CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP035683	Vibrio mimicus strain 2011V-1073 chromosome 2, complete sequence	0 crisprs	csa3,RT,cas3	0	0	1	0
NZ_CP035682	Vibrio mimicus strain 2011V-1073 chromosome 1, complete sequence	1 crisprs	DEDDh,RT,csa3,DinG,cas3,csx1	0	0	5	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

311053 : 317230

Vibrio_phage(90.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154113995.1\|311053_312427_-	toxin	Q64EV0	Vibrio_phage	2.6e-198	75.3
WP_001160094.1\|312429_312774_-	DUF2523 domain-containing protein	G8IRV0	Vibrio_phage	4.8e-53	86.0
WP_154113996.1\|312773_314180_-	hypothetical protein	G8IRU9	Vibrio_phage	1.2e-89	45.4
WP_000776831.1\|314310_314520_-	hypothetical protein	G8IRU8	Vibrio_phage	8.6e-13	58.0
WP_154114463.1\|314553_314748_-	hypothetical protein	G8IRU7	Vibrio_phage	5.1e-20	73.0
WP_000974869.1\|314793_315132_-	DUF1293 domain-containing protein	Q858R2	Vibrio_phage	9.8e-51	89.3
WP_154113997.1\|315131_316241_-	replication initiation factor family protein	Q64EV8	Vibrio_phage	6.2e-211	94.8
WP_005515307.1\|316230_316434_-	hypothetical protein	C3W4P3	Vibrio_phage	8.5e-34	95.5
WP_001018573.1\|316444_316693_-	hypothetical protein	O56843	Vibrio_virus	2.0e-21	66.7
WP_154113998.1\|316861_317230_+	hypothetical protein	Q858Q3	Vibrio_phage	8.8e-53	84.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP035682

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP035682_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP035682_1

1169476-1169560

Orphan

Consensus_repeat	Method
CCCCCCCTTGCCACGCATAATTACCCCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP035682_1

>merge|NZ_CP035682|1|1169476-1169560|CRISPRCasFinder
CCCCCCCTTGCCACGCATAATTACCCCCCTGACTACTGACGATCTGCGCATAATCACCCCCCCTTGCCACGCATAATTCCCCCCC

>NZ_CP035682|1|1|1169476-1169560|CRISPRCasFinder
CCCCCCCTTGCCACGCATAATTACCCCCC	TGACTACTGACGATCTGCGCATAATCA
CCCCCCCTTGCCACGCATAATTCCCCCCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP035682.1\|WP_000044781.1\|1175201_1175339_-\|50S-ribosomal-protein-L34	unknown	unknown	gnl\|CDD\|366117
NZ_CP035682.1\|WP_154113085.1\|1165301_1168061_+\|conjugal-transfer-mating-pair-stabilization-protein-TraN	unknown	unknown	gnl\|CDD\|237846
NZ_CP035682.1\|WP_113604264.1\|1158265_1159690_+\|conjugal-transfer-protein-TraH	unknown	unknown	gnl\|CDD\|368759
NZ_CP035682.1\|WP_063691921.1\|1168425_1169379_+\|replication-protein	unknown	unknown	gnl\|CDD\|309782
NZ_CP035682.1\|WP_000505209.1\|1176314_1176986_-\|amino-acid-ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223836
NZ_CP035682.1\|WP_000378226.1\|1172980_1174606_-\|membrane-protein-insertase-YidC	unknown	unknown	gnl\|CDD\|234942
NZ_CP035682.1\|WP_063691927.1\|1164671_1165205_+\|regulator	unknown	unknown	gnl\|CDD\|377635
NZ_CP035682.1\|WP_000561079.1\|1175580_1176318_-\|amino-acid-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224051
NZ_CP035682.1\|WP_032481331.1\|1163097_1163352_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035682.1\|WP_154113763.1\|1168193_1168439_+\|DNA-binding-protein	unknown	unknown	gnl\|CDD\|378935
NZ_CP035682.1\|WP_000683491.1\|1177063_1177810_-\|amino-acid-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270427
NZ_CP035682.1\|WP_032481345.1\|1170100_1171324_-\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271185
NZ_CP035682.1\|WP_154113084.1\|1157164_1158022_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035682.1\|WP_032481337.1\|1169735_1170104_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|200128
NZ_CP035682.1\|WP_032469211.1\|1174608_1174866_-\|membrane-protein-insertion-efficiency-factor-YidD	unknown	unknown	gnl\|CDD\|376620
NZ_CP035682.1\|WP_001747911.1\|1163848_1164058_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035682.1\|WP_022577335.1\|1171526_1172888_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	unknown	unknown	gnl\|CDD\|235392
NZ_CP035682.1\|WP_001747910.1\|1164057_1164669_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP035682.1\|WP_005510105.1\|1174832_1175189_-\|ribonuclease-P-protein-component	unknown	unknown	gnl\|CDD\|179327
NZ_CP035682.1\|WP_001747912.1\|1159693_1163098_+\|conjugal-transfer-protein-TraG	unknown	unknown	gnl\|CDD\|369594

Protein	Function_ID	Function_description	E-value
NZ_CP035682.1\|WP_000044781.1\|1175201_1175339_-\|50S-ribosomal-protein-L34	gnl\|CDD\|366117	pfam00468, Ribosomal_L34, Ribosomal protein L34.	1.21493e-11
NZ_CP035682.1\|WP_154113085.1\|1165301_1168061_+\|conjugal-transfer-mating-pair-stabilization-protein-TraN	gnl\|CDD\|237846	PRK14876, PRK14876, conjugal transfer mating pair stabilization protein TraN; Provisional.	0
NZ_CP035682.1\|WP_000378226.1\|1172980_1174606_-\|membrane-protein-insertase-YidC	gnl\|CDD\|234942	PRK01318, PRK01318, membrane protein insertase; Provisional.	0
NZ_CP035682.1\|WP_000561079.1\|1175580_1176318_-\|amino-acid-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224051	COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism].	7.70746e-142
NZ_CP035682.1\|WP_063691921.1\|1168425_1169379_+\|replication-protein	gnl\|CDD\|309782	pfam04796, RepA_C, Plasmid encoded RepA protein. Family of plasmid encoded proteins involved in plasmid replication. The role of RepA in the replication process is not clearly understood.	1.76848e-30
NZ_CP035682.1\|WP_063691927.1\|1164671_1165205_+\|regulator	gnl\|CDD\|377635	pfam06252, DUF1018, Protein of unknown function (DUF1018). This family consists of several bacterial and phage proteins of unknown function.	0.0020516
NZ_CP035682.1\|WP_001747912.1\|1159693_1163098_+\|conjugal-transfer-protein-TraG	gnl\|CDD\|369594	pfam07916, TraG_N, TraG-like protein, N-terminal region. The bacterial sequences found in this family are similar to the N-terminal region of the TraG protein. This is a membrane-spanning protein, with three predicted transmembrane segments and two periplasmic regions. TraG protein is known to be essential for DNA transfer in the process of conjugation, with the N-terminal portion being required for F pilus assembly. The protein is thought to interact with the periplasmic domain of TraN to stabilize mating-cell interactions.	1.51446e-56
NZ_CP035682.1\|WP_154113763.1\|1168193_1168439_+\|DNA-binding-protein	gnl\|CDD\|378935	pfam12728, HTH_17, Helix-turn-helix domain. This domain is a DNA-binding helix-turn-helix domain.	7.28551e-05
NZ_CP035682.1\|WP_032481345.1\|1170100_1171324_-\|site-specific-integrase	gnl\|CDD\|271185	cd01185, INTN1_C_like, Integrase IntN1 of Bacteroides mobilizable transposon NBU1 and similar proteins, C-terminal catalytic domain. IntN1 is a tyrosine recombinase for the integration and excision of Bacteroides mobilizable transposon NBU1 from the host chromosome. IntN1 does not require strict homology between the recombining sites seen with other tyrosine recombinases. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	3.04278e-51
NZ_CP035682.1\|WP_000505209.1\|1176314_1176986_-\|amino-acid-ABC-transporter-permease	gnl\|CDD\|223836	COG0765, HisM, ABC-type amino acid transport system, permease component [Amino acid transport and metabolism].	1.02883e-74
NZ_CP035682.1\|WP_032481337.1\|1169735_1170104_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|200128	TIGR01764, Probable_excisionase, DNA binding domain, excisionase family. An excisionase, or Xis protein, is a small protein that binds and promotes excisive recombination; it is not enzymatically active. This model represents a number of putative excisionases and related proteins from temperate phage, plasmids, and transposons, as well as DNA binding domains of other proteins, such as a DNA modification methylase. This model identifies mostly small proteins and N-terminal regions of large proteins, but some proteins appear to have two copies. This domain appears similar, in both sequence and predicted secondary structure (PSIPRED) to the MerR family of transcriptional regulators (pfam00376). [Unknown function, General].	3.3368e-14
NZ_CP035682.1\|WP_005510105.1\|1174832_1175189_-\|ribonuclease-P-protein-component	gnl\|CDD\|179327	PRK01732, rnpA, ribonuclease P; Reviewed.	1.7566e-64
NZ_CP035682.1\|WP_022577335.1\|1171526_1172888_-\|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE	gnl\|CDD\|235392	PRK05291, trmE, tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE.	0
NZ_CP035682.1\|WP_032469211.1\|1174608_1174866_-\|membrane-protein-insertion-efficiency-factor-YidD	gnl\|CDD\|376620	pfam01809, Haemolytic, Haemolytic domain. This domain has haemolytic activity. It is found in short (73-103 amino acid) proteins and contains three conserved cysteine residues.	3.54314e-39
NZ_CP035682.1\|WP_000683491.1\|1177063_1177810_-\|amino-acid-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270427	cd13709, PBP2_YxeM, Substrate binding domain of an ABC transporter YxeMNO; the type 2 periplasmic binding protein fold. This group contains cystine-binding domain (YxeM) of a periplasmic receptor-dependent ATP-binding cassette transporter and its closely related proteins. Cystine is an oxidized dimeric form of cysteine that is required for optimal bacterial growth. In Bacillus subtilis, three ABC transporters, TcyJKLMN (YtmJKLMN), TcyABC (YckKJI), and YxeMNO are involved in uptake of cystine. Likewise, three uptake systems were identified in Salmonella enterica serovar Typhimurium, while in Escherichia coli, two transport systems seem to be involved in cystine uptake. Moreover, L-cystine limitation was shown to prevent virulence of Neisseria gonorrhoeae; thus, its L-cystine solute receptor (Ngo0372) may be suited as target for an antimicrobial vaccine. The cystine receptor belongs to the type 2 periplasmic binding fold protein superfamily (PBP2). The PBP2 proteins are typically comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.51155e-122
NZ_CP035682.1\|WP_113604264.1\|1158265_1159690_+\|conjugal-transfer-protein-TraH	gnl\|CDD\|368759	pfam06122, TraH, Conjugative relaxosome accessory transposon protein. The TraH protein is thought to be a relaxosome accessory component, also necessary for transfer but not for H-pilus synthesis within the conjugative transposon.	3.87993e-98

>NZ_CP035682.1|WP_063691921.1|1168425_1169379_+|replication-protein
MKPFSQLLAQYQADIEVENRDKSQGLSRAESELIDASVRIKSDPPSPNDFTFMHSIMCQVGLPRSRVNGSEFERRCGAAGLYIRAGKIWDGKQFLQQPVPYGPMPRLVMAYLNTQALRSKSPEIDVGNSASAFLKQLGKESSGGKNGSYTNFRKQLLALSACSITLGFSTADKAFTYDGKPIQKFEAWIGNSDNQGALWPGVITFSHEYFTTLSEHAVPLDLRALNQLNSSALAMDIYAMLSDRLHRISGRPVVLYWRNLREQFGQEYTGDDADRNFKKVFLPALKRVLTVYPDAKVKKVTGGILMMSSPPPIPYRN
>NZ_CP035682.1|WP_154113763.1|1168193_1168439_+|DNA-binding-protein
MMLEKFMQQTLNEKDYSHLQMISVYEVTALLKISVPTLQRIRTNDPSFPKPYKIGGDKTLRYRLDQLEAWLDSRRVSNEAI
>NZ_CP035682.1|WP_154113085.1|1165301_1168061_+|conjugal-transfer-mating-pair-stabilization-protein-TraN
MSTMPPIMTRFVASLLCLTISVLPIHSYAGNQEPNIGAVGRDAKQFGLSIANGVKQNSAQVQDGKISLPVGNGQSTSININELFPGVQPGQNTAEYFPDAASPEELEQIFSDADAMDQFGNEAKANLFQDANSSNPSISGSAYQVLMDAANRSRPDFSNDPVLNLSKKTYEDMDLIAGGFGDCSAETTINQNTINAHIPEYERCQRVVDQSADCEVVHDYDASVVKHYDGPYNLKSCGDGCTELWIGKVGDDYWAGNCKIYEEYTRVQVSNPDAIVSATLEYVKWDDYMQVWVGKSGQETKVWSGPDGNFPPETAGRCELSTSWERNPNVDVTPYFKNVKDGDVVTFKIRVSVTGEGEGFGRIKLRYDPSKAITKDEWAPQSCMDSAKGVVDGFAEGEITCIDDPTDATGCTVINGVKVCESQLKPSPFPGIPKLCKKVRVKADYDFYKGQMDCWTDPQGETHCPVNTGGNLNSCQMYEDNPQCGFISSECIDGAEGSSGKCYVFKDTYDCGTDISIPTLEKETTYQCGGPIRCMGDDCLDITKSQSTDFARASALLNAAQFMTQDMSCTGQNDDDNPTGEENVMCSAFAGEAGECKIAVGGVSDCCEKPTNISFADYLNLIMAVPKLDGAVMGLSDGSAVKGAYQVLRDPVMSGWTEITQPFASYIENISGAVDSFLQPVQQFAQEAIGALKEQITKLTSEALGNASATGAAGVPAGAPESMTEQILGQQGAAMLSTVMTVYTVYVVSMVMIQMIWKCEEKEFTMNAKRALNSCTYVGSYCKSKVLGACVEERESYCCFNSPLSRIIQEQVRPQLGLNFGDARTPQCGGIPLDRIADIDWSKVNLDEWLGILQQNGKLPDPASLNLDALTGAGSDFNIDGTRQDASERIMERLEGINVDKIRNDKAREIFPDLDGNGG
>NZ_CP035682.1|WP_063691927.1|1164671_1165205_+|regulator
MSECFTSGSLSRWVKARHMALAGYITKIIILETGLTYKQVRRLYAELEYSGYDVKDKKSRTFRGGATLIHSQTSKIQASLLMQLYSNLGGEKVKRSVDISALNKAFRMYHAIRKEVPGMKGGKWEPFDITDAWCLASELRNGEAMIEHCEQCQCTFFTSINQRTCVECPFCRVSKAA
>NZ_CP035682.1|WP_001747910.1|1164057_1164669_+|hypothetical-protein
MYALEPLERDVIGSFDKFAVQLSEEKPDQDIFEFDLTLWTLLKLLSANAPSQVSNHFSLPEDLVNKLASTPDSYLSQLASGVLLSFKLETDQMEVIDALAGSYDSVICLKNVVDDFDAAYWLLLNKLASRNLDMARQNFGVSSGLASSVAASSNSQLRSLSHRVVIRFSLRFDIGVLDQFLSAALADTTPILLKKIQQSLVWR
>NZ_CP035682.1|WP_001747911.1|1163848_1164058_+|hypothetical-protein
MKHLDRETEKRLNIVVKAIGTLFILSFLTHLFISSWRDDQYGFTLLALIAGSALVSINLGRRKKGKEDY
>NZ_CP035682.1|WP_032481331.1|1163097_1163352_+|hypothetical-protein
MSRRAEYRRVIKELKVMILLGEGIWLNEKPISCGNKKFIVDGSVLNNVIREHPELNKHILIGFFSSPQRYPLLRYKDRQLTLSL
>NZ_CP035682.1|WP_001747912.1|1159693_1163098_+|conjugal-transfer-protein-TraG
MDFSIYSVGDAAFLEQIMIAVAMATGTGDFERMVSIGLLIGALIISFQSLFQGAKSWDLHQVFACWLVYAISFGAGVTVTIEDAYNGQVRVVDNVPVGPAAAGSIISSVGFGLTKLFEVAYSPVASVTESKFMDSLELLSKLRNHEMESALWTAWNDSLGGGAVDMKKSLTNYISECTAIKFSLGESNEDQINTENWRTALRFDSQIYGTRLFLSPSGPTDPSCTDGWIQLSQSFETAFNSGLSQQALGYLLSTTDALNATSDALYRLQVTNVAAGDFIKANFLQPIVQRGFAQYYSDMNDPYAQIMLTQAESQRNTQYAAEQSLFVKSIQPLMTLVEGFAYAITPIAAFVMVLGSKGLLLVGKYLQMLIWVQLWLPIMSVINLFIYIMGQQALAKYTTGNLSSFEGVAYAGAEIERWIGIGGMMAAATPVLSLMLVTGSVYAFNSIAQRVGASDTVNEKLMSPDLVDRGSVLSQQPQFNQSRIAGTMTSGGESLVDSINLGSTVSNALSSSSAATAQAQKGFASQLSNSVFSGHGSEQTYSQLQSLGQTLRASDSTQAKSILSAAQNYVTDRGINASHTDAVAGAIAMRASAGVDAGKLAAAFTGPVGAAVNAANPVSMNGSLDVSAQSQSQDSRQQLSSDIDSLSRGLGFTKDDSSALTSDLARQVSTDKGQRFTQSLGEEQRKQLMQSSSDLLSSQQTYQELSQAQQTIGTTSNNNISALADKVLNNWSAGKSLSDGVRQSSPETRDFAQRKAQHYQDLGIDSQRAIVGGQLFAMLNSNSPSEQAIAASAIAKATGGNSGIDFNQPGQSAMLVKDAPRYVSPVENSSALSAPERMSNEQKLLAESGSIGSENSVRDAHEKGIQQLEQSYGTSRNEYLNDRLPALRAQIMASDLAPSTSSALFAGAEGAGRFVQQVVGGAGAAKEGFAESFGQSMSKLAQMTPEQRDQFIEDTKKGDDYVKQEYGLGGFLAVGAANLGRDIIGVGISGFEAGKEWLTGKSDLSEAAQGMSVRERGMFFASALASASEAGAGKAAEFVQQYGDEFRQIAMDTARYDYGLNSQAGAELFAASLMGGDSSRSGELRENLREEVGDNVLADKMAAIIESSAGAGKDQAGGYLAPVSRYLSVAKGGR
>NZ_CP035682.1|WP_113604264.1|1158265_1159690_+|conjugal-transfer-protein-TraH
MRVSPPYIRTLSASCLIIFSVVATHASAEGLQSEMDRLFNEMSNTTRPGIHETQRRGVIAGGRVTTKARIFDENLVSFVPPSWKAGCGGVDLFGGSLSFVNADQIVQLMRAVAANAKGYAFQLALDNVFPDGAKWIENFQKKVQALNQHLGNSCQLAQGIVNDSLSAFDTKLKNDTRTKASTKGLFEDMFSATQETDGQTAIKTLKDNSPQAYQEMIGNIVWKQLKKNSVSSWFQYGDNSLLEAMMSITGAVVIGDLINDPNLAGANNSTNPIVTLPGNRITLGDLISGGSVKVYSCDSDTVNCISAGSELKSVQLRGIGNQMSDLLLGSDSSPGLIYKYANNVGALSSAEIAFVSNLPSSFGSLFRNLAAVSSDTAEQFAQQAQTIIALDITYRFIEEIYRATTIALANSDNAYQQKAVDVLDASRAVVRQEYDQLIVRHGKLSDLMGYYNSLLDVTKKQRLLLAAQASGKKE
>NZ_CP035682.1|WP_154113084.1|1157164_1158022_-|hypothetical-protein
MKMNMSTSVSSATALFAAIMLAGCATTPKSYNPEMSRALNLARAGGIYDQDLKDSEDGRNSYKQSLLMKALNVTSLASSLDAPLRGLNGQQTLMFNTASILTSPDNPSARPSLMAWMPASMAKSSEDAYSNYINLIDNAVAVAAKSMNLDLTKIVESTAPKIDGNPLIMWAVTAPQFGCDGSNCVIAYNVIMPNPWKTPAFVGSGNIDSFNLAANNTTKYSRLIFSQVSDVKSFPMDDFYKSTSRALPEWAVMYFPPNSVFQDGKALPYPVIYEKGQQLLFRKAQ
>NZ_CP035682.1|WP_032481337.1|1169735_1170104_+|helix-turn-helix-domain-containing-protein
MTVDVNETLNALRSEIAEMKQLLAQFVENTVSDGSKSNLPPSDKEYFTVDEAAAYVGAKRSYIYRLTHEKRLSFTKPGGNRVLIKRSDLQAWLEKNRVKSADELHQDVANYITSFPRGRKAS
>NZ_CP035682.1|WP_032481345.1|1170100_1171324_-|site-specific-integrase
MKVSVNKRNPNSKGLQQLRLVYYYGVVEGEDGKKRPKRDYEPLELYVYQNPKTQAERQHNKEMLRQAEAARSARLVESHANKFQLEDRVKLASSFYEYYDRLTSTKEPGSTSNYSIWVSAGKHLRSYHGRAELTFEEIDKKFLEGFRKYLLEEPLTKSKSKLAKNTASSYFNKVRAALNEAYREGIIRDNPVQRVKSVKAENTKRTYLTLDEVRAMTKAECRYDVLKRAFLFSCTTGLRWSDINKLTWSEIEEFEPGHYRIIFDQQKLKNGGNSLVYLDLPDSAVTLLNIQNREGPDDRVFVGLKYNSYMNVALLQWAMRAGITKHVTFHAGRHTFAVAQLNRGVDIYSLSRLLGHSELRTTEIYADILESRRVTAMRGFPDIFEDKVKESGACCPHCGKSVMNKTL
>NZ_CP035682.1|WP_022577335.1|1171526_1172888_-|tRNA-uridine-5-carboxymethylaminomethyl(34)-synthesis-GTPase-MnmE
MTTDTIVAQATAPGRGGVGIIRVSGPLAAHVAQTVTGRTLRPRYAEYLPFTDENGQQLDQGIALFFPNPHSFTGEDVLELQGHGGPVVMDMLIRRILQIHGVRPARPGEFSERAFLNDKMDLTQAEAIADLIDASSEQAAKSALQSLQGEFSKRIHTLVESLIHLRIYVEAAIDFPEEEIDFLADGKVSADLQTIIDNLAAVRREANQGAIMREGMKVVIAGRPNAGKSSLLNALSGKESAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLRDASDAVEKIGIERAWEEIRQADRVLFMVDGTTTEATDPQEIWPDFVDKLPENIGITVIRNKADQTGEPLGICHVNQPTLIRLSAKTGQGVDALRQHLKECMGFAGNQEGGFMARRRHLDALERAAEHLDIGQQQLEGYMAGEILAEELRIAQQHLNEITGEFSSDDLLGRIFSSFCIGK
>NZ_CP035682.1|WP_000378226.1|1172980_1174606_-|membrane-protein-insertase-YidC
MDSQRNILLIALALVSFLLFQQWQVAKNPAPQATQQAQSTGAAPAPSFSDELDPTPAQNAAAQAKTITVTSDVLTLSIDTLGGDIVSAKLNQYSEELDSSEPFVLLQNTQGHQFIAQSGLVGPQGIDVTSNNRPAYQVNADSFSLAEGQDELRIPMTYQANGIDYTKTFILKRGSYAVDVVFDVANNSGNAATLGMYAHLRQNLLDSGGNLAMPTYRGGAYSTSDVRYKKYSFDDMKDRNLSVPNDVTVNWVAMIQHYFASAWIPRDEPQAQLYSRVINNLGDMGIRTPNKTIANGDKAEFEATLWVGPKLQDQMAAVAPNLDLVVDYGWLWFIAKPLHWLLSFIQSFVGNWGVAIICLTFIVRGAMYPLTKAQYTSMAKMRMLQPKLQAMRERIGDDRQRMSQEMMELYKKEKVNPLGGCLPILLQMPIFIALYWALMESVELRHSPFFGWIHDLSAQDPYYILPLLMGASMFVIQKMSPTTITDPMQQKIMTFMPVMFTFFFLWFPSGLVLYWLVSNIVTLIQQTLIYKALEKKGLHSK
>NZ_CP035682.1|WP_032469211.1|1174608_1174866_-|membrane-protein-insertion-efficiency-factor-YidD
MATPLSPFSWLAIGIVKLYQWFISPLIGPRCRFTPTCSTYAIEALRAHGFIKGCWLSTKRLLKCHPLNEGGFDPVPPDQKQDRDK
>NZ_CP035682.1|WP_005510105.1|1174832_1175189_-|ribonuclease-P-protein-component
MSTYAFNRELRLLTPEHYQKVFQQAHSAGSPHLTIIARANNLSHPRLGLAVPKKQIKTAVGRNRFKRLCRESFRLHQNQLAHKDFVVIAKKSAQDLSNEELFNLLGKLWQRLSRPSRG
>NZ_CP035682.1|WP_000044781.1|1175201_1175339_-|50S-ribosomal-protein-L34
MSKRTFQPSVLKRKRTHGFRARMATANGRKVLNARRAKGRKRLSK
>NZ_CP035682.1|WP_000561079.1|1175580_1176318_-|amino-acid-ABC-transporter-ATP-binding-protein
MIALNNIHKRFGASEVLKGIDLEIQRGEIVVIIGSSGTGKSTLLRCVNFLEQADQGTISIDELTVDTQRHTKADVLALRRKTGFVFQNYALFAHLTARENIAEALITVRGWKKDQAHQRAQQILDDIGLGEKGDSYPAALSGGQQQRVGIGRAMALQPELLLFDEPTSALDPEWVGEVLALMKKLATQHQTMLVVTHEMQFAKEVADRVIFMAEGNIVEQGSPQDIFDHPQDPRLRKFLNQVGIR
>NZ_CP035682.1|WP_000505209.1|1176314_1176986_-|amino-acid-ABC-transporter-permease
MGFDFHYMLELLPILLKYLGTTLEMASWGLVFALILALVLANIRVFKVPVLDPLSQLYISFFRGTPLLVQLFLLYYGLPQIFPLLVGLDAFSAAVIGLTLHFAAYMAESIRAAIIGIDRSQMEASLSVGMTTSQAMRRIILPQAARVALPSLMNYFIDMIKSTSLAFTLGVAEIMAKAQMEASSSFRFFEAFLAVALIYWVVVLVLTRLQSWAEQKLNKAYAR
>NZ_CP035682.1|WP_000683491.1|1177063_1177810_-|amino-acid-ABC-transporter-substrate-binding-protein
MKHWFNIALAALALSSATVQAATDVKVGMSGRYFPFTFVKKDELQGFEIDVWNEIGKRNDYKVEFVTANFSGLFGLLETGRIDTISNQITITDARKAKYLFSDPYVIDGAQITVRKGNDSIKGIEDLAGKTVAVNLGSNFEQLLRSHDKDSKINIKTYDTGIEHDVALGRADAFVMDRLSALELIEKTGLPLQLAGSPFETIENAWPFVNNEKGQQLQGEVNKALAAMRADGTLSKIAIKWFGTDISQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

424227 : 431232

Anguillid_herpesvirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001162852.1\|424227_424656_-	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.0e-20	38.4
WP_154112863.1\|424733_426023_-	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	3.8e-34	34.0
WP_000872176.1\|426180_426375_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_001124187.1\|426423_426762_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_154112864.1\|426775_428626_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	9.1e-106	41.1
WP_001105753.1\|428649_429165_-	co-chaperone HscB	NA	NA	NA	NA
WP_000301571.1\|429213_429537_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.0e-25	50.5
WP_000331703.1\|429597_429981_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.4e-53	78.2
WP_000775247.1\|430017_431232_-	IscS subfamily cysteine desulfurase	A0A0H3TPH2	Faustovirus	3.0e-33	31.1

DBSCAN-SWA_2

665129 : 672441

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154112920.1\|665129_666017_+	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	2.4e-56	41.1
WP_154112921.1\|666346_668935_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	3.8e-33	26.3
WP_000116730.1\|669011_670022_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.0e-34	34.2
WP_000189384.1\|670095_671031_-	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	4.6e-05	34.7
WP_022577561.1\|671030_671657_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	8.0e-38	53.3
WP_154112922.1\|671649_672441_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.9e-69	53.3

DBSCAN-SWA_3

1845860 : 1852341

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000210577.1\|1845860_1846994_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	8.1e-65	39.6
WP_154113771.1\|1847005_1848256_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	3.9e-100	48.4
WP_000543542.1\|1848357_1848807_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_154113304.1\|1848819_1849923_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	5.9e-44	33.1
WP_154113305.1\|1849927_1850581_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.8e-33	38.4
WP_148555819.1\|1850620_1851730_+	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	7.4e-63	39.3
WP_000864130.1\|1851870_1852341_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.8e-34	48.7

DBSCAN-SWA_4

2600267 : 2606635

Mycobacterium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154113551.1\|2600267_2601530_+	SufS family cysteine desulfurase	A0A2K9L2Y3	Tupanvirus	4.8e-66	33.6
WP_154113552.1\|2601534_2601942_+	cysteine desulfuration protein SufE	NA	NA	NA	NA
WP_000705933.1\|2602074_2602293_+	glutaredoxin-like protein NrdH	V5UN81	Mycobacterium_phage	7.3e-15	57.4
WP_154113553.1\|2602289_2602697_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	R4JF54	Bacillus_phage	9.2e-11	35.0
WP_154113781.1\|2602745_2604884_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	A8E2R1	Enterococcus_phage	2.7e-202	49.7
WP_000879043.1\|2604893_2605865_+	class 1b ribonucleoside-diphosphate reductase subunit beta	R4TBI6	Mycobacterium_phage	4.3e-131	71.7
WP_154113554.1\|2605933_2606635_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	4.9e-36	40.1

DBSCAN-SWA_5

2703421 : 2717605

Vibrio_phage(57.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154113595.1\|2703421_2703754_+	hypothetical protein	E3U9J1	Vibrio_phage	1.6e-05	71.4
WP_000201563.1\|2704509_2704689_-	hypothetical protein	Q9MBU8	Vibrio_virus	6.4e-25	100.0
WP_019830347.1\|2704820_2705900_+	hypothetical protein	A0A023W5Z8	Vibrio_virus	2.2e-213	100.0
WP_001888513.1\|2705877_2706258_+	hypothetical protein	A0A0N9HJ67	Vibrio_phage	4.0e-69	100.0
WP_000493022.1\|2706393_2706642_+	colonization factor	A0A0N7F140	Vibrio_phage	8.8e-33	100.0
WP_080480141.1\|2706652_2707936_+	hypothetical protein	A0A142I701	Vibrio_phage	2.7e-218	98.4
WP_080112448.1\|2707932_2708226_+	accessory cholera enterotoxin	A0A0F6YNQ7	Vibrio_phage	4.1e-45	99.0
WP_050926705.1\|2708222_2709422_+	zonula occludens toxin ZOT	A0A023W604	Vibrio_virus	5.3e-240	100.0
WP_001888508.1\|2709514_2710291_+	cholera enterotoxin catalytic subunit CtxA	A0A023W6A1	Vibrio_virus	7.8e-152	100.0
WP_000593519.1\|2710287_2710662_+	cholera enterotoxin binding subunit CtxB	A0A142I6Y1	Vibrio_phage	5.9e-65	100.0
WP_000201563.1\|2711452_2711632_-	hypothetical protein	Q9MBU8	Vibrio_virus	6.4e-25	100.0
WP_019830347.1\|2711763_2712843_+	hypothetical protein	A0A023W5Z8	Vibrio_virus	2.2e-213	100.0
WP_001888513.1\|2712820_2713201_+	hypothetical protein	A0A0N9HJ67	Vibrio_phage	4.0e-69	100.0
WP_000493022.1\|2713336_2713585_+	colonization factor	A0A0N7F140	Vibrio_phage	8.8e-33	100.0
WP_080480141.1\|2713595_2714879_+	hypothetical protein	A0A142I701	Vibrio_phage	2.7e-218	98.4
WP_080112448.1\|2714875_2715169_+	accessory cholera enterotoxin	A0A0F6YNQ7	Vibrio_phage	4.1e-45	99.0
WP_050926705.1\|2715165_2716365_+	zonula occludens toxin ZOT	A0A023W604	Vibrio_virus	5.3e-240	100.0
WP_001888508.1\|2716457_2717234_+	cholera enterotoxin catalytic subunit CtxA	A0A023W6A1	Vibrio_virus	7.8e-152	100.0
WP_000593519.1\|2717230_2717605_+	cholera enterotoxin binding subunit CtxB	A0A142I6Y1	Vibrio_phage	5.9e-65	100.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP035683

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP035682

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection