	33.0
WP_002356367.1\|2448724_2449054_-	hypothetical protein	NA	NA	NA	NA
WP_002356366.1\|2449073_2449712_-	dTMP kinase	M1PSC7	Streptococcus_phage	2.1e-54	53.8

DBSCAN-SWA_12

2528385 : 2548594

Streptococcus_phage(90.0%)

integrase

attL 2534440:2534455|attR 2556457:2556472

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079995048.1\|2528385_2529438_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-26	34.9
WP_000420681.1\|2529922_2530237_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	3.7e-52	97.1
WP_000985040.1\|2530252_2530639_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	2.5e-58	89.0
WP_002368310.1\|2530678_2532073_+	DNA translocase FtsK	A0A1S5SFB5	Streptococcus_phage	6.8e-247	90.9
WP_002390709.1\|2532075_2532231_+	hypothetical protein	NA	NA	NA	NA
WP_002390710.1\|2532278_2533454_+	XRE family transcriptional regulator	A0A1S5SEX3	Streptococcus_phage	1.9e-218	96.2
WP_001009056.1\|2533496_2533718_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.3e-31	100.0
WP_002368312.1\|2533834_2534332_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	9.6e-87	94.5
WP_025186755.1\|2534345_2534738_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.2e-68	99.2
2534440:2534455	attL	NA	NA	NA	NA
WP_002368314.1\|2534721_2537169_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	97.8
WP_002368316.1\|2537171_2539349_+	hypothetical protein	A0A1S5SF30	Streptococcus_phage	0.0e+00	93.0
WP_000769868.1\|2539345_2540347_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	5.0e-191	100.0
WP_001224320.1\|2540343_2541279_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	7.7e-170	99.0
WP_011058339.1\|2541553_2541640_+	tetracycline resistance determinant leader peptide	NA	NA	NA	NA
WP_000691736.1\|2541655_2543575_+	tetracycline resistance ribosomal protection protein Tet(M)	A0A1S5SF82	Streptococcus_phage	0.0e+00	99.5
WP_011058338.1\|2543675_2543861_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	3.9e-17	67.9
WP_001227347.1\|2543920_2544274_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	1.3e-58	100.0
WP_013670292.1\|2544478_2544550_+	hypothetical protein	NA	NA	NA	NA
WP_000804885.1\|2544778_2545201_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.5e-72	100.0
WP_000857133.1\|2545197_2545428_+	helix-turn-helix domain-containing protein	A0A1S5SEX1	Streptococcus_phage	2.7e-36	100.0
WP_001845478.1\|2545653_2545905_-	hypothetical protein	NA	NA	NA	NA
WP_000814511.1\|2545888_2546092_+	excisionase	A0A1S5SF07	Streptococcus_phage	4.0e-31	100.0
WP_002368319.1\|2546173_2547391_+\|integrase	tyrosine-type recombinase/integrase	A0A1S5SEW7	Streptococcus_phage	2.0e-231	99.3
WP_002355141.1\|2547655_2548594_-	glycosyltransferase family 2 protein	V5USA4	Oenococcus_phage	1.4e-78	50.5
2556457:2556472	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP036248

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP036248_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP036248_1

92730-92861

Orphan

Consensus_repeat	Method
GTTGGTTTTTCCCACTTTCGAACA	CRISPRCasFinder

2 spacers

The CRISPR arrays of NZ_CP036248_1

>merge|NZ_CP036248|1|92730-92861|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACAAAGTACTGGTATTATTGGATTCTTCTGGACGTTGGTTTTTCCCACTTTCGAAAGAAATGCCGATTTTATCATGTTTATCCGAAGGTTGGTTTTTCCCACTTTCGGGAA

>NZ_CP036248|1|1|92730-92861|CRISPRCasFinder
GTTGGTTTTTCCCACTTTCGAACA	AAGTACTGGTATTATTGGATTCTTCTGGAC
GTTGGTTTTTCCCACTTTCGAAAG	AAATGCCGATTTTATCATGTTTATCCGAAG
GTTGGTTTTTCCCACTTTCGGGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP036248.1\|WP_002369734.1\|83808_83994_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_002360663.1\|93544_93901_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_002387524.1\|96098_96329_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_002387528.1\|94929_95226_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_073340338.1\|78912_82830_-\|LPXTG-anchored-aggregation-substance	unknown	unknown	gnl\|CDD\|369832
NZ_CP036248.1\|WP_002379922.1\|78497_78851_-\|pheromone-response-system-RNA-binding-regulator-PrgU	unknown	unknown	gnl\|CDD\|286680
NZ_CP036248.1\|WP_002387530.1\|89801_91430_-\|peptide-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173869
NZ_CP036248.1\|WP_002383592.1\|91472_92141_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP036248.1\|WP_002369746.1\|93893_94676_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|224113
NZ_CP036248.1\|WP_010773557.1\|84065_86738_-\|surface-exclusion-protein-SEA1/PrgA	unknown	unknown	gnl\|CDD\|275124
NZ_CP036248.1\|WP_002390319.1\|88833_89799_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_010773379.1\|86748_87018_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_012881081.1\|95483_95570_-\|type-I-toxin-antitoxin-system-Fst-family-toxin	unknown	unknown	unknown
NZ_CP036248.1\|WP_002369738.1\|87623_88004_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP036248.1\|WP_002383600.1\|83145_83469_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379975

Protein	Function_ID	Function_description	E-value
NZ_CP036248.1\|WP_002369746.1\|93893_94676_-\|ParA-family-protein	gnl\|CDD\|224113	COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].	2.16992e-71
NZ_CP036248.1\|WP_010773557.1\|84065_86738_-\|surface-exclusion-protein-SEA1/PrgA	gnl\|CDD\|275124	TIGR04320, hypothetical_protein, SEC10/PgrA surface exclusion domain. This model describes a conserved domain found in surface proteins of a number of Firmutes. Many members have LPXTG C-terminal anchoring motifs and a substantial number have the KxYKxGKxW putative sorting signal at the N-terminus. The tetracycline resistance plasmid pCF10 in Enterococcus faecalis promotes conjugal plasmid transfer in response to sex pheromones, but PgrA/Sec10 encoded by that plasmid, a member of this family, specifically inhibits the ability of cells to receive homologous plasmids. The phenomenon is called surface exclusion.	1.8892e-38
NZ_CP036248.1\|WP_002383592.1\|91472_92141_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	1.62815e-13
NZ_CP036248.1\|WP_002387530.1\|89801_91430_-\|peptide-ABC-transporter-substrate-binding-protein	gnl\|CDD\|173869	cd08504, PBP2_OppA, The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	0
NZ_CP036248.1\|WP_073340338.1\|78912_82830_-\|LPXTG-anchored-aggregation-substance	gnl\|CDD\|369832	pfam08363, GbpC, Glucan-binding protein C. This domain is found in the Streptococcus Glucan-binding protein C (GbpC) and also in surface protein antigen (Spa)-family proteins which show sequence similarity to GbpC.	1.85764e-73
NZ_CP036248.1\|WP_002379922.1\|78497_78851_-\|pheromone-response-system-RNA-binding-regulator-PrgU	gnl\|CDD\|286680	pfam09627, PrgU, PrgU-like protein. This hypothetical protein of 125 residues is expressed in bacteria but is thought to be plasmid in origin. It forms a six beta-strand barrel with three accompanying alpha helices and is probably a homo-dimer in the cell. It may be involved in pheromone-inducible conjugation.	9.66855e-63
NZ_CP036248.1\|WP_002383600.1\|83145_83469_-\|hypothetical-protein	gnl\|CDD\|379975	pfam17400, DUF5406, Family of unknown function (DUF5406). This is a family of unknown function found in Bacteria.	1.20492e-41

>NZ_CP036248.1|WP_002383592.1|91472_92141_-|CPBP-family-intramembrane-metalloprotease
MEYIKRFFIVIGLFLLSQIGMFTYGTLKQSSLQVGQGTMPLLSTLILIVIFIMNIGLLLVLANKLELLNFDSKFLNKKNILIIVIGVVIARLVAILGTILLNNQGIDSTANDAAINNLFTGENPLLIILILGISAPIMEEIVFRAGIIGYFLKDWPILGIALSSISFGLVHGPTDIISFFMYALIGLVLSIAYFKTSRLEVSILIHFFNNLIPAIVIAFGLI
>NZ_CP036248.1|WP_002387530.1|89801_91430_-|peptide-ABC-transporter-substrate-binding-protein
MKKTEKILFLGFSALMFILIGCSNKDNLQENKKSSAVEQTANLTAATPIQSLDPATAVDQTSITLLANVMEGLYRLDKKNQAEPALAEKLPDISKDGKTYTISLRKDATWTDKTPVTAEDFVFAWQRVVDSNTASQNVGLFAPIENAEEISKGSKAKESLGVKAVNNHTLQIALKEPTPYFTNLLALPAFLPVNHKFADKHKKDYGTSKDTISTNGAFNLTNLEGLGTSDSWVIEKNTNYWDNKNVSMNTIHFQVIKEINTGVNLYKDGQLDEAPLGGEYAKQYKSDKDYSSSLLATSMYLELNKKPKDSILKNKNLRKSISYAIDRASLVEKLLDNGSIASVGLVPKKLVYDPKTKKDFADQDLVGYDKEKANKYWENAQKELTTPNNLKLDILVGDGEFEKKAGEFLQNQLQESLKGVTVTVTPVPANAHIEKLSKGDFSISLIGWQAGYADPLSFLANFKTNSPMNYGGYESNEFDILLKDTSDKRLKSLKEAEELLIDDAAIVPIIQTGSSKLINPNLKDINLHSVGSRYDYREMKKE
>NZ_CP036248.1|WP_002390319.1|88833_89799_+|hypothetical-protein
MKLCRKEFGENQEEFYKDIFSRRSASSFEIHNQHALQIKDIALLSDRSGLSFHELINYCKEDFASDFDKDLDYFRTTLDNYAKTQDIELKKNLEELYSKVVSLHFTSLKYMNLYFMMKLILSDKIDKISKIDYPDLLDVKKIFQNFSKFTLFHYKILANISSEFSFSELKSLYDELFPISENSTSELKEIAALCLNNILAGSFLEKRYEDILPILNIYNELLTHFPSYKYKINYIHNKNLYLYVTTKNLKYLNKVVSYIDLLEDIEGVEIAEQVRTSLEHLLSQEGDEKGKNFIGIVNEHGHIQTYEKSNYKKFFQEKRSD
>NZ_CP036248.1|WP_002369738.1|87623_88004_-|hypothetical-protein
MIELKATDLNRITCQLTLFNRQRFKLYNGTTERIVYDFSGRNLLINPVSFETDQDMEHFFRQVKLIYFDGKVVGYRGCSELPLKLECRAFQKMVKRQKMLLNAPFNYKVFEENEFREWCEKMRSYK
>NZ_CP036248.1|WP_010773379.1|86748_87018_-|hypothetical-protein
MLALMNEDADWYRNEDTERFKRIQELAKKIETASTRQFSSHISKERFEAYQRMGLQFKEIAEEFHITTTALQQWRKDNGYPIYNKNNKK
>NZ_CP036248.1|WP_010773557.1|84065_86738_-|surface-exclusion-protein-SEA1/PrgA
MKKFASAGLSILVATGVAGIGGNEVQAAEQAQPKTPENSSTEQPTVKATQTTEQAITEKQQQVTEKQAIVDQKQQVADTAKKEKDTIDQSVKDQQAVVDQNKDALDQSQQAVTDQQAVVDEAKKVVDEATPSAIEKAKEQVATDTQAVDEQQKVVDQAQTDVNQQQAVVDEKAKETNAAKVQNEKDQQAVTAAKQEQAKLEELAKNAEAEKAKAEKEQAAKEAELANKQKEEAKAKDQKTKDDQAVADQQSVVTTSQEKVADAKADTAAKQADLTSKENALKDKQAATKQAQNTLDSSKEELKGHKGLNLPANFTPDYYKKLTEQEKQAMEKEALALNKVFPENQADAAKVTEMINVKNPTEKQKQQMSDYVVGLINDVREKLGLQKLKISNQAMKFAWDVAKYDNPKEFDHDVNAINRAAKENGFKEFPGQNFYENLSMGRFTTQEGKVSMYDFEKAARNALVSMLMNDGHSGYSHLDSLLDANETNMAVSISGDLNDISAKIHIISYNQSKLVEANTYEEGTAPVFKSKETLQKEVATNQEKLATAQQAESDAQQARSASQQALNTAKTTQATAEKELSVHKATLANLQAVATKSTTNYEEKVRQTATAETSLQQTKDQLATINELIHNRAAVLEKAKTNVAEAQAIEQTSAKVLKEKQEAQKAEENTLNSLKEVLDLAKENLNQKQIALKTSTRSLSRLENAQPTYEKALNELNKAEAAVVQAQEAYENSLKSLEELKEQQAVATLAYTQAQEDLSNAKLELQQYQGILRDLEAQQAEQRRQEALQDQVAKEQQRLEREAKQQQMLVASATSADKTPSLQQLSFSKQKEQPKAQTLTHSEPRKTKQVAKAQESLPHTGEQQSIWLTIFGLFMAVGAISFKNKRRKNS
>NZ_CP036248.1|WP_002369734.1|83808_83994_-|hypothetical-protein
MAKKINLVSIFCSHEALEQIYILSYPYCLIKQYLFKRIEDIFGSFFIGEMTLLWRNRSRLK
>NZ_CP036248.1|WP_002383600.1|83145_83469_-|hypothetical-protein
MKNYDPNIRWGLHTIKVSFQRWDYKGYVTFVKGGNCKGLDILELEVDDLYDKKFKENPINFRLLGAGDDGEEWFAMTLKNNEDELFIEDEWKCLKDYILGIEIIDFK
>NZ_CP036248.1|WP_073340338.1|78912_82830_-|LPXTG-anchored-aggregation-substance
MKQQTEVKKRFKTYKAKKRWVTAPILFIGVLGVVGLATDDVQAAELDTQPGTTTVQPDNPDPQVGSTTPKTAVTEEATVQKDTTSQPTKVEEVAPENKGTEQSSATPNDTTNVQQPTAEAEKSAQEQPVVSPETTNEPLGQPTEVAPAENEANKSTSIPKEFETPDVDKAVDEAKKDPNITVVEKTAEDLGNVSSKDLAAKEKEVDQLQKEQAKKIAQQAAELKAKNEKIAKENAEIAAKNKAEKERYEKEVAEYNKHKNENGYVKEPVSKNLVFDQSVVTKDTKISSITGGKFIKAADFNKVNAGDSKDIFTKLRKDMAGKATGNFKNSFIKEVNLGSNGGYAVLLEKNKPVTVTYTGLNASYLGRKITKAEFVYELQSSSSKSGTLNAVFSNDPIITAFIGTSRANGKEIKTRLTIKFFDASGKEVLPDKASPFAYALSSLNSSLTNKGGHAEFVSDFGANNAFKYINGSYVKKQADGKFYSPEDIDYGTGPSKLKNSDWDAVGHKNAYFGSGVGLANGRISFSFGMTTKGKSNVPVSSAQWFAFSTNLNAKSITPYQEKGRFKQPEKATIEFNRYKANVVPVLVPNKEVTDGQKNINDLNVKRGDSLQYIVTGDTTELAKVDPKTVTKQGIRDTFDAEKVTIDLSKVKVYQADASLNEKDLKAVAAAINSGKAKDVTASYDLNLDQNTVTAMMKTNADGSVVLAMGYKYLLVLPFVVKNVEGDFENTAVQLTNDGETVTNTVINHVPGSNPSKDVKADKNGTVGTVSLHDKDIPLQTKIYYEVKSSERPANYGGITEEWGMNDVLDTTHDRFTGKWHAITNYDLKVGDKTLKAGTDISAYILLENKDNKDLTFTMNQALLAALNEGSNKVGKQAWSVYLEVERIKTGDVENTQTENYNKELVRSNTVVTHTPDDPKPTKAVHNKKGEDINHGKVARGDVLSYEMTWDLKGYDKDFAFDTVDLATGVSFFDDYDETKVTPIKDLLRVKDSKGVDITNQFTISWDDAKGTVTISAKDPQAFILAYGGQELRVTLPTKVKANVSGDVYNSAEQNTFGQRIKTNTVVNHIPKVNPKKDVVIKVGDKQSQNGATIKLGEKFFYEFTSSDIPAEYAGVVEEWSLSDKLDVKHDKFSGQWSVFANSNFVLADGTKVNKGDDISKLFTMTFEQGVVKITASQAFLDAMNLKENKHVAHSWKAFIGVERIAAGDVYNTIEESFNNEKIKTNTVVTHTPEKPQTPPEKTVIVPPTPKTPQAPVEPLVVEKASVVPELPQTGEKQNVLLTVAGSLVTMLGLAGLGFKRRKETK
>NZ_CP036248.1|WP_002379922.1|78497_78851_-|pheromone-response-system-RNA-binding-regulator-PrgU
MEAVVEREAKGMKEIAIQEKDLTLQWRGNTGKLVKVRLKNTRAMEMWYNKQITEENIQEITTLNIIKNGKSLALEVYPEKSIYVKPNLGRINVPVFFIKTPINRGVFEEIFGETLKA
>NZ_CP036248.1|WP_002360663.1|93544_93901_-|hypothetical-protein
MSNNRGKSAAERLLGAGKEDTNPTKATTSNEKELKTTHEHIVMNKKNIEKLIKQQGNSKRNADSIRINPILANALKYWTSIGEPEKSKPDVIEETLLKSIPEEYLIKGYEMAKKQNKI
>NZ_CP036248.1|WP_002369746.1|93893_94676_-|ParA-family-protein
MARIISVANQKGGVSKTTTSINLGAALHFTFNKSVLVIDMDPQGNATDNFGFDIDGTNVPTIYEVLKDEASITEAILNYKGIDVIPADIALSSAEREFTQVGSEHRLKRVLQPIEENYDYIIIDCPPSLGILTVNAFTVSDEIIIPVEAAYFSLKGLVKLNETIETVKEYTNESLIIRGVLFTKYNERFNISKEMNKTANQISDALHVNIFDTYIRRTITVDEAQAAGSDLISFNKTSTAEDDYIQFTKEFLEKVGDLNE
>NZ_CP036248.1|WP_002387528.1|94929_95226_-|hypothetical-protein
MPRKTFVYPHPINAYIIKHLGITVEEFCELHAFSQGTVSSWITRNKKIETLPISFIYSLSLSASKTMDQVYSDLLKLQDDYLLHLERHRRTKKIIDEE
>NZ_CP036248.1|WP_012881081.1|95483_95570_-|type-I-toxin-antitoxin-system-Fst-family-toxin
MAEKLISLIIAPLLVGLVLLLVDRWLDD
>NZ_CP036248.1|WP_002387524.1|96098_96329_-|hypothetical-protein
MVRRTKKEFKPYNDYVDRPFELKWPTAFPLGELQAAIKETNDYHSREIERLPQQSQAKIEHLLSRSIKQNSAEFLR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_KY513281	Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence	5073-5102	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	602-631	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	515-544	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33709-33738	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	503-532	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	503-532	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5526-5555	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83505-83534	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	LC499744	Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence	9536-9565	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	827-856	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7643-7672	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66171-66200	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12176-12205	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60906-60935	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92754-92783	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43889-43918	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4944-4973	0	1.0
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	CP002494	Enterococcus faecalis 62 plasmid EF62pC, complete sequence	7697-7726	0	1.0
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP031028	Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence	12230-12259	0	1.0
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP019514	Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence	60960-60989	0	1.0
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP036248	Enterococcus faecalis R712 plasmid pR712_02, complete sequence	92808-92837	0	1.0
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NC_013533	Enterococcus faecalis plasmid pBEE99, complete sequence	748-777	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP030046	Enterococcus faecalis strain C54 plasmid pC54, complete sequence	43943-43972	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP028284	Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence	4998-5027	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NC_004671	Enterococcus faecalis V583 plasmid pTEF2, complete sequence	548-577	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP015885	Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence	461-490	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP040897	Enterococcus faecalis strain HA-1 plasmid punnamed	33655-33684	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP046109	Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence	449-478	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP028837	Enterococcus faecalis strain FC plasmid unnamed2, complete sequence	5472-5501	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NC_011642	Enterococcus faecalis plasmid pMG2200, complete sequence	83451-83480	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP030043	Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence	773-802	1	0.967
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	MH830362	Enterococcus faecalis plasmid p4, complete sequence	66225-66254	2	0.933
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP049777	Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence	449-478	2	0.933
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	NC_023573	Staphylococcus phage phiSA012 DNA, complete genome	31963-31992	6	0.8
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP009639	Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence	44093-44122	6	0.8
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP053963	Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence	85626-85655	6	0.8
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	MT711976	Streptomyces phage Coruscant, complete genome	87401-87430	7	0.767
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP045822	Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence	31080-31109	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP045813	Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence	22357-22386	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP041758	Bacillus sp. KBS0812 plasmid unnamed, complete sequence	54635-54664	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP010015	Bacillus sp. YP1 plasmid pBUYP1, complete sequence	19043-19072	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NC_021809	Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence	25434-25463	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP020103	Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence	16845-16874	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NC_015149	Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631	65777-65806	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP034485	Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence	65216-65245	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP045923	Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence	22456-22485	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP035412	Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence	75658-75687	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP028216	Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence	14293-14322	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP035398	Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence	81874-81903	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_CP030938	Bacillus sp. DM2 plasmid unnamed, complete sequence	50467-50496	8	0.733
NZ_CP036248_1	1.2\|92808\|30\|NZ_CP036248\|CRISPRCasFinder	92808-92837	30	NZ_AP019715	Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence	53778-53807	8	0.733
NZ_CP036248_1	1.1\|92754\|30\|NZ_CP036248\|CRISPRCasFinder	92754-92783	30	JQ660954	Clostridium phage PhiS63, complete genome	22890-22919	9	0.7

1. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_KY513281 (Enterococcus faecalis strain 6742 plasmid p6742_2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

2. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

3. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

4. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

5. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

6. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

7. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

8. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

9. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to LC499744 (Enterococcus faecalis S7316 plasmid pS7316optrA DNA, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

10. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

11. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

12. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

13. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

14. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

15. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

16. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

17. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattattggattcttctggac	Protospacer
******************************

18. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to CP002494 (Enterococcus faecalis 62 plasmid EF62pC, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

19. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP031028 (Enterococcus faecalis strain TY1 isolate flatfish plasmid pDEF-1, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

20. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP019514 (Enterococcus faecalis strain CLB21560 plasmid pB, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

21. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP036248 (Enterococcus faecalis R712 plasmid pR712_02, complete sequence) position: , mismatch: 0, identity: 1.0

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcatgtttatccgaag	Protospacer
******************************

22. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NC_013533 (Enterococcus faecalis plasmid pBEE99, complete sequence) position: , mismatch: 1, identity: 0.967

aagtactggtattattggattcttctggac	CRISPR spacer
aagtcctggtattattggattcttctggac	Protospacer
**** *************************

23. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP030046 (Enterococcus faecalis strain C54 plasmid pC54, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

24. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP028284 (Enterococcus faecalis strain FDAARGOS_324 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

25. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NC_004671 (Enterococcus faecalis V583 plasmid pTEF2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

26. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP015885 (Enterococcus faecalis strain sorialis plasmid Efsorialis-p2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

27. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP040897 (Enterococcus faecalis strain HA-1 plasmid punnamed) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

28. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP046109 (Enterococcus faecalis strain 133170041-3 plasmid pAD1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

29. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP028837 (Enterococcus faecalis strain FC plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

30. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NC_011642 (Enterococcus faecalis plasmid pMG2200, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

31. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP030043 (Enterococcus faecalis strain C25 plasmid pC25-1, complete sequence) position: , mismatch: 1, identity: 0.967

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgccgattttatcatgtttatccgaag	Protospacer
***.**************************

32. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to MH830362 (Enterococcus faecalis plasmid p4, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

33. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP049777 (Enterococcus faecalis strain ES-1 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaacgctgattttatcatgtttatccgaag	Protospacer
***.**.***********************

34. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to NC_023573 (Staphylococcus phage phiSA012 DNA, complete genome) position: , mismatch: 6, identity: 0.8

aagtactggtattattggattcttctggac	CRISPR spacer
aagtactggtattaaaggattcttcaaaat	Protospacer
**************  ********* ..*.

35. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP009639 (Bacillus cereus 03BB108 plasmid pBFI_1, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

36. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP053963 (Bacillus cereus strain FDAARGOS_802 plasmid unnamed3, complete sequence) position: , mismatch: 6, identity: 0.8

aaatgccgattttatcatgtttatccgaag---	CRISPR spacer
aaatgacgattttatcatcttta---gaaagca	Protospacer
***** ************ ****   ***.

37. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to MT711976 (Streptomyces phage Coruscant, complete genome) position: , mismatch: 7, identity: 0.767

aagtactggtattattggattcttctggac	CRISPR spacer
acagagtggttttattggcttcttctggat	Protospacer
* . * **** ******* **********.

38. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP045822 (Bacillus subtilis strain MB8_B7 plasmid pBs001, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

39. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP045813 (Bacillus subtilis strain P8_B3 plasmid pBs005, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

40. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP041758 (Bacillus sp. KBS0812 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

41. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP010015 (Bacillus sp. YP1 plasmid pBUYP1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

42. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NC_021809 (Bacillus subtilis subsp. subtilis str. NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

43. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP020103 (Bacillus subtilis strain NCIB 3610 plasmid pBS32, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

44. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NC_015149 (Bacillus subtilis subsp. natto plasmid pLS32 DNA, complete sequence, strain: IAM 11631) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

45. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP034485 (Bacillus subtilis subsp. subtilis NCIB 3610 = ATCC 6051 strain NCIB 3610 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

46. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP045923 (Bacillus subtilis strain P8_B1 plasmid pBs003, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

47. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP035412 (Bacillus subtilis strain SRCM103622 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

48. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP028216 (Bacillus subtilis strain SRCM102750 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

49. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP035398 (Bacillus subtilis strain SRCM103773 plasmid unnamed1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

50. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_CP030938 (Bacillus sp. DM2 plasmid unnamed, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

51. spacer 1.2|92808|30|NZ_CP036248|CRISPRCasFinder matches to NZ_AP019715 (Bacillus subtilis subsp. subtilis strain NBRC 13719 plasmid pBSU1, complete sequence) position: , mismatch: 8, identity: 0.733

aaatgccgattttatcatgtttatccgaag	CRISPR spacer
aaatgccgattttatcttatttacagaatc	Protospacer
**************** *.****.  .*

52. spacer 1.1|92754|30|NZ_CP036248|CRISPRCasFinder matches to JQ660954 (Clostridium phage PhiS63, complete genome) position: , mismatch: 9, identity: 0.7

aagtactggtattattggattcttctggac	CRISPR spacer
ttgtactgatattattggtttcttcgtttt	Protospacer
  ******.********* ******    .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1815 : 54550

Streptococcus_phage(46.15%)

holin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000576156.1\|1815_2370_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.3e-36	52.1
WP_000085855.1\|2588_2720_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.2e-14	90.7
WP_001038790.1\|2724_3462_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
WP_001814874.1\|3586_3670_-	23S rRNA methyltransferase attenuation leader peptide	NA	NA	NA	NA
WP_001096887.1\|4210_5005_-	aminoglycoside O-phosphotransferase APH(3')-IIIa	E4ZFP6	Streptococcus_phage	2.3e-154	100.0
WP_001255866.1\|5574_6483_-	aminoglycoside nucleotidyltransferase ANT(6)-Ia	E4ZFP8	Streptococcus_phage	2.8e-177	100.0
WP_000662263.1\|6515_7250_-	class I SAM-dependent methyltransferase	A0A1X9I6N4	Streptococcus_phage	1.5e-141	100.0
WP_000233000.1\|7230_8100_-	hypothetical protein	A0A1X9I6C9	Streptococcus_phage	6.7e-152	90.7
WP_000205227.1\|8114_8339_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002390960.1\|8481_10026_-	recombinase family protein	A0A2K5B2B4	Erysipelothrix_phage	1.8e-256	88.7
WP_000323438.1\|10045_10462_-	recombinase	A0A2K5B2B3	Erysipelothrix_phage	1.2e-71	98.6
WP_002360685.1\|10462_10759_-	hypothetical protein	A0A2K5B2B2	Erysipelothrix_phage	4.6e-44	91.8
WP_000238804.1\|11151_11757_-	helix-turn-helix domain-containing protein	A0A219YA40	Aeromonas_phage	3.6e-19	33.7
WP_000653331.1\|11887_14860_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	3.6e-197	36.4
WP_001062586.1\|15902_16505_-	recombinase family protein	A0A219YA40	Aeromonas_phage	5.7e-17	38.3
WP_002354485.1\|17005_17692_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000222577.1\|17819_18779_+\|transposase	IS30-like element IS1252 family transposase	W5R8L2	Staphylococcus_phage	2.4e-33	35.1
WP_000170424.1\|19211_19784_-	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	6.8e-36	46.0
WP_000599739.1\|19799_20405_-	cell filamentation protein	NA	NA	NA	NA
WP_000958277.1\|20634_20865_+	hypothetical protein	NA	NA	NA	NA
WP_001278770.1\|20864_21206_+	type II toxin-antitoxin system PemK/MazF family toxin	A0A1S5SEX8	Streptococcus_phage	4.2e-17	41.7
WP_001053446.1\|21317_22256_+	hypothetical protein	NA	NA	NA	NA
WP_000892301.1\|22502_23105_+	cell division protein Fic	NA	NA	NA	NA
WP_000246197.1\|23817_24084_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_002402695.1\|24076_24352_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_000606299.1\|25230_25557_-	hypothetical protein	NA	NA	NA	NA
WP_052774627.1\|25757_28505_-	BspA family leucine-rich repeat surface protein	NA	NA	NA	NA
WP_001808798.1\|28627_28837_-	hypothetical protein	NA	NA	NA	NA
WP_000758948.1\|28836_29217_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_000758651.1\|29219_30248_-	DUF916 and DUF3324 domain-containing protein	NA	NA	NA	NA
WP_000836322.1\|30624_31329_-	hypothetical protein	NA	NA	NA	NA
WP_001186973.1\|31808_32738_-	CHAP domain-containing protein	S5M633	Brevibacillus_phage	3.2e-19	41.9
WP_001015293.1\|32778_33459_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.6e-116	89.8
WP_002379942.1\|33736_34423_-\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	4.8e-113	88.5
WP_001808810.1\|34455_34620_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000384569.1\|34785_34983_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_002390459.1\|34972_35587_+	helix-turn-helix transcriptional regulator	A0A139ZPI6	Marinitoga_camini_virus	1.2e-06	46.8
WP_000384541.1\|35769_36687_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.6e-42	43.6
WP_000933358.1\|36679_37429_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_000242080.1\|37428_38259_+	undecaprenyl-diphosphate phosphatase	NA	NA	NA	NA
WP_002379942.1\|38455_39142_-\|transposase	IS6-like element ISEnfa1 family transposase	A0A1X9I6C6	Streptococcus_phage	4.8e-113	88.5
WP_002415860.1\|39282_40104_+	hypothetical protein	NA	NA	NA	NA
WP_002367774.1\|40137_40482_+	hypothetical protein	NA	NA	NA	NA
WP_000875953.1\|40471_40741_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	4.3e-17	46.5
WP_002367772.1\|40973_42905_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002390192.1\|43095_44535_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.6e-09	22.6
WP_002367770.1\|44536_45499_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.0e-20	27.3
WP_000241511.1\|45563_45926_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_000245205.1\|45919_46183_-	PbsX family transcriptional regulator	NA	NA	NA	NA
WP_000411487.1\|46680_47337_-	hypothetical protein	NA	NA	NA	NA
WP_000406546.1\|48587_49229_-	hypothetical protein	NA	NA	NA	NA
WP_002383787.1\|49610_50924_-	hypothetical protein	NA	NA	NA	NA
WP_000865436.1\|51047_51911_-	DNA/RNA non-specific endonuclease	NA	NA	NA	NA
WP_001209505.1\|51900_52344_-	hypothetical protein	NA	NA	NA	NA
WP_002383786.1\|52557_53493_-	hypothetical protein	NA	NA	NA	NA
WP_001031355.1\|53634_53832_-	hypothetical protein	NA	NA	NA	NA
WP_002365924.1\|54307_54550_+\|holin	putative holin-like toxin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP036247

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 60708

Streptococcus_phage(32.0%)

transposase,holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002369773.1\|1168_1417_+	hypothetical protein	NA	NA	NA	NA
WP_002369771.1\|1519_1786_+	type II toxin-antitoxin system RelB/DinJ family antitoxin	NA	NA	NA	NA
WP_002360769.1\|1778_2054_+	type II toxin-antitoxin system YafQ family toxin	NA	NA	NA	NA
WP_002365983.1\|2857_3043_+	hypothetical protein	NA	NA	NA	NA
WP_079995061.1\|3045_3219_+	PcfM protein	NA	NA	NA	NA
WP_002360842.1\|3242_3833_+	hypothetical protein	A0A1B0XUG6	Freshwater_phage	2.1e-08	38.8
WP_002390215.1\|3937_4717_+	hypothetical protein	A8ATL9	Listeria_phage	1.3e-16	45.2
WP_002417363.1\|4716_6060_+	hypothetical protein	A8ATM0	Listeria_phage	2.0e-102	42.8
WP_002390334.1\|6750_7362_+	hypothetical protein	B5SP25	Lactococcus_phage	7.5e-57	56.2
WP_002390336.1\|7689_8100_+	hypothetical protein	NA	NA	NA	NA
WP_002360759.1\|8185_8524_+	hypothetical protein	NA	NA	NA	NA
WP_002369765.1\|8738_9398_+	DUF2786 domain-containing protein	A0A172JHR5	Bacillus_phage	1.9e-13	30.7
WP_002375302.1\|9447_9630_+	hypothetical protein	NA	NA	NA	NA
WP_002390338.1\|9840_10533_-	hypothetical protein	NA	NA	NA	NA
WP_002369763.1\|10685_12452_+	glycoside hydrolase family protein	A0A1U9WRD0	Streptococcus_virus	3.6e-27	45.3
WP_002375300.1\|12636_13272_+	hypothetical protein	NA	NA	NA	NA
WP_002390339.1\|13258_13726_+\|holin	holin	A0A097QQ04	Enterococcus_phage	2.7e-30	62.4
WP_002369761.1\|13728_14256_+	hypothetical protein	NA	NA	NA	NA
WP_002360863.1\|14298_16479_+	DUF1906 domain-containing protein	NA	NA	NA	NA
WP_002369760.1\|16586_17129_+	hypothetical protein	NA	NA	NA	NA
WP_002369759.1\|17195_17771_+	YcxB family protein	NA	NA	NA	NA
WP_002367719.1\|18044_19364_+\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_079995077.1\|21345_22221_+	hypothetical protein	NA	NA	NA	NA
WP_002367777.1\|23324_23738_+	hypothetical protein	NA	NA	NA	NA
WP_002367775.1\|24107_26609_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_002367774.1\|26642_26987_+	hypothetical protein	NA	NA	NA	NA
WP_000875953.1\|26976_27246_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A1S5SCV8	Streptococcus_phage	4.3e-17	46.5
WP_002367772.1\|27478_29410_-	PTS beta-glucoside transporter subunit IIBCA	NA	NA	NA	NA
WP_002367771.1\|29600_31040_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.6e-09	22.6
WP_002367770.1\|31041_32004_+	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.0e-20	27.3
WP_000241511.1\|32068_32431_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_000245205.1\|32424_32688_-	PbsX family transcriptional regulator	NA	NA	NA	NA
WP_000588503.1\|32836_33094_-	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_000388479.1\|33086_33356_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_001120991.1\|33486_33666_-	hypothetical protein	NA	NA	NA	NA
WP_002326819.1\|34046_34742_-	hypothetical protein	NA	NA	NA	NA
WP_002354485.1\|34797_35484_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_000312841.1\|36014_36302_-	hypothetical protein	NA	NA	NA	NA
WP_000629052.1\|36291_36621_-	hypothetical protein	NA	NA	NA	NA
WP_000754864.1\|36925_37255_+	helix-turn-helix transcriptional regulator	E4ZFI8	Streptococcus_phage	2.6e-16	44.6
WP_000516404.1\|37541_38027_-	glycopeptide resistance protein VanZ-A	NA	NA	NA	NA
WP_000732308.1\|38179_39091_-	VanY-A/VanY-F/VanY-M family D-Ala-D-Ala carboxypeptidase	NA	NA	NA	NA
WP_000402348.1\|39518_40127_-	D-Ala-D-Ala dipeptidase VanX-A	NA	NA	NA	NA
WP_001079843.1\|40132_41164_-	D-alanine--(R)-lactate ligase VanA	NA	NA	NA	NA
WP_001059542.1\|41156_42125_-	D-lactate dehydrogenase VanH-A	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	3.5e-40	33.1
WP_000122610.1\|42456_43749_+\|transposase	ISL3 family transposase	A0A1S5SBP9	Streptococcus_phage	3.2e-57	38.9
WP_002305818.1\|43846_45001_-	VanA-type vancomycin resistance histidine kinase VanS	W8CYF6	Bacillus_phage	1.5e-13	23.3
WP_001280781.1\|44978_45674_-	VanA-type vancomycin resistance DNA-binding response regulator VanR	W8CYM9	Bacillus_phage	4.9e-36	37.7
WP_001226076.1\|45887_46463_-	recombinase family protein	A0A1V0E035	Clostridioides_phage	9.0e-20	34.8
WP_002354485.1\|48245_48932_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-127	99.6
WP_002370256.1\|49424_50021_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	7.1e-20	36.6
WP_002358267.1\|50037_50325_+	hypothetical protein	NA	NA	NA	NA
WP_002358271.1\|50318_50543_+	hypothetical protein	NA	NA	NA	NA
WP_002390466.1\|50611_50812_+	hypothetical protein	NA	NA	NA	NA
WP_002360675.1\|50832_51135_+	hypothetical protein	NA	NA	NA	NA
WP_001240982.1\|51499_54418_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.1e-169	36.1
WP_000576156.1\|54421_54976_-	recombinase family protein	A0A0F7LA37	Escherichia_phage	2.3e-36	52.1
WP_000085855.1\|55194_55326_-	hypothetical protein	E4ZFP9	Streptococcus_phage	8.2e-14	90.7
WP_001038790.1\|55330_56068_-	23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B)	E4ZFQ0	Streptococcus_phage	1.4e-134	99.6
WP_001865637.1\|56192_56276_-	23S rRNA methyltransferase attenuator leader peptide ErmL	NA	NA	NA	NA
WP_002370254.1\|56834_58163_+	Y-family DNA polymerase	Q6DMX4	Streptococcus_phage	3.7e-93	42.4
WP_002360672.1\|58159_58510_+	hypothetical protein	NA	NA	NA	NA
WP_002360667.1\|58760_58871_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_002369784.1\|59109_59406_+	hypothetical protein	NA	NA	NA	NA
WP_002369783.1\|59525_59801_-	hypothetical protein	NA	NA	NA	NA
WP_002366009.1\|59778_60708_-	ParA family protein	F0PIG8	Enterococcus_phage	2.6e-16	25.6

DBSCAN-SWA_2

63824 : 68188

Staphylococcus_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000195429.1\|63824_64997_+\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0
WP_000393259.1\|65053_65446_+	GNAT family N-acetyltransferase	A0A0N7GFH7	Staphylococcus_phage	6.9e-72	100.0
WP_001028144.1\|65446_66886_+	aminoglycoside O-phosphotransferase APH(2'')-Ia	A0A1X9I6C2	Streptococcus_phage	3.8e-285	100.0
WP_000195429.1\|67015_68188_-\|transposase	IS256-like element IS256 family transposase	A0A0N9STL0	Staphylococcus_phage	3.5e-135	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP036249

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP036248

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP036247

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection