CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040433	Stenotrophomonas maltophilia strain SKK55 chromosome, complete genome	2 crisprs	csa3,DEDDh,WYL,cas3,Cas9_archaeal,DinG	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040433_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040433_1

490788-490862

Orphan

Consensus_repeat	Method
TTCGTATTTGCCGGCCAGCGTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040433_1

>merge|NZ_CP040433|1|490788-490862|CRISPRCasFinder
TTCGTATTTGCCGGCCAGCGTCCGGCACTACCCGACCGAAACATTAGGGATTTTCGTATTTGCCGGCCAGCGGCC

>NZ_CP040433|1|1|490788-490862|CRISPRCasFinder
TTCGTATTTGCCGGCCAGCGTCC	GGCACTACCCGACCGAAACATTAGGGATT
TTCGTATTTGCCGGCCAGCGGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040433.1\|WP_061478627.1\|491901_492312_+\|DoxX-family-protein	unknown	unknown	gnl\|CDD\|225168
NZ_CP040433.1\|WP_154350169.1\|496022_496298_-\|DUF4031-domain-containing-protein	unknown	unknown	gnl\|CDD\|379076
NZ_CP040433.1\|WP_134969289.1\|496311_496806_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_061478652.1\|483083_483428_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_134969290.1\|495386_495929_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_049411437.1\|483467_484082_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_005407915.1\|497845_498700_-\|flagellar-motor-stator-protein-MotA	unknown	unknown	gnl\|CDD\|181655
NZ_CP040433.1\|WP_154350166.1\|484391_485321_+\|DUF2236-domain-containing-protein	unknown	unknown	gnl\|CDD\|226188
NZ_CP040433.1\|WP_154350167.1\|490923_491805_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP040433.1\|WP_154350170.1\|496903_497842_-\|flagellar-motor-protein-MotB	unknown	unknown	gnl\|CDD\|236365
NZ_CP040433.1\|WP_154351691.1\|487717_490780_+\|EAL-domain-containing-protein	unknown	unknown	gnl\|CDD\|238923
NZ_CP040433.1\|WP_154350168.1\|492343_493132_+\|dioxygenase	unknown	unknown	gnl\|CDD\|153375
NZ_CP040433.1\|WP_061478619.1\|477193_478849_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|367655
NZ_CP040433.1\|WP_061478621.1\|481029_482289_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|225814
NZ_CP040433.1\|WP_005415112.1\|495047_495296_-\|DUF3297-family-protein	unknown	unknown	gnl\|CDD\|371696
NZ_CP040433.1\|WP_061478620.1\|479215_480865_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349910
NZ_CP040433.1\|WP_069140060.1\|493249_494899_+\|Na+/H+-antiporter	unknown	unknown	gnl\|CDD\|129911
NZ_CP040433.1\|WP_005415096.1\|476499_477177_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_154350165.1\|482278_483049_+\|response-regulator	unknown	unknown	gnl\|CDD\|225818
NZ_CP040433.1\|WP_061478624.1\|485429_487541_-\|M13-family-metallopeptidase	unknown	unknown	gnl\|CDD\|341056

Protein	Function_ID	Function_description	E-value
NZ_CP040433.1\|WP_061478627.1\|491901_492312_+\|DoxX-family-protein	gnl\|CDD\|225168	COG2259, COG2259, Predicted membrane protein [Function unknown].	5.98672e-09
NZ_CP040433.1\|WP_154350169.1\|496022_496298_-\|DUF4031-domain-containing-protein	gnl\|CDD\|379076	pfam13223, DUF4031, Protein of unknown function (DUF4031). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria and viruses. Proteins in this family are typically between 91 and 130 amino acids in length. There is a conserved HYD sequence motif.	5.98625e-31
NZ_CP040433.1\|WP_005407915.1\|497845_498700_-\|flagellar-motor-stator-protein-MotA	gnl\|CDD\|181655	PRK09110, PRK09110, flagellar motor stator protein MotA.	2.19995e-164
NZ_CP040433.1\|WP_154350166.1\|484391_485321_+\|DUF2236-domain-containing-protein	gnl\|CDD\|226188	COG3662, COG3662, Uncharacterized protein conserved in bacteria [Function unknown].	1.36874e-57
NZ_CP040433.1\|WP_154350167.1\|490923_491805_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.93238e-93
NZ_CP040433.1\|WP_154350170.1\|496903_497842_-\|flagellar-motor-protein-MotB	gnl\|CDD\|236365	PRK09041, motB, motility protein MotB.	7.42474e-160
NZ_CP040433.1\|WP_154351691.1\|487717_490780_+\|EAL-domain-containing-protein	gnl\|CDD\|238923	cd01948, EAL, EAL domain. This domain is found in diverse bacterial signaling proteins. It is called EAL after its conserved residues and is also known as domain of unknown function 2 (DUF2). The EAL domain has been shown to stimulate degradation of a second messenger, cyclic di-GMP, and is a good candidate for a diguanylate phosphodiesterase function. Together with the GGDEF domain, EAL might be involved in regulating cell surface adhesiveness in bacteria.	3.45116e-94
NZ_CP040433.1\|WP_154350168.1\|492343_493132_+\|dioxygenase	gnl\|CDD\|153375	cd07363, 45_DOPA_Dioxygenase, The Class III extradiol dioxygenase, 4,5-DOPA Dioxygenase, catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine. This subfamily is composed of plant 4,5-DOPA Dioxygenase, the uncharacterized Escherichia coli protein Jw3007, and similar proteins. 4,5-DOPA Dioxygenase catalyzes the incorporation of both atoms of molecular oxygen into 4,5-dihydroxy-phenylalanine (4,5-DOPA). The reaction results in the opening of the cyclic ring between carbons 4 and 5 and producing an unstable seco-DOPA that rearranges to betalamic acid. 4,5-DOPA Dioxygenase is a key enzyme in the biosynthetic pathway of the plant pigment betalain. Homologs of DODA are present not only in betalain-producing plants but also in bacteria and archaea. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon.	7.05361e-122
NZ_CP040433.1\|WP_061478619.1\|477193_478849_+\|hypothetical-protein	gnl\|CDD\|367655	pfam03783, CsgG, Curli production assembly/transport component CsgG. CsgG is an outer membrane-located lipoprotein that is highly resistant to protease digestion. During curli assembly, an adhesive surface fibre, CsgG is required to maintain the stability of CsgA and CsgB.	6.18639e-07
NZ_CP040433.1\|WP_061478621.1\|481029_482289_+\|sensor-histidine-kinase	gnl\|CDD\|225814	COG3275, LytS, Putative regulator of cell autolysis [Signal transduction mechanisms].	2.67862e-43
NZ_CP040433.1\|WP_005415112.1\|495047_495296_-\|DUF3297-family-protein	gnl\|CDD\|371696	pfam11730, DUF3297, Protein of unknown function (DUF3297). This family is expressed in Proteobacteria and Actinobacteria. The function is not known.	2.17409e-44
NZ_CP040433.1\|WP_061478620.1\|479215_480865_+\|M28-family-peptidase	gnl\|CDD\|349910	cd05660, M28_like_PA, M28 Zn-peptidase containing a protease-associated (PA) domain insert. Peptidase family M28 (also called aminopeptidase Y family), uncharacterized subfamily. The M28 family contains aminopeptidases as well as carboxypeptidases. They have co-catalytic zinc ions; each zinc ion is tetrahedrally co-ordinated, with three amino acid ligands plus activated water; one aspartate residue binds both metal ions. This subfamily is composed of uncharacterized proteins containing a protease-associated (PA) domain insert which may participate in substrate binding and/or promote conformational changes, influencing the stability and accessibility of the site to substrate.	4.13251e-105
NZ_CP040433.1\|WP_061478624.1\|485429_487541_-\|M13-family-metallopeptidase	gnl\|CDD\|341056	cd08662, M13, Peptidase family M13 includes neprilysin and endothelin-converting enzyme I. The M13 family of metallopeptidases includes neprilysin (neutral endopeptidase, NEP, enkephalinase, CD10, CALLA, EC 3.4.24.11), endothelin-converting enzyme I (ECE-1, EC 3.4.24.71), erythrocyte surface antigen KELL (ECE-3), phosphate-regulating gene on the X chromosome (PHEX), soluble secreted endopeptidase (SEP), and damage-induced neuronal endopeptidase (DINE)/X-converting enzyme (XCE). Proteins in this family fulfill a broad range of physiological roles due to the greater variation in the active site's S2' subsite allowing substrate specificity. NEP is expressed in a variety of tissues including kidney and brain, and is involved in many physiological and pathological processes, including blood pressure and inflammatory response. It degrades a wide array of substrates such as substance P, enkephalins, cholecystokinin, neurotensin and somatostatin. It is an important enzyme in the regulation of amyloid-beta (Abeta) protein that forms amyloid plaques that are associated with Alzeimers disease (AD). ECE-1 catalyzes the final rate-limiting step in the biosynthesis of endothelins via post-translational conversion of the biologically inactive big endothelins. Like NEP, it also hydrolyzes bradykinin, substance P, neurotensin, and Abeta. Endothelin-1 overproduction has been implicated in various diseases including stroke, asthma, hypertension, and cardiac and renal failure. Kell is a homolog of NEP and constitutes a major antigen on human erythrocytes; it preferentially cleaves big endothelin-3 to produce bioactive endothelin-3, but is also known to cleave substance P and neurokinin A. PHEX forms a complex interaction with fibroblast growth factor 23 (FGF23) and matrix extracellular phosphoglycoprotein, causing bone mineralization. A loss-of-function mutation in PHEX disrupts this interaction leading to hypophosphatemic rickets; X-linked hypophosphatemic (XLH) rickets is the most common form of metabolic rickets. ECEL1 is a brain metalloprotease which plays a critical role in the nervous regulation of the respiratory system, while DINE is abundantly expressed in the hypothalamus and its expression responds to nerve injury. A majority of these M13 proteases are prime therapeutic targets for selective inhibition.	0
NZ_CP040433.1\|WP_154350165.1\|482278_483049_+\|response-regulator	gnl\|CDD\|225818	COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms].	4.02298e-51
NZ_CP040433.1\|WP_069140060.1\|493249_494899_+\|Na+/H+-antiporter	gnl\|CDD\|129911	TIGR00831, Putative_Na+/H+_exchanger_Rv2287/MT2345/Mb2309., Na+/H+ antiporter, bacterial form. The Monovalent Cation:Proton Antiporter-1 (CPA1) Family (TC 2.A.36) The CPA1 family is a large family of proteins derived from Gram-positive and Gram-negative bacteria, blue green bacteria, yeast, plants and animals. Transporters from eukaryotes have been functionally characterized, and all of these catalyze Na+:H+ exchange. Their primary physiological functions may be in (1) cytoplasmic pH regulation, extruding the H+ generated during metabolism, and (2) salt tolerance (in plants), due to Na+ uptake into vacuoles. This model is specific for the bacterial members of this family. [Transport and binding proteins, Cations and iron carrying compounds].	9.32252e-101

>NZ_CP040433.1|WP_154351691.1|487717_490780_+|EAL-domain-containing-protein
MRGRVRRQEWRPPAVEVGDVEDSFAHEASRLHKEHPPMPALKRALARPLRAITWGGVLLGVLLVTGLTLMLVNDYHRRLEAAQRQSRALAVGSERLLALELRNLERAMSGIAADAAELFRSVPSQAPALMDASIGGVLGRHAELHSIAVLDGHGRPLTAGEGDLQLPLWTDPQRRGQGSALYIGPPQRASDGGWVVPLALPMAGERWLLARLRCGELQRIVGGLDVGPNGLVSISDAEGYMLARVPDPHGTVGRRYGLPRRDLLGTQAVVELGSVPGVVDGVPRIMTISTLEHSPLAVQVGLADEDVLAPWWPYLQASVAIVLAYIAVLLVLLYAVRRSTRSQQAMAEELKTGHAELRLAHQVGRVCTWYVDEDAALLRWSPLAREIFGVQTDALPVADFFARVHRDDAARLQHAFDQAFAGGAVLDQVFRLVLPGGEVRWVGARGQRVEVADSERRMIGALTDLSERYQAREQVSEVERRFRLLFDRNPAPFWVFDPDTLRFIEVNDAAVRQYGYSRDEFLAMSILDIRPREGWDEVRGAIQRAQVGDPPDATVRLHRRKDGSVFEVRAHLSKLDFDGQPACLVLAEDVSERLAYERDLAYRARHNPATGLLNVRALTEQLDEQQQGYTIAFVQLRGLQLVADTLGREIGDAVLQSMATRLGGLGARCGTLAFQPAEDFVFAIGAEHDTQRVLDDLLQIVSAPMRGKDSLHQFEPRIGVAVHTAGDGHSAEQVIGMAAQAAHAARAEGNVVVWFDAAVTTRLADRLRLAGRIHAAIDNEFQLYFQPIRHASDGSPAALEALLRWPQADGSFIPPNEFIQLCEDTGLILALGRWVIRAAAKAQRRLVEAGWGELPIAVNVSAVQFFNSDLVAEFTRVQQEFGLARGALHVELTESSLMRKPAQAMQTMQRLHEQGISVSLDDFGTGYSSMSYLQHLPLDILKIDRSFVADVETNPRNASICRALLSLGHSMGLTIIAEGVETPGQLDWLAAHGCDQVQGYLLGRPAPLERIIDALDEVPA
>NZ_CP040433.1|WP_061478624.1|485429_487541_-|M13-family-metallopeptidase
MSKLRRPTLALAIVASLSLAACDRPAEPAAGATAPADAAPAAAKPMLGSFGFDASGMDRSIAAGDDFFGFANGTWVKNTEIPADRSRFGSFNVIAEKTLADTRAILEGAAGNTKASGDDKLIGDYYAAYMDEAGIEQRGVAPVEPQLKAIDAIADKAGLARALGGDLRADVDLLNATNFYTDRLFGLWVSVDLLQPDRTAPYLVQGGLGMPDRDFYLGGGRMAELRKQYQAYIAQMLQLAGVADPAGKAQRILALETKIAQAHATQEETNDVTKGANPWTQADFNAKAPGMDWNAFLDAAALGNQQDFIVWQPKAVAGLSRLVATEPLEVWKDYLAFHALDRAAAYLPKKFADARFAFHGTALSGTPQQSDRWKRAVDDANHAVGEAIGKRYVEKHFDAKTKERADEMAKNIIAAFAKRIDALSWMSPQTKASAKAKVAGLTVGMGYPEKWRDYTGLEIRRDDPLGNAQRAELFEYQRNIAKLGKPVDHSEWAMLPQTINAMNVPLENRLVFPAAILQPPFFDGAADDAVNYGAIGAVIGHEISHGFDNAGALFDETGKLHNWWTAEDLKQFNAAGDALAAQFSSYEPFPGVHVNGKLTLGENIADVAGLGTAYDAYQLSLQGKPGQTLEGFTPDQRFFLGFAQAWRSKSREQALRNSLLTDVHAPGQFRALTVRNIDAWYPAFEVKEGQKLYLAPDKRVKVW
>NZ_CP040433.1|WP_154350166.1|484391_485321_+|DUF2236-domain-containing-protein
MPALLQRLSRPVTAPIRRWVLDAFPRGQSGIDYDHPQGDPGWFGPDSVTWRLHAEFPSMLAGGLCALMLQTLHPRALAGVYDHSNFRQDLVGRLRRTTAFVAGTSYAPSGEVEALVARVRRIHAQIRGQTAQGEPYAADDPQLLTWVHVTEAFGFLQGFRRYGREVPAHIADRYYDEYRCVAEALGAMDVPRSEAEVAAYFCARQPELRVDERSREVLEVLSGVRLPVPVPGLSREVFLGAGAALLPDWAEGMLARSGRQRAQAAASAKLMQGMAPLFRRALPDGLASRACARMGAPVEILREWPAVAW
>NZ_CP040433.1|WP_049411437.1|483467_484082_-|hypothetical-protein
MIALFKGLGILLRDNELYSSPFDKQVAHWRNLSEQQIRDEVAVLAQAKCQWLIASIVGWQAASLLILGLIANYLWRDDFHITFTRVVIVFGSWVSILFVIWFMANMFDQQAGFERWMKAFNSRARISSKADSVEHVAEALDLAEHYPEVLDYKQAVTARRELRHEDIRIMTEIGRMKQHSELVGRLNHVGETEHHHDLTLQPAY
>NZ_CP040433.1|WP_061478652.1|483083_483428_+|hypothetical-protein
MSRLLIACVAVLALAGCEKSRNTSITRTHANGVDTLYSKSTVVDGEARFQCIASSSGHCHYLVLDPACSTDAACTTPPLRRFAVAAGKTEAMRGLPDGFRQCVSQDPMEHCHRE
>NZ_CP040433.1|WP_154350165.1|482278_483049_+|response-regulator
MPLEALIAEDEELLRQSLVEQLRRLWPDLKLVAECEDGASALEQLAEKQPDIAFLDIRMPGISGIEVARSLSELSPRTQVVFVTAYDQYAIDAFEQGAMDYLLKPVSDERLLATRERILSRLPSTRQDDAVLERLLQRLGPSQGAAERPPLAWITASNGRETQLIMLEDVAYFRADNKYTTVVTASGESLLRTPLRELLEVLDPQHFRQIHRSTIVNMKAVAAVSRDDTGRGVLRLRGRTETLVVSQPFMSLFRGM
>NZ_CP040433.1|WP_061478621.1|481029_482289_+|sensor-histidine-kinase
MFASLSLLFRHLLAWAAALFVAGMVWSGIFSGMNDGPGWIFGLLAMFLIISALGSAITHIRRVWLVAGRLDATTLSGRQRRQIELPMDAGHAFSVVEAAISELPRVEDVESSAGSLQVRAYVRRVDLWNGRQPSRWNLPARLAIKRNSVLATVTPGQGTSTVTLLFEPDAGWWADLLALDEGSNFENAEAVTRAISRRVADQRRDEQAAAEQTQVEKELSVARLNLLHAQVEPHFLYNTLANAQVLTRTDPARAEQMLGHLIQYLRSSLPQVDESVSTLGVELERTRAYLEILRIRMGARLAVEVQVPNELHGVHLPAMALQTLVENAIKHGLEPKPGGGTIWILARGFDDHVTVTVADDGLGFGQGTSGTGIGLKNLRERLRLTCGEQAGVAIVANFPSGVAATMTLPQSHKERSHAA
>NZ_CP040433.1|WP_061478620.1|479215_480865_+|M28-family-peptidase
MKRVVLGVLALSVSSALMAATPKFDGARISADVKELASDAYEGRSPATAGEEKTIAYLSKQFADAGLQPGGDLKDGKRLWTQAVPLRKGDIVGTPQLALHQGGKTVALEQGKQIAVRAAMNGASNVDISKAPLVFLGYGVKAPERNWDDFKGVDLKGKIAVVLINDPDFETGQGDFDGKGMTYYGRWTYKYEEGARQGALGVLIVHETAPASYGWATVAGSNTNTMFDVVRDNPAESHPLLEGWIQRDLAVELFRSAGQDFEALKKKAQQRDFTPVPLTGASLDAKYAVKTEVITSHNVAARLEGSRHPDETIIYSAHWDHIGVGEPDARGDRIFNGALDNASGTASLIELARGFAKEKRPQRSLLFLAVTAEEKGLLGSEYYATHPLYPLEKTVAVINMDGMAPFGPSRDFGIYGAARFELLDQLKDVAKGWDIRYTPDPKPEAGLFFRSDHFPFAKRGVPALSWSAGQDWVDGGVAAGKKASEDYTAKRYHQQGDEWQPDWVFAGAARDLEVLYTLGNQLANSRAWPNWSKDESFRAVRDASADQRK
>NZ_CP040433.1|WP_061478619.1|477193_478849_+|hypothetical-protein
MRTTSRLIGLGLAAVLLAACGKQDTPAADAPTPAKDKATSALASNAPVEAAPLRGTPDFGGTTQVAREADGIGSTPELAVLAALQSAVAQVNGVRVASQMQSLRAGLHVDVDDEHVGDIRADAFTQQMIAGSQGAVLGYEILSQDEVRQLDEETIARVRASDEGWSFKGSASASASGEATAKGGGASASVKERYDEKVSVDAKRGASSFDSDVTHRSMRSYWKVRVRAQIAQYRAPDEQGKPKIVVALPRTKAGSYAVGDGRVSADEVADAIRARLSDTLTQTQRFIVLDREFGDELQAEIDHINSGNVRLQDTARVGQQLATDLILIPTIERFEYPRSVRNLRMSDRQVTSYSGGGRITLRLVNATTGQVVMSDSFDHQLASTGPSTLPRVVNGRNMAAAMMESLSGQIGTSIVTTLFPVSVVSVDGDQVVLSQGGDTVQAGQRWQAVRLGEELKDPQTGRSLGRSEHPCCTIRIDRVAAQTSYGTIEDGVDAMRGGFRPGQIELRQKLGSKPAAAAAGATASAAPATAARPVAKPKPKPAAAPAEDPNW
>NZ_CP040433.1|WP_005415096.1|476499_477177_+|hypothetical-protein
MIRNTALVLAIAAATLSMPAHAGLGKLKDLAGAATGTSSSSASSAAAPDEAAQEALVRRFVSSQSHSLQAQTSFARAFGLAEQVQLLEAERQALSSGSVSVDAMKKSVSVSEAAQAAIDERQAAQPELNAESKQHYAEGLVSLLASAAEAQKLGGEASNFTAGMKNLGATQMATVGRKLAAGAWVAKESPGFIQGLYGSTKSAVTFAKKSKVKVPSNADSMLDSI
>NZ_CP040433.1|WP_154350167.1|490923_491805_-|LysR-family-transcriptional-regulator
MDTLEAMRVFVAVVERNGFSAAAHALDMSTAGVTRQVAALEKRLSTRLLHRTTRRVSPTSTGAAYYAQCVRLLAEFDALEASIGAQALEPSGTLRINAPVSWGIARLGPLLASYRERFPQVELDLALSDRLVDMVEEGYDVAIRITREPGPALIARRLGESRVSLCAAPSYLAARGTPQTPQDLQNHACLSYSYWAAGDHWPLQGPGGEVKVAVNSLLHANNGDVLREAAIAGMGVILQPDFLLEDALADGRLVRVLPEWEASPIGIFAVYASRSHLAPKVRSFIDHLVEAGV
>NZ_CP040433.1|WP_061478627.1|491901_492312_+|DoxX-family-protein
MHTTTAPVSPLAPYGATLLRLALGVLFLVHALIKLLVFTPAGTAAFFESLGLPGVLAYLTIGAELVITTALLLGIYARWVGLAGVPLLLGTIVTVHGANGFGFANAGGGWEYPAFWALALVVLFLVGDGKWTLRSR
>NZ_CP040433.1|WP_154350168.1|492343_493132_+|dioxygenase
MSRLPSLYISHGSPMTALHPGQVGVRLAELAQDLPTPRAIVMASAHWLGRQPQVGAHPQPPTIHDFGGFPRALFELQYPAPGDPALAEEVARRIAAAGLPVAIDPQRGLDHGAWVPLRLLRPQADIPVVPLSIQPLLGPGHQFALGRALAPLREQGVLLVGSGSITHNLHDWGDYQDGKEAPYVRPFIEWVEQRLAADDRQALFDYRRQAPFAERAHPTDEHLLPLFFAMGAAGEDSFGARRIDAGIDAGFLAMDLYRFDGA
>NZ_CP040433.1|WP_069140060.1|493249_494899_+|Na+/H+-antiporter
MHTIEVVLAMLVAVVASGYLVRVLPFSLPLPLVQIGLGAVIAGVFNRGHALEPEVFFLLFLPPLLFLDGWRIPKQGLFRDKGAILELAFGLVVFTVIGAGLLIHWMIPVMPLAVCFALAAIVSPTDPVAVGAIASKAPIPKRLMHILEGESLLNDASGLVCFRFAVAAVMTGSFSLATASLTFVWVAVAGLAVGVAVTLGVSTFQRWLWRRFGEEPGAAMLVNLLIPFAAYLLAEEIHASGILAAVAAGIAMSYVELTGRVSGSMRVQRAGVWNMLQFSFNGIMFVLLGEQLPGIVERATTTMNESGHQSAWWLLVYVVVINLALILLRLLWVWLSLRWNLLRARRRGLERGEAPNWRIVVATSVAGVRGAITLAGVLTLPLFLPDGSAFPARDLVIFLAAAVILFSLVGASVALPQLLKGLQLPADSGERKEEDLARRLSSKAALAGVERMRQQLVMNQNTENVQLYNDAASRVSLLYQRHLEKDNDGPDVDPEKVRRMELGYRQLRSAGLNAEREELFRLTRRGVISDEISRRLIRNLDLLESRKRE
>NZ_CP040433.1|WP_005415112.1|495047_495296_-|DUF3297-family-protein
MSDTPPDHLAINPASPFHDAQALERGVGVRFNDVERDNVEEYSVSEGWIRVQAGKARDRRGNPMTIKVKGKVEVYFLDQKPE
>NZ_CP040433.1|WP_134969290.1|495386_495929_+|hypothetical-protein
MPDNSDYFDFEEDIHDFDEDGFEARVWNLLVLINPGDEELALQQFNRWREHLSEDGQPLEADSDWLPALFTAIAWQSGFDVERDDLESLQSAVNELSARFNLQLDWGGDLDDEDFAEGLDGVQLMATAFDRLREHNYTLWSVDAGRDGFTGVMALTRDDDAMLALCSLLNVEIRLGSDPF
>NZ_CP040433.1|WP_154350169.1|496022_496298_-|DUF4031-domain-containing-protein
MTVYVDDAVHPWRGQRWAHLMADTLAELHAMAAQLGIPPRAFQNKASGAHYDVTVELRAQAIALGARAISRHADRDLVKAVIANARAQYRP
>NZ_CP040433.1|WP_134969289.1|496311_496806_-|hypothetical-protein
MSQNSKAKRDKRKKQQAKRPFLRLNAQQQVQNHAVLTNEDGQVVAAIGLQGREWLLAIGGQTMGNAENPVPMLAMLKHLSNVQEKEGRKVNLEYSELLQKLLDTLAAESGQTADEYLDKLVSEFETVEAEEGEEAAEAAEGDVVEAAADAEAPPAADSDSKPQA
>NZ_CP040433.1|WP_154350170.1|496903_497842_-|flagellar-motor-protein-MotB
MAETKPTVIVRRVRKAGHAAHHGGSWKVAYADFVTAMMAFFLVLWLMATTNKNDRAAISEYFRNPSPLSGQNATPAPGMAGPGGASTSMIKLGGATDISRGNSNDPFQNQKEAVPQPVDQQQRDKQQLEALMKELQEAISRSQALEPFKDQLLLDLTPEGLRIQIVDKQNRPMFDLGSATLKPYTQQILHELANYLNHVPNRISLTGHTDITAYSAARGYGNWELSADRANAARRALVDGGLEDNKITRVVGLSSSVLFDRADPQNPINRRISIVVMTQAAEAAALAGAGPQVGLSAPTADPDVQAAQGEAH
>NZ_CP040433.1|WP_005407915.1|497845_498700_-|flagellar-motor-stator-protein-MotA
MLIIVGFLVVIISVIGGYLGAHGRLGALWQPYELVIIGGAALGAFLVGTPAKTVKQTLQAMVGVFKGPRYKQQDYIDVLSLLYELLNKARREGFMALEDHVERPAESALFGNYPKVQADHHLIDFITDCLRLMIGSNIEPHELEPLLELELEKHHAEAMAPSQVLTKVADGLPGFGIVAAVLGIVITMGSIGGDIVEVGGHVAGALVGTFLGILLGYGFVGPMAAAMEARAEQDSRIYESVKTALLACLRGYNPKIALEFARKTLPSNVRPAFSDFEQHLKTVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040433_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040433_2

1267545-1267621

Orphan

Consensus_repeat	Method
AGCCGAGCATGGGCCCGGCTCTACAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040433_2

>merge|NZ_CP040433|2|1267545-1267621|CRISPRCasFinder
AGCCGAGCATGGGCCCGGCTCTACAGACAGAGCGCCGCGGGGTCGTTGTGGAGCCGAGCATGGGCTCGGCTCTACAG

>NZ_CP040433|2|2|1267545-1267621|CRISPRCasFinder
AGCCGAGCATGGGCCCGGCTCTACAG	ACAGAGCGCCGCGGGGTCGTTGTGG
AGCCGAGCATGGGCTCGGCTCTACAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040433.1\|WP_005415736.1\|1260186_1260588_+\|50S-ribosomal-protein-L19	unknown	unknown	gnl\|CDD\|235418
NZ_CP040433.1\|WP_146256385.1\|1276576_1277365_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274052
NZ_CP040433.1\|WP_146256386.1\|1274650_1275079_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_049451765.1\|1277357_1278020_+\|N-6-DNA-methylase	unknown	unknown	gnl\|CDD\|280533
NZ_CP040433.1\|WP_049417408.1\|1260670_1261051_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_005415742.1\|1263862_1264270_+\|RNA-binding-S4-domain-containing-protein	unknown	unknown	gnl\|CDD\|224109
NZ_CP040433.1\|WP_005415735.1\|1259273_1260032_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	unknown	unknown	gnl\|CDD\|234581
NZ_CP040433.1\|WP_040008484.1\|1270439_1272383_+\|integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP040433.1\|WP_049446852.1\|1273308_1273854_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_049419399.1\|1275936_1276584_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|368643
NZ_CP040433.1\|WP_154350414.1\|1261129_1261564_+\|DUF1801-domain-containing-protein	unknown	unknown	gnl\|CDD\|227936
NZ_CP040433.1\|WP_008266608.1\|1272369_1273140_+\|nucleotide-binding-protein	unknown	unknown	gnl\|CDD\|99863
NZ_CP040433.1\|WP_008267292.1\|1275241_1275808_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_040008476.1\|1274237_1274591_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_154350417.1\|1266874_1267474_-\|DUF937-domain-containing-protein	unknown	unknown	gnl\|CDD\|368733
NZ_CP040433.1\|WP_061479152.1\|1261602_1262010_+\|DUF1801-domain-containing-protein	unknown	unknown	gnl\|CDD\|227936
NZ_CP040433.1\|WP_061479154.1\|1263613_1263853_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040433.1\|WP_154350415.1\|1262078_1263551_-\|MATE-family-efflux-transporter	unknown	unknown	gnl\|CDD\|240543
NZ_CP040433.1\|WP_154350418.1\|1267680_1270302_-\|DNA-mismatch-repair-protein-MutS	unknown	unknown	gnl\|CDD\|235444
NZ_CP040433.1\|WP_154350416.1\|1264489_1266727_-\|catalase/peroxidase-HPI	unknown	unknown	gnl\|CDD\|237891

Protein	Function_ID	Function_description	E-value
NZ_CP040433.1\|WP_005415736.1\|1260186_1260588_+\|50S-ribosomal-protein-L19	gnl\|CDD\|235418	PRK05338, rplS, 50S ribosomal protein L19; Provisional.	9.53186e-64
NZ_CP040433.1\|WP_146256385.1\|1276576_1277365_+\|hypothetical-protein	gnl\|CDD\|274052	TIGR02244, Cytosolic_purine_5'-nucleotidase, HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase. This model includes a 5'-nucleotidase specific for purines (IMP and GMP). These enzymes are members of the Haloacid Dehalogenase (HAD) superfamily. HAD members are recognized by three short motifs {hhhhDxDx(T/V)}, {hhhh(T/S)}, and either {hhhh(D/E)(D/E)x(3-4)(G/N)} or {hhhh(G/N)(D/E)x(3-4)(D/E)} (where "h" stands for a hydrophobic residue). Crystal structures of many HAD enzymes has verified PSI-PRED predictions of secondary structural elements which show each of the "hhhh" sequences of the motifs as part of beta sheets. This subfamily of enzymes is part of "Subfamily I" of the HAD superfamily by virtue of a "cap" domain in between motifs 1 and 2. This subfamily's cap domain has a different predicted secondary structure than all other known HAD enzymes and thus has been designated "subfamily IG". This domain appears to consist of a mixed alpha/beta fold. A Pfam model (pfam05761) detects an identical range of sequences above the trusted cutoff, but does not model the N-terminal motif 1 region. A TIGRFAMs model (TIGR01993) represents a (putative) family of _pyrimidine_ 5'-nucleotidases which are also subfamily I HAD's, which should not be confused with the current model.	0.00794752
NZ_CP040433.1\|WP_049451765.1\|1277357_1278020_+\|N-6-DNA-methylase	gnl\|CDD\|280533	pfam02384, N6_Mtase, N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.	0.000105334
NZ_CP040433.1\|WP_154350417.1\|1266874_1267474_-\|DUF937-domain-containing-protein	gnl\|CDD\|368733	pfam06078, DUF937, Bacterial protein of unknown function (DUF937). This family consists of several hypothetical bacterial proteins of unknown function.	2.11697e-16
NZ_CP040433.1\|WP_005415742.1\|1263862_1264270_+\|RNA-binding-S4-domain-containing-protein	gnl\|CDD\|224109	COG1188, COG1188, Ribosome-associated heat shock protein implicated in the recycling of the 50S subunit (S4 paralog) [Translation, ribosomal structure and biogenesis].	6.28715e-26
NZ_CP040433.1\|WP_005415735.1\|1259273_1260032_+\|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD	gnl\|CDD\|234581	PRK00026, trmD, tRNA (guanine-N(1)-)-methyltransferase; Reviewed.	3.5981e-143
NZ_CP040433.1\|WP_040008484.1\|1270439_1272383_+\|integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	0.000612287
NZ_CP040433.1\|WP_154350416.1\|1264489_1266727_-\|catalase/peroxidase-HPI	gnl\|CDD\|237891	PRK15061, PRK15061, catalase/peroxidase.	0
NZ_CP040433.1\|WP_154350414.1\|1261129_1261564_+\|DUF1801-domain-containing-protein	gnl\|CDD\|227936	COG5649, COG5649, Uncharacterized conserved protein [Function unknown].	5.52534e-52
NZ_CP040433.1\|WP_049419399.1\|1275936_1276584_+\|hypothetical-protein	gnl\|CDD\|368643	pfam05869, Dam, DNA N-6-adenine-methyltransferase (Dam). This family consists of several bacterial and phage DNA N-6-adenine-methyltransferase (Dam) like sequences.	3.02495e-07
NZ_CP040433.1\|WP_061479152.1\|1261602_1262010_+\|DUF1801-domain-containing-protein	gnl\|CDD\|227936	COG5649, COG5649, Uncharacterized conserved protein [Function unknown].	9.6271e-56
NZ_CP040433.1\|WP_154350415.1\|1262078_1263551_-\|MATE-family-efflux-transporter	gnl\|CDD\|240543	cd13138, MATE_yoeA_like, Subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins similar to Bacillus subtilis yoeA. The integral membrane proteins from the MATE family are involved in exporting metabolites across the cell membrane and are responsible for multidrug resistance (MDR) in many bacteria and animals. A number of family members are involved in the synthesis of peptidoglycan components in bacteria.	1.77606e-132
NZ_CP040433.1\|WP_154350418.1\|1267680_1270302_-\|DNA-mismatch-repair-protein-MutS	gnl\|CDD\|235444	PRK05399, PRK05399, DNA mismatch repair protein MutS; Provisional.	0
NZ_CP040433.1\|WP_008266608.1\|1272369_1273140_+\|nucleotide-binding-protein	gnl\|CDD\|99863	cd06110, BSuCS-II_like, Bacillus subtilis (Bs) citrate synthase (CS)-II_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-II, the major CS of the gram-positive bacterium Bacillus subtilis. A mutation in the gene which encodes BsCS-II (citZ gene) has been described which resulted in a significant loss of CS activity, partial glutamate auxotrophy, and a sporulation deficiency, all of which are characteristic of strains defective in the Krebs cycle. Streptococcus mutans CS, found in this group, may participate in a pathway for the anaerobic biosynthesis of glutamate. This group also contains functionally uncharacterized CSs of various gram-negative bacteria. Some of the gram-negative species represented in this group have a second CS isozyme found in another group. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS.	0.00684272

>NZ_CP040433.1|WP_154350417.1|1266874_1267474_-|DUF937-domain-containing-protein
MNTESLAASLFQQLQQGQGLQQVSQQLGLDSSQTAQAVGSALPLLLGAMGQNASEPQGAQSLLNALQRDHSGGSGFDLGGILGAVMGGGGSGATDGAGILGHVFGGQQPQAAQLLGQKTGLDSGTSGKLLAILAPIVMSFLAQRFAQGGNAGQLSQALGQETQQSGGIGNLLGGVLDQDGDGQFGASDLMKLGAGLLKR
>NZ_CP040433.1|WP_154350416.1|1264489_1266727_-|catalase/peroxidase-HPI
MKSEAKCPFNHAVVGDATTNRDWWPNQLRVDLLNQHSARSNPLDAGFDYAKAFKGLDYTALKADLKALMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRIGDGRGGGGRGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGQAISWADLLILTGNVALESMGFKTLGFAGGRPDTWEPDQDVYWGRETTWLGGDVRYKHGSEGVEENHGVLVSDDDADGDVHSRTLENPLAAVQMGLIYVNPEGPDGNPDPVLAAHDIRDTFGRMAMDDEETVALIAGGHSFGKTHGAGPADNVGKEPEAAGLENQGLGWASSFRSGKGGDAITSGLEVTWTRTPAQWSHDFFEILFGNEWELSKSPAGAHQWVAKNAEAVIPDAHDPSKKHRPTMLTTDLSLRMDPAYEKISRRFLAEPQAFADAFARAWFKLTHRDMGPRARYLGPEIPAEQFIWQDPLPEAQHPLIDARDIAALKQQIAAAGLSVAELVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPQQLAKVLAALEKVQASFNAGGKHVSLADLIVLAGGVGVEQAAKAGGHEVSVPFTPGRTDASQEQTDVESFAVLEPVADGFRNYLKGAYSVPGEALLIDKAQLLTLTAPEMTVLVGGLRVLGANADGGKHGVFTTRPGTLSNDFFVNLLDMGTQWKATGRESYEGRGRTDGALRWTGTRTDLVFGSNAVLRALAEVYASADGEKKFVQDFIAAWTRVMELDRYDLHG
>NZ_CP040433.1|WP_005415742.1|1263862_1264270_+|RNA-binding-S4-domain-containing-protein
MPELSPLSPSVRLDIWLWAARFFKTRSLAKQAIETGKVSVAGQRPKSSRAVRVGEQLQVDRGEEHFEVQVLGLSDQRGPAATAQQLYAESEASKARRAEQRALRIAARDGFQPPEHKPDKRARRLIRALGDIDAL
>NZ_CP040433.1|WP_061479154.1|1263613_1263853_+|hypothetical-protein
MHQRLQVERRLALALISAVLAACSMDDRLGDTQIRPTDRPECLVGSQRQDLASGVRPLIGGTGCRADPDNPRPLNKPLE
>NZ_CP040433.1|WP_154350415.1|1262078_1263551_-|MATE-family-efflux-transporter
MAKAPLDLTSGPIGRNLLLFSLPILAGNIAQSLNGSVNAVWVGRFLGEAALTATANANNIMFFLIGSVFGFGMASTILIGQAIGARDIAQARRVVGTSATFFIGLSVIIALAGWFMAHPLLAAMGTPAASLPLAEAYLQIIFLAMPTLYAFAFLTAALRGAGDSRTPFRFLMVSVALDIVLNPVLIFGMGPFPALGIAGSAWATLVAQTLSLAGLLLYMRHKRHTLWLGRADMRLFRLDMTILKALVVKGVPMGLQMVLISLSVILLMTMVNQYGTDTGAGYGAALQLWNYLQMPAMAIGAACSSMAAQNVGAQRWDRVRGTARQGVLFNFLLTGALILPLVVFDRQLLALFLPPASQALEIARHLNHVVIGSFLFFGVSFVISGVVRSTGAVIPPLLILAGSLWGVRVPFAELLQPYWGADAIWWSFPVSSLVSMLLSLAYYRWGGWRKAKMMGKPSHAETLATPSEIPACPPSPVADPDAALEPAPPR
>NZ_CP040433.1|WP_061479152.1|1261602_1262010_+|DUF1801-domain-containing-protein
MVTHAPNPADAGTPAAELIDARIAELGDWRGETLARVRALIHEALPDVQETWKWRGTPVWEQDGILCTGETYRQAVKLTFAHGAALPDPKGLFNASLDGNTRRAIDIHQGAMPDAAAFKALLRAAATFNAAKKKR
>NZ_CP040433.1|WP_154350414.1|1261129_1261564_+|DUF1801-domain-containing-protein
MPAKRTAPSTAPTLLSGGNPQIAKGEGDAPVQAYIAAMPDWKRAIGARLDVLIEQAVPGVHKAVKWNSPMYAVAPGEGWFLSFHCFTRYIKVAFFPGAALAPVPPEPSRSANTRYLHIFEDAPLDETQFRDWVRQAAALPGERM
>NZ_CP040433.1|WP_049417408.1|1260670_1261051_+|hypothetical-protein
MNDINPRYPAVIQSALRFLDGKGLARVQSAPLLHRLLWRAGIALPPPILAGFGTNALVQGLLFGLFWTALMWLMLWQGSERPLALLLVAGLLAGALFGIVMAALMRSLRRHRKLPDWRRFRARQAD
>NZ_CP040433.1|WP_005415736.1|1260186_1260588_+|50S-ribosomal-protein-L19
MSKLNKSIVAEFESAQITRELPKFSQGDTVVVNVKVKEGSRERVQAYEGVVIATKNAGLNSSFTVRKISHGYGVERVFQTHSAIIDSVEVKRRGKVRAGKLYYLRGLEGKAARIKEDLAAAAAAKAARLADKA
>NZ_CP040433.1|WP_005415735.1|1259273_1260032_+|tRNA-(guanosine(37)-N1)-methyltransferase-TrmD
MRFDVITLFPEFLAQSAGLGVVGRAQEKGLFSLHGWNPRDYAEGNYRRVDDRPFGGGPGMVMLIEPLQACLQAIREADPTPARVIYLSPQGAPLTQAKVRELAALPRMVLLCGRYEGIDERFLEANVDEEISLGDYVLSGGELGAAVIIDAVARLQDGALNDAESAAQDSFEGDLGLLDCPHYSQPAQHPLGDVPEVLRSGNHAAIAAWRRQQSLLRTAQRRPDLLDEQALGKADRKLLEQGRQARNQKASP
>NZ_CP040433.1|WP_154350418.1|1267680_1270302_-|DNA-mismatch-repair-protein-MutS
MQATDSKTKRNESKGSQEHTPLMKQFFAAKSEYPDLLLFFRMGDFYELFYDDARKAARLLDITLTQRGSSGGAPIPMAGVPVHAYEGYLARLVALGESVAICEQIGDPALAKGLVERKVVRIVTPGTVTDEALLDERRDTLLMALSRTKQGYGLAWADLAGGRFLVNEVETDDALEAELARLEPAELLVPDEENWPEFLRQRTGVRRRAPWLFDADSGRRQLLAFFKLHDLSGFGIDDKPRATAAAGALLGYVEETQKQRLPHLTSIAMETAGEAIAMNAATRRHLELDTRVDGDTRNTLLGVLDSTVTPMGGRLLRRWLHRPLRLREVLVQRHHAVETLIDRGSDADIREQFRRLGDLERILTRVALRSARPRDFSTLRDGLGLLPAVREVLAPLDSPRLQALHAALGEHDACAQLLASAIAEMPPLKLSDGGVLADGFDEELDELRRLSTHADQFLVDLEQRERESSGIPTLKVGYNRVHGYYIEISKGQSDRAPVHYTRRQTLTNAERYITEELKAFEDKVLSARDRSLSREKYLYEQLLDTLGEQLEPLKQCAAALSELDVLAAFAERAQALDWSRPELQAEPCLKIERGRHPVVEAVREQPFEPNDLDLHPDRRMLVITGPNMGGKSTYMRQNALIVLLAHIGSFVPASRAVIGPIDRILTRIGAGDDLARGQSTFMVEMAETSYILHHATAHSLVLMDEIGRGTSTYDGLALADAVARHLAHQNRCYTLFATHYFELTALADEQHEGGRSGIANVHLDAVEHGEGLVFMHAVKDGPANRSFGLQVAALAGLPRATVAQARRRLAELEQRGGESHAAELAPQALDAPQQFGLFSAPSSKAQEALAAIDPDELTPKQALEALYRLKTLL
>NZ_CP040433.1|WP_040008484.1|1270439_1272383_+|integrase
MPKNVATDRATRRQATKFSLTHQQVMELSVRRIPASGGLGKRAKLVERPAEQGDKAYRVLDGNQGAPVGFGFYVGKTRTTYEVVRRGTQGVRRFALGNVTDMGLEEAYSVARELIQELKASGENPKTRAARASQQQQEDGRLARLTVADCFDVYIADMKDRVTKRLVKQSSLTALEDSLARLSRPEVGFAQRAVADVTDDDVEAAFDALRKSAMVRSNRIPTPMREALAGYEDWAELDTRTLESLGITGKYVQRVRASGLAATEHSFTDAHRAVAMVLKRESVLAGREGRESRLRHNPLQAIFDRHLLRGARNLRKHYEKAAVRNPLTDNTLPKVLQSIVGRRDEQGGHNAGASDYLLLTLLWGTRRSEAAQLRWMDRCSHSELIQEEVSWVWLGQPGEINRYTKREGPQVFMFDTKSGEERFLPISYFAERVLRLRFETRLDDDGALRELAAAESLLKSAKAKGAARTVLAALEAGVQEALRKVDRTRFVFPARSSRSKSGHYLDSKSILANVRRDAGLVGQQGDTGDIRDDVDQGLTTHDLRRTLGRYAALKFGESRIVSQMLHHHVRTAGGDGMSPVSERYTQQEWARLREAFGEVEEMMVARSPRVWNRLKGLDKPRLDEAGEEPVKLFAPRNRKLALSHADD
>NZ_CP040433.1|WP_008266608.1|1272369_1273140_+|nucleotide-binding-protein
MQTIETVRSDEDYRAKLQRALDQELSRAAAGLTPTVSTKAAAQFLGVHFDTLGEWRRRSPPLGPPFQKGAGSLHGGANQHVRYLYEDLVEWQRARLGRSAKERRLVAEEDALRQQIRELERELAVKTGRTELEKLKKAVGKGVSFLSLRDCVSISHGWVMSDGCIAGHVLSVSEDLLDRALDEGNVWDASLSEALLEAWVSVDAREPYDAAMSAALDEVEKVLRVARSSARQDALDDSLPEPARPAKDVGGGRFRF
>NZ_CP040433.1|WP_049446852.1|1273308_1273854_+|hypothetical-protein
MSGAVAAYTMGISLDSLNSRRRAGKGLFPDFTRAKSNKGGTRYNWRSVLDCSEAEVNGRWISAGRQRIEEDEASALSAALAVAKIRRAEADAEIESLTKALKRLGIKALERVLPWAVDDRGRVLGSAAAYPAHLAKPHTTLEALQMPWVERRLHDVLMDAVDSILSDVRQALNRAREASLG
>NZ_CP040433.1|WP_040008476.1|1274237_1274591_+|hypothetical-protein
MGLDMFAGKTRKDVVDNTAVPIMEWRKHPDLHGYMQALYASRSGCKDPMKFNKKPLFLSRQDLEDLRQAVLSGQLPKTEGHFFGESLPEEQHFDLIFIDGACRLIDQGWNVFYDSWW
>NZ_CP040433.1|WP_146256386.1|1274650_1275079_+|hypothetical-protein
MSKKPSSKSRRNRKSNRSSRSHGAIVPQIYLTTSAASLIEGMDSIERELFEMTLPDLLTSEEVTSCIQVYGSYRAVVTHFDTQFVVESVGCRAATKGHSSKPGFVLDTYDQHAPGDLQPPSWLGSFQPLLRTAPLPGLQSES
>NZ_CP040433.1|WP_008267292.1|1275241_1275808_+|hypothetical-protein
MKQRYTISVTGPVWVDYSVAMDVTCVSDAINHLESLDPEIAAQWLIESSAYSLERIEHEVCGGVGDAVYEAIPDYVFNRAGEMEFGSDEEDDHDGVADPVAPALPQRLLLTATGLASRRYTFEAESWEDALSQFHGLSTEELNAPTWSIWGIDLDVDVSLVVGALVEGGEADEDALEDIAMHLDVQLP
>NZ_CP040433.1|WP_049419399.1|1275936_1276584_+|hypothetical-protein
MPKERKTTSIPRTKKLAAATVGFDRLPQFETTTTWLTPPEHIWGSPREGFTGLGPFDLDPATPENGMPWPTAARMLKPSDDGLASEWPADAFVFMNPPFGRGQEAWMEKMANHPGGGIALVFARTETRWFQSFVLNHPDVSAVVFQEGRLKFHRANGDVGDAPPAGPAWIAYGEEGARRLKRAVREGQIRGCFLELDFARVSSGVGADVGAANDE
>NZ_CP040433.1|WP_146256385.1|1276576_1277365_+|hypothetical-protein
MSKGTSKKAKPTDPRNNAYQRLLKAIQAIPGESPREKMRKFTAFALKVCVINQAEELFTRGFGPLVAWCDLTLLGTDVQGSEDWCHEAGQAYGGAVETFEPFECILGRLFNELVWSGKKNDAQHFTPWGLARAMNAFAQAPQKDEWPMGDPTCGAGTLLLVKLHELAGKDSKALRGLTVKANDRDPLCAAMTALQLLSNQLIWRMPIGRVVVECKDIITQYLETRVVFWSLTRDRFIAMDEEIRLEKANRVTGADMGAANDE
>NZ_CP040433.1|WP_049451765.1|1277357_1278020_+|N-6-DNA-methylase
MNEVANLVKAIRAIPSTPGKPWNPRVAFETFVQHALMSMAHIHADTKGHLDTKVLAFGPLKKNVEEAPEVVAAINAYIKAVFASRPFDDVLGRVHAELLARKGGEGLGQSFTPGDLLDLVQTLATRHRPGGSGAKVYDSCCGAGSLALAAIRSQQKHLPSEKILVLAGDIDPLCAAMTALQIHANQTFHFLPLGAVKVTVGNELIGPRRPGFWSRFHLYE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040433_2	2.1\|1267571\|25\|NZ_CP040433\|CRISPRCasFinder	1267571-1267595	25	CP023013	Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence	477746-477770	4	0.84
NZ_CP040433_2	2.1\|1267571\|25\|NZ_CP040433\|CRISPRCasFinder	1267571-1267595	25	NZ_CP022783	Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence	479175-479199	4	0.84
NZ_CP040433_2	2.1\|1267571\|25\|NZ_CP040433\|CRISPRCasFinder	1267571-1267595	25	NZ_CP022795	Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence	478266-478290	4	0.84
NZ_CP040433_2	2.1\|1267571\|25\|NZ_CP040433\|CRISPRCasFinder	1267571-1267595	25	NZ_CP021449	Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence	1588726-1588750	4	0.84
NZ_CP040433_2	2.1\|1267571\|25\|NZ_CP040433\|CRISPRCasFinder	1267571-1267595	25	NZ_CP039340	Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence	449243-449267	4	0.84

1. spacer 2.1|1267571|25|NZ_CP040433|CRISPRCasFinder matches to CP023013 (Ralstonia solanacearum strain T110 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acagagcgccgcggggtcgttgtgg	CRISPR spacer
ccagagcgccgcggggtcggtgcag	Protospacer
 ****************** **..*

2. spacer 2.1|1267571|25|NZ_CP040433|CRISPRCasFinder matches to NZ_CP022783 (Ralstonia solanacearum strain SL3755 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acagagcgccgcggggtcgttgtgg	CRISPR spacer
ccagagcgccgcggggtcggtgcag	Protospacer
 ****************** **..*

3. spacer 2.1|1267571|25|NZ_CP040433|CRISPRCasFinder matches to NZ_CP022795 (Ralstonia solanacearum strain SL2330 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

acagagcgccgcggggtcgttgtgg	CRISPR spacer
ccagagcgccgcggggtcggtgcag	Protospacer
 ****************** **..*

4. spacer 2.1|1267571|25|NZ_CP040433|CRISPRCasFinder matches to NZ_CP021449 (Ralstonia solanacearum strain SEPPX05 plasmid pSEPPX05, complete sequence) position: , mismatch: 4, identity: 0.84

acagagcgccgcggggtcgttgtgg	CRISPR spacer
ccagagcgccgcggggtcggtgcag	Protospacer
 ****************** **..*

5. spacer 2.1|1267571|25|NZ_CP040433|CRISPRCasFinder matches to NZ_CP039340 (Ralstonia solanacearum strain UW386 plasmid pUW386, complete sequence) position: , mismatch: 4, identity: 0.84

acagagcgccgcggggtcgttgtgg	CRISPR spacer
ccagagcgccgcggggtcggtgcag	Protospacer
 ****************** **..*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

575777 : 585472

Enterobacteria_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154350198.1\|575777_576833_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.6e-78	45.6
WP_061480209.1\|576847_577735_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.4e-96	58.2
WP_154350199.1\|577731_578289_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.2e-45	51.1
WP_154350200.1\|578285_579179_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.1e-27	37.8
WP_154350201.1\|579300_580704_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	4.2e-47	29.1
WP_154350202.1\|580715_582062_-	phosphomannomutase	A0A127AWJ1	Bacillus_phage	3.2e-28	25.9
WP_154350203.1\|582160_585472_-	helicase	A8C6A2	Antheraea_pernyi_nuclear_polyhedrosis_virus	1.8e-48	30.5

DBSCAN-SWA_2

898317 : 978104

Bacillus_phage(21.43%)

transposase,protease,integrase

attL 946708:946722|attR 979792:979806

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154351695.1\|898317_899520_+\|transposase	ISL3 family transposase	A4PE56	Ralstonia_virus	5.7e-117	54.1
WP_061480603.1\|899608_900304_+	hypothetical protein	NA	NA	NA	NA
WP_154351696.1\|900488_901511_-	L-threonine 3-dehydrogenase	NA	NA	NA	NA
WP_061480604.1\|902023_904186_+	S46 family peptidase	NA	NA	NA	NA
WP_154350280.1\|904312_904936_-	hypothetical protein	NA	NA	NA	NA
WP_134968340.1\|905163_905808_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_154350281.1\|905849_907121_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_154350282.1\|907201_908248_+	sporulation protein	NA	NA	NA	NA
WP_061479936.1\|908294_909074_+	CvpA family protein	NA	NA	NA	NA
WP_049414284.1\|909104_910571_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	6.3e-86	39.4
WP_111200540.1\|910580_911405_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_154350283.1\|911470_912928_-	DUF2235 domain-containing protein	NA	NA	NA	NA
WP_061479939.1\|913153_914407_+	peptidyl-Asp metalloendopeptidase	NA	NA	NA	NA
WP_154350284.1\|914461_915208_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_061479941.1\|915300_915840_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_154350285.1\|915820_916966_-	glycosyltransferase	NA	NA	NA	NA
WP_061479942.1\|917136_920061_-	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	5.4e-28	24.9
WP_005415458.1\|920382_921909_-	exopolyphosphatase	NA	NA	NA	NA
WP_134968698.1\|922047_924135_-	polyphosphate kinase 1	NA	NA	NA	NA
WP_061479944.1\|924139_925471_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	2.5e-28	33.2
WP_005408258.1\|925577_926267_-	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	2.6e-34	34.7
WP_061479945.1\|926383_928030_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_004154541.1\|928172_928463_+	glutaredoxin 3	A0A2L0UZG6	Agrobacterium_phage	2.0e-07	43.2
WP_004154542.1\|928459_928852_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_012479261.1\|929170_930175_+	isocitrate dehydrogenase	NA	NA	NA	NA
WP_154350286.1\|930381_931125_+	isochorismatase family protein	NA	NA	NA	NA
WP_061479947.1\|931178_932087_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_154350287.1\|932168_933032_-	hypothetical protein	NA	NA	NA	NA
WP_061479949.1\|934397_934706_+	hypothetical protein	NA	NA	NA	NA
WP_134968738.1\|935120_936416_+	trigger factor	NA	NA	NA	NA
WP_004146318.1\|936492_937119_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	7.7e-57	57.4
WP_004154600.1\|937245_938535_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.9e-135	58.0
WP_154350288.1\|938678_941129_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.5e-220	51.7
WP_005408270.1\|941348_941621_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	4.5e-22	62.9
WP_154350289.1\|942498_944454_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_154350045.1\|944557_945520_-\|transposase	transposase	NA	NA	NA	NA
WP_154350290.1\|945834_947037_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
946708:946722	attL	NA	NA	NA	NA
WP_154350291.1\|947033_947798_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_061479955.1\|947809_948454_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_005408275.1\|948466_948919_+	ribonuclease HI	J9Q745	Salmonella_phage	1.0e-42	53.4
WP_014036152.1\|948923_949655_+	DNA polymerase III subunit epsilon	A2I2Z6	Vibrio_virus	2.0e-08	29.4
WP_005415481.1\|949717_950422_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_065427648.1\|950757_952209_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_049397076.1\|953830_955030_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_061479957.1\|956305_956710_+	hypothetical protein	A0A1C9C5K8	Heterosigma_akashiwo_virus	1.7e-17	34.6
WP_061479958.1\|956728_957775_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_061479959.1\|957795_958545_+	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_154350292.1\|958544_959312_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_005415486.1\|959859_960177_+	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_154350293.1\|960536_971426_+	transporter	NA	NA	NA	NA
WP_061480527.1\|971483_971927_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_072168252.1\|972090_972465_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_154350294.1\|972917_973502_+	hypothetical protein	NA	NA	NA	NA
WP_154350295.1\|973498_974419_+	DUF4868 domain-containing protein	NA	NA	NA	NA
WP_154351697.1\|974856_975594_-	NYN domain-containing protein	NA	NA	NA	NA
WP_154350296.1\|975664_976606_-	hypothetical protein	NA	NA	NA	NA
WP_154350297.1\|976706_978104_-\|integrase	tyrosine-type recombinase/integrase	A0A059XK29	uncultured_phage	2.8e-06	22.4
979792:979806	attR	NA	NA	NA	NA

DBSCAN-SWA_3

2322707 : 2329878

Stenotrophomonas_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099562425.1\|2322707_2323088_+	hypothetical protein	B1NI82	Stenotrophomonas_phage	5.0e-59	88.1
WP_154350800.1\|2323650_2324337_-	conjugal transfer protein	A0A1D6ZIU7	Xanthomonas_phage	1.8e-54	54.2
WP_154350801.1\|2324333_2325518_-	zonular occludens toxin family protein	B1NI81	Stenotrophomonas_phage	9.4e-56	36.7
WP_154350802.1\|2325514_2325835_-	DUF2523 domain-containing protein	NA	NA	NA	NA
WP_154350803.1\|2325834_2326878_-	hypothetical protein	S0F309	Stenotrophomonas_phage	8.3e-48	44.4
WP_154350804.1\|2327367_2327610_-	hypothetical protein	NA	NA	NA	NA
WP_154350805.1\|2327851_2328148_-	hypothetical protein	NA	NA	NA	NA
WP_154350806.1\|2328960_2329131_-	hypothetical protein	NA	NA	NA	NA
WP_154350807.1\|2329127_2329367_-	hypothetical protein	S0F3S0	Stenotrophomonas_phage	2.6e-05	51.9
WP_154350808.1\|2329500_2329878_+	helix-turn-helix domain-containing protein	B1NI83	Stenotrophomonas_phage	1.7e-14	44.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040433

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection