CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040436	Stenotrophomonas maltophilia strain PEG-390 chromosome, complete genome	4 crisprs	csa3,WYL,DEDDh,cas3,Cas9_archaeal,DinG	0	1	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040436_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040436_1

2677244-2677324

Orphan

Consensus_repeat	Method
GCCTACGGCACTGCCGAGATTGCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040436_1

>merge|NZ_CP040436|1|2677244-2677324|CRISPRCasFinder
GCCTACGGCACTGCCGAGATTGCCGATGGTGCCGTTGAGGTTGCCGTTGAGCAGGTTGCCTACGGCACTGCCGACATTGCC

>NZ_CP040436|1|1|2677244-2677324|CRISPRCasFinder
GCCTACGGCACTGCCGAGATTGCC	GATGGTGCCGTTGAGGTTGCCGTTGAGCAGGTT
GCCTACGGCACTGCCGACATTGCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040436.1\|WP_155029715.1\|2666200_2668282_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|227113
NZ_CP040436.1\|WP_155029718.1\|2671034_2671442_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133408
NZ_CP040436.1\|WP_111102426.1\|2682989_2684348_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NZ_CP040436.1\|WP_155029716.1\|2668302_2670117_+\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238233
NZ_CP040436.1\|WP_021204284.1\|2680632_2680824_+\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366
NZ_CP040436.1\|WP_019659962.1\|2685616_2686966_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP040436.1\|WP_058982316.1\|2681433_2681910_+\|pilus-assembly-protein-TadE	unknown	unknown	gnl\|CDD\|377921
NZ_CP040436.1\|WP_155029721.1\|2678967_2679948_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378964
NZ_CP040436.1\|WP_155029719.1\|2671505_2672333_+\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP040436.1\|WP_019659961.1\|2684375_2685632_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|349765
NZ_CP040436.1\|WP_134735563.1\|2663723_2664077_-\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|182471
NZ_CP040436.1\|WP_134731548.1\|2672824_2673661_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|236764
NZ_CP040436.1\|WP_155029722.1\|2681933_2682971_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP040436.1\|WP_155029714.1\|2665148_2666069_-\|DUF2817-domain-containing-protein	unknown	unknown	gnl\|CDD\|349450
NZ_CP040436.1\|WP_155029724.1\|2687950_2688886_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP040436.1\|WP_155029723.1\|2686968_2687925_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP040436.1\|WP_155029713.1\|2664228_2665080_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP040436.1\|WP_019659952.1\|2672414_2672705_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_155029717.1\|2670245_2670962_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP040436.1\|WP_058982314.1\|2680891_2681437_+\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|227295

Protein	Function_ID	Function_description	E-value
NZ_CP040436.1\|WP_155029715.1\|2666200_2668282_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|227113	COG4772, FecA, Outer membrane receptor for Fe3+-dicitrate [Inorganic ion transport and metabolism].	2.58238e-154
NZ_CP040436.1\|WP_155029718.1\|2671034_2671442_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133408	cd04781, HTH_MerR-like_sg6, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 6) with at least two conserved cysteines present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	4.66134e-36
NZ_CP040436.1\|WP_111102426.1\|2682989_2684348_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	6.73293e-97
NZ_CP040436.1\|WP_155029716.1\|2668302_2670117_+\|chloride-channel-protein	gnl\|CDD\|238233	cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel. The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function.	2.46858e-94
NZ_CP040436.1\|WP_021204284.1\|2680632_2680824_+\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	3.6292e-09
NZ_CP040436.1\|WP_019659962.1\|2685616_2686966_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	1.2403e-151
NZ_CP040436.1\|WP_058982316.1\|2681433_2681910_+\|pilus-assembly-protein-TadE	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	3.61014e-05
NZ_CP040436.1\|WP_155029721.1\|2678967_2679948_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378964	pfam12833, HTH_18, Helix-turn-helix domain.	5.89851e-18
NZ_CP040436.1\|WP_155029722.1\|2681933_2682971_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	1.42891e-33
NZ_CP040436.1\|WP_019659961.1\|2684375_2685632_+\|fimbrial-protein	gnl\|CDD\|349765	cd03111, CpaE-like, pilus assembly ATPase CpaE. This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.	8.44389e-41
NZ_CP040436.1\|WP_134735563.1\|2663723_2664077_-\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	gnl\|CDD\|182471	PRK10452, PRK10452, multidrug/spermidine efflux SMR transporter subunit MdtJ.	2.4951e-24
NZ_CP040436.1\|WP_134731548.1\|2672824_2673661_-\|OmpA-family-protein	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	6.55975e-35
NZ_CP040436.1\|WP_155029714.1\|2665148_2666069_-\|DUF2817-domain-containing-protein	gnl\|CDD\|349450	cd06231, M14_REP34-like, Peptidase M14-like domain similar to rapid encystment phenotype 34 (REP34). This family includes Francisella tularensis protein rapid encystment phenotype 34 (REP34) which is a zinc-containing monomeric protein demonstrating carboxypeptidase B-like activity. REP34 possesses a novel topology with its substrate binding pocket deviating from the canonical M14 peptidases with a possible catalytic role for a conserved tyrosine and distinct S1' recognition site. Thus, REP34, identified as an active carboxypeptidase and a potential key F. tularensis effector protein, may help elucidate a mechanistic understanding of F. tularensis infection of phagocytic cells. A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	1.78146e-65
NZ_CP040436.1\|WP_155029724.1\|2687950_2688886_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	8.07385e-13
NZ_CP040436.1\|WP_155029723.1\|2686968_2687925_+\|pilus-assembly-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	6.76537e-36
NZ_CP040436.1\|WP_155029713.1\|2664228_2665080_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	1.22601e-33
NZ_CP040436.1\|WP_155029719.1\|2671505_2672333_+\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	7.00515e-22
NZ_CP040436.1\|WP_155029717.1\|2670245_2670962_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	9.92911e-51
NZ_CP040436.1\|WP_058982314.1\|2680891_2681437_+\|prepilin-peptidase	gnl\|CDD\|227295	COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	1.16632e-11

>NZ_CP040436.1|WP_134731548.1|2672824_2673661_-|OmpA-family-protein
MKQHRIARAGQHAATLGLILGMGLLAACRSHAPATDGPAEATAVQFPEASRASLKEGIYPDVADLRRFAPGMSKRQLYTLLGTPHFNEGMWGVREWNYLFNFRTAQGAEYFTCQFQVRFDSKGIAQAGYWKPESCAAVLEPPRPPAPLAPAPLPEQPLRLSADALFGFDSAVLSAEGQQAVQGILAQVREAAQVQSIRVTGYTDRIGSASYNQTLSQRRAEAVRSALVQGGVPAASISAEGRGAAEPIVQCEQRNRRELIACLAPNRRVQIAGVAQPR
>NZ_CP040436.1|WP_019659952.1|2672414_2672705_-|hypothetical-protein
MNAQFLPLSMKTETTLSVYGQLGNHAVVRIPGRRLPGLILQADTVAGFLAQLQEAQACLRSGRAQRTDAELDMLIDVLQQWYALIESRLADAGEAL
>NZ_CP040436.1|WP_155029719.1|2671505_2672333_+|methyltransferase-domain-containing-protein
MASTPPLDQNALWNGPGGQVWVAQQAILDGLFQPMADLLVAELPETVTQLLDIGCGTGASLLASAAARPSAHCTGLDISAPMLALARQRAEAAGLDADFIVADAQQHPLPTAHFDWIQSRLGVMFFEDTEAAFVNLRRAARPGAGLRFLAWRGAGENPFMTTAERAIGDELDLPPRVPGAPGQFAFADGERVQHLLQAAGWNDVEVVAVDLPCSLAREDLPTYVGQVGPLGLALRTMPKERADSLLARALAAFAPFVENDRVRVDAACWLVRGHA
>NZ_CP040436.1|WP_155029718.1|2671034_2671442_-|MerR-family-transcriptional-regulator
MRELDIGEVVKRSGVPASTLRYYEQLGLLQALGRRGLRRQYGEQVLERLALIGLGQAAGLSLQQIGASLPLQRGCISLDREALLAQADVLQRQITRLQRVRRHLQRAAACPQAEDARKCGSFQKLLRAQQRMAGR
>NZ_CP040436.1|WP_155029717.1|2670245_2670962_+|MgtC/SapB-family-protein
MRFIETFQAGPFADTVVSLLAAFVLGTLIGAERQYRQRTAGLRTNVLVAVGAAAFVDLGMRIAGSAEAVRVVSYVVSGVGFLGAGVIMKEGMNVRGLNTAATLWCSAAVGSCTGADMLAEGVLLTVLIIAGNTLLRPLVNAINRIPINEAATEATYEVRLSVDAEAVPRVRERLVDALEAAQYPVGDVQVVEHADAPTDVIAVLVSTAVSADELDVVLARMEHVPGVLHATWEVSTRD
>NZ_CP040436.1|WP_155029716.1|2668302_2670117_+|chloride-channel-protein
MTVALTVAAYHAATMSSPVSPSRLHLAFQGLRLRLRGSDLWFIALALLVGLIAGYLTLLQSGIARWLQGTLYGLDDGMRLSSLPSLTWTALLVLPLGGLLVGLVSLAATRLKRPLLDAVEANALHGGRMSMRDNLIVLTQTLLSNGCGASVGLEASYTQMGAGSGSQLGRVMRLRRNDVRILVGAGAAGAIAAAFGAPLAGAFYAFEIVIGAYTPAALAPVAVAALAGAFVADQAGIEAYLLTAASTIDVRAADYAIYGLLGCCCAMVGIAIMRLIASIEGTVKRSPLPAWGRPVVGGLLLIPLALASPQVLSSGHGALHLDLTTHLPLIWIGGLLTLKCLASGISLGFGFRGGLFFASLFMGTLVGALFAGLLGMATGVPVIDATSAALAGMAALAAAVVGAPMTMAMLVLEGTHDFLLTSVVMSAVLVSSTLVRQWFGYSFSTWRMHLRGETIKSARDVGWVQNLNAGRLMRKGVATTPADLDAAAFRQRFPLGSGSRVILIDSEGHYAGIVQIPRVYGDGVKPETMIGELAENRDVSLSPAADVVSVMQRFDQTQADELAVVGADGQVLGVVSEAFVRKRYAEELDKRQRELMGERVEDTD
>NZ_CP040436.1|WP_155029715.1|2666200_2668282_+|TonB-dependent-siderophore-receptor
MPILALQPARLPLAAALALCLLPTTRAFAQDGATTLDSIQVSGSWLGTGLHDSVKRFAGARTVVDRQRIEASGAASIGDAMRRIPGVQVTDNSGTAGSSVSLNIGVRGLTGRYSPRSTVLLDGVPLAVAAYGQPQLSFAPTSLSNIESIDVVRGGGAVRYGPQNVGGIINFSTRAIPTEAGLHGEAGVRYTAYDHGGGDSTQYNAFLGGTGDNGLGAALLYSGQDGRGWRRGSDDRFNDLALKFAYAIDAQQELRAKLSYYDVRSLTPGGLTRNQYEADPFQNTRPTDFWKGHRTGVDLGYTNTLSANSEFEVLAYYNESSRASSLINAANTQLTVQPRDYRVLGIEPRYTQRLHWGSSVHDITAGYRFLRERGNDRSYTVTRRTGVASATTRFDNATDAHAFYIDDRIAIGQWRITPGVRMEWIDMDRRQAGGAATFSSRNDKALPSLNIAYLLTPQLTVFGNYTTSFGPVQNIQLNSQTANNPLNPEIARTTELGARWQDGALRAEVTVFKMRFDNQILQVPGITPPTFQNIGATDHKGVESALEYHFAEDSALAGLELYANYTWTKAIQQSGDNRGLDVPFYSRDTDSIGARYALAGWTFNVSSTHQSGQFSDAANTWEETADARVGRVPGVRLWNAQVAWQVPGLGDSEIALGVNNLADKRWYTRNVDGNAGRMVAAPRTFYVQGRYRF
>NZ_CP040436.1|WP_155029714.1|2665148_2666069_-|DUF2817-domain-containing-protein
MSQAAFYPVGTPGQPWGAAEREVWRGRQQRLRRYDEEVLPRIEALASRFDKVAYGQLDYAGETYTLFALRSRDWNTALPAALVTGGVHGYETSGVMGALEFLEKHAADYAGKANLLVAPCVNPWGFERINRWNFDAIDPNRNFRADGPARESTALMELIAPIKDQFVLHIDLHETTDSDESEFRPALAARDGKPFEPGLIPDGFYLVDDSENPQAAFQQAVIAAVEKVTHIAPADDKGEIIGSPVVAHGVIEYPLVKLGLCAGITGATYTTTTEVYPDSPRATPQQCNDAQVAAVCAALDYALAHR
>NZ_CP040436.1|WP_155029713.1|2664228_2665080_+|LysR-family-transcriptional-regulator
MPYSPESLQAFVEAAALGSFSAAARRLRKTQSTVSTAIAHLEADLGVSLFDRSGRYPQLTEAGRQVLAHAQEILAADTRLQQLSVRLAAPVEARLTVVFSDVYQLDPEQRVLQRFAEAFPEIELEWLDAEGEDVLELVGSGRAALGLLPRQESYPDGLVARPLPHHSELSVYVARDHALADAGRRAASQLARYRQVRLSAEVDHARAVTGLAWTATDYLMVMEMAEDGIGWAELPRALVQRYDRGQLVELTLPGWPRRIHSDLLWRRDTPPGPAALWWADALG
>NZ_CP040436.1|WP_134735563.1|2663723_2664077_-|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter
MSRTVPARGALVAWACLTVAIVAEVVGTSFMAHAARDGGWTGYLIMAGALALSYFFLAQSVRRIAVGVAYAVWEGLGLTLLTVVGLTVFGESLSLQQLAGLMLAVAGIVCVTLGEAH
>NZ_CP040436.1|WP_155029721.1|2678967_2679948_-|helix-turn-helix-domain-containing-protein
MVDGGVGDSDDSGLRSIDLATLSGVLRVCDVELLLLDGNGPRAAFASRVHEEALFCSISCGFHCRGRFMLPPDWAMLGYLHATDETLSWCHGVPLAAGMALTVMPEGISEFTLSPGTHMTLMLVPAARVQRKLAELSLRSTPPAGQALSLFSLANEAAPLARHYQQLHLQLGQGSGLQPEEAERLLHEHVQALLGAGTADRPGCSRARRTHYLIAQRAENFMRLNLRRNIYMNEICDAAGVSERGLRYAFEDLFGTSPNRYLSMLRLCAACRSLSMADSSRRSVKAIALSCGLWDLSRFADNYRKVFGELPRDTLMRAPAQIGQPA
>NZ_CP040436.1|WP_021204284.1|2680632_2680824_+|Flp-family-type-IVb-pilin
MNASIRKFLKEEDGVTALEYGLLAAVIAGVLIALGSTQIQTFFSTLFENLTKLANKASGSTPA
>NZ_CP040436.1|WP_058982314.1|2680891_2681437_+|prepilin-peptidase
MTLLGLLAIGVCLRIAISDLYARRVPNAWLLSACAITVVVLIAGQFNAPRLPWASHVAGAALGLVALLPFHALRWMGAGDVKFFSVLGLMLGWQTLLPIWIAASLAAGAHAALVLASRRVGPVLPIGLQAQLNRASSQWHSHPALRDMQNARQGRHGIPYAAYLAVSAIAWILITTYGGVP
>NZ_CP040436.1|WP_058982316.1|2681433_2681910_+|pilus-assembly-protein-TadE
MNTPNPRRQRGAASIEFALMLMLGLLPLLLFTFSGVMIMAAQQTLATASAEGARASLRYGSANERRTAACIAARSSMQWLLNFSGQSVDCSNGGSNAILVSAQAPCAGLASAQCMTVTVSYDYASHPFLPGTATLYKWVMRAPIRSVAVAQLDLGSGN
>NZ_CP040436.1|WP_155029722.1|2681933_2682971_+|Flp-pilus-assembly-protein-CpaB
MLKLTRIAAVALIGLAVLLAVIALMIGRRQAAPATVAPAAQSEAQAITVVEAVARLPAGEPISANGLRLAQRSAPVAGAASSISAVVGKVPVQDIAEGTAISSNALAQGFSLQLRPGERALAVPVDELVGAGNRIVPGDFVDVFLNLRNAQPNASGPADAAQTRLLLSRLRVLSYGQQDIALANAGAVARTEADARNDPRAADITGSSSTQSTGSETTQPARSAVLAVPVADANRLLLGAQQGKLFLALRNPADPGQPDLALFPQARGVIDPLRGLDAEQQLALQRPENHAYAGIDGDALAGRSNTPARSTQDATARTPAPRRSAPRASGIEIIRGDSSAPRGSL
>NZ_CP040436.1|WP_111102426.1|2682989_2684348_+|type-II-and-III-secretion-system-protein-family-protein
MTERRRSPRPSPRQRWLALLLVLLAPATSVAADDLVLQTREQRPWPLPGDLERVAIADPGVADIVMLRGQRQALLVGKAPGTTTLLLWHRKQAEPQRLQVRVQSAVQGAADAGANGLVFTQQDNQGLLQGSTDSVLSHMQEQKTAAMALGKDGLLADASTVSSGGVVQVEVKVVEFNKTALKQIGISFQNRNGNFAYGFARPGGQLPGNTGILPGMQEGNSSNEAESPISSAFRLVFGSTKGLWNADVDLLQSNGMARVLAEPTLVALSGQSASFLAGGELPILEPQGLGTTTITYKPFGIGLTVTPTVLAPNRIALKVAPEASDLDYSNAIALNGVQIPSITTRRADTTVELGDGESFVIGGLVSSNVVSSVGKIPLLGDLPVIGSFFRNFDYKRQDKELVIIVTPRLVKPLARNTELPLPGDREAKPHMPEWGAWLLGPISQDPVPGFSR
>NZ_CP040436.1|WP_019659961.1|2684375_2685632_+|fimbrial-protein
MPYATAQPLHPQGPPMNLVLYGMDRELLPRLAAKLPPTTTLHWQDSSAPTSAQDLHRGPQNLVLLDFRPEHAAASSVLAQQLQQTEPDLALVAVGATSAGQVEGVVIALRAGLRDVLDLDSDNAGVEAALRRALSPRPAAAAQHAHKARLIVLLGVRAGVGTSTMAAHLSVLAQQTRALAQGEAVQQDGLLMELAQPSGDLALYLNLDSRFHYEDALRNASRIDATLARTAMARHDSGLVLLDRASGSDAVPPSDPGALLQRLRTVFASVLCDAGGCPVRQLPPLLLDQADEIWLVTDASIATLVSLDQALKHLAGQREREKRLQLVINRHDDSSGMSPEQIARRFEVPLLATLPERPRVRLSASQGHLLLQDAPRDPYLRALAPLVSRLDPAACRVQAQGLRERLSLALGGSQWKTR
>NZ_CP040436.1|WP_019659962.1|2685616_2686966_+|CpaF-family-protein
MEDKVTPFPHAVARPVLPESTPGHQPFAQTEQYQKVLSAAHEHLLNSIEDERIDIDSWAPDTIARWVQVQTVGFIQEWRIPINEEEMQVVADGLVKELTGFGPLDDLLHDPSIEDILINGFKDVHVSQGGQLKRATQRFTDDTHLLRILRRILAPLGRRLDDSNPMVDARLPNGGRLNAIISPLAVDGPMVSIRKFRKDPFTPDELLAKGTFDEPMHALLKAMVLGRCNILVSGGTSSGKTSLLNALASYVPANERVITVEDTAELSLNHPHVVRLESRIGGAEGHGAVSIRDLVRNSLRMRPDRIVVGEVRGAEVLEMLQAMNTGHDGSMATIHANSPRDCLYRIEMLAGFAGFQGSEDSLRRQIASAIDFIVQISRLGSGRRVLVSITEITGVSDNLITTQEMFRHELQIDGNGKEIDRWVGLGFHPHSHKLEPFRQQLRESLYGDF
>NZ_CP040436.1|WP_155029723.1|2686968_2687925_+|pilus-assembly-protein
MGTGALLGMLSIIAVLLALAAWLWGTASSREQRQVSMRHAEQQLSRGSATGGAPAGPSVTAANDPVRPASTGRRVLPLDGLLQRAGLQTGWKIPIMLLVPGLVLSVVAMARLGTAWMFPLTLLLYLLGCWLWVMRRTTKLRAQLLHQLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRFARSGMELDRALAQAAQPYRMEVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELSATTSETRMSAWVLGLLPPACAVLMAIASPDFFQPVLHDPLGHKILLLALGMELVGGFLLYRLAKSL
>NZ_CP040436.1|WP_155029724.1|2687950_2688886_+|type-II-secretion-system-F-family-protein
MSASAWFALSLLVLAAGIALLGIGGWIRSHREQRTTATLKTALQPRDTSRDTEPARHDSLGWLERFGRALSGGRLETALLANEDRLLLDLAGWNTRRGTAIYLGLRLLLAVLVLALVLTFSSVTGLARIMVIIGALAAGLLLPKFVLSSWVKRRRRAVETELPLLIDLLRLLQGVGFSMDQSLQTLGDKLRDALPVLGSELQEANVAYTHGRTRAQSLRRLSEVYADDDLTSLMQLILQVHAHGGAVQEPLRQFSLRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPALVALATTLSKMGSP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040436_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040436_2

3594560-3594674

Orphan

Consensus_repeat	Method
GAGCGGTGCGAACCAAGGTTCGCACCCACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040436_2

>merge|NZ_CP040436|2|3594560-3594674|CRISPRCasFinder
GAGCGGTGCGAACCAAGGTTCGCACCCACCAAGTCAGATCCCGCATCGGTAGCGTCGGGCCAATGCCCGGCAAGCGCAGCGGCACGAGCGGTGCGAACCAGGGTTCGCACCCACC

>NZ_CP040436|2|2|3594560-3594674|CRISPRCasFinder
GAGCGGTGCGAACCAAGGTTCGCACCCACC	AAGTCAGATCCCGCATCGGTAGCGTCGGGCCAATGCCCGGCAAGCGCAGCGGCAC
GAGCGGTGCGAACCAGGGTTCGCACCCACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040436.1\|WP_111098279.1\|3597797_3600923_-\|efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223911
NZ_CP040436.1\|WP_155030033.1\|3602297_3604361_-\|TonB-dependent-copper-receptor	unknown	unknown	gnl\|CDD\|273801
NZ_CP040436.1\|WP_019660189.1\|3591320_3591602_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_134731273.1\|3604433_3604865_-\|DUF2946-domain-containing-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_155030034.1\|3607829_3608429_+\|O-acetyl-ADP-ribose-deacetylase	unknown	unknown	gnl\|CDD\|394878
NZ_CP040436.1\|WP_019660022.1\|3605466_3606450_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|183677
NZ_CP040436.1\|WP_134731279.1\|3594683_3595517_-\|rRNA-methyltransferase	unknown	unknown	gnl\|CDD\|236779
NZ_CP040436.1\|WP_019660183.1\|3584883_3586737_-\|autotransporter-domain-containing-esterase	unknown	unknown	gnl\|CDD\|238883
NZ_CP040436.1\|WP_019660197.1\|3600919_3602026_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP040436.1\|WP_019660185.1\|3587251_3588046_+\|thiazole-synthase	unknown	unknown	gnl\|CDD\|234687
NZ_CP040436.1\|WP_019660021.1\|3606656_3607616_+\|cysteine-synthase-A	unknown	unknown	gnl\|CDD\|273465
NZ_CP040436.1\|WP_019660190.1\|3591677_3592394_+\|fumarylacetoacetate-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223257
NZ_CP040436.1\|WP_155030030.1\|3588045_3588780_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP040436.1\|WP_019660191.1\|3592448_3592853_+\|large-conductance-mechanosensitive-channel-protein-MscL	unknown	unknown	gnl\|CDD\|234795
NZ_CP040436.1\|WP_155030032.1\|3597208_3597805_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP040436.1\|WP_019660184.1\|3586944_3587145_+\|sulfur-carrier-protein-ThiS	unknown	unknown	gnl\|CDD\|168159
NZ_CP040436.1\|WP_019660187.1\|3588807_3590655_+\|SLC13-family-permease	unknown	unknown	gnl\|CDD\|238535
NZ_CP040436.1\|WP_021202003.1\|3595517_3597029_-\|alanine:cation-symporter-family-protein	unknown	unknown	gnl\|CDD\|376500
NZ_CP040436.1\|WP_155030031.1\|3590806_3591142_-\|Rieske-2Fe-2S-domain-containing-protein	unknown	unknown	gnl\|CDD\|239550
NZ_CP040436.1\|WP_019660192.1\|3593097_3594519_+\|M28-family-peptidase	unknown	unknown	gnl\|CDD\|349879

Protein	Function_ID	Function_description	E-value
NZ_CP040436.1\|WP_111098279.1\|3597797_3600923_-\|efflux-RND-transporter-permease-subunit	gnl\|CDD\|223911	COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms].	0
NZ_CP040436.1\|WP_155030033.1\|3602297_3604361_-\|TonB-dependent-copper-receptor	gnl\|CDD\|273801	TIGR01778, TonB-copper, TonB-dependent copper receptor. This model represents a family of proteobacterial TonB-dependent outer membrane receptor/transporters which bind and translocate copper ions. Two characterized members of this family exist, outer membrane protein C (OprC) from Pseudomonas aeruginosa and NosA from Pseudomonas stutzeri which is responsible for providing copper for the copper-containing N2O reducatse. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	0
NZ_CP040436.1\|WP_019660184.1\|3586944_3587145_+\|sulfur-carrier-protein-ThiS	gnl\|CDD\|168159	PRK05659, PRK05659, sulfur carrier protein ThiS; Validated.	5.34231e-31
NZ_CP040436.1\|WP_155030034.1\|3607829_3608429_+\|O-acetyl-ADP-ribose-deacetylase	gnl\|CDD\|394878	cd02908, Macro_OAADPr_deacetylase, macrodomain, O-acetyl-ADP-ribose (OAADPr) family. Macrodomains are found in a variety of proteins with diverse cellular functions, as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Macrodomains can recognize ADP-ribose (ADPr) in both its free and protein-linked forms, in related ligands, such as O-acyl-ADP-ribose (OAADPr), and even in ligands unrelated to ADPr. This family includes eukaryotic macrodomain proteins such as human MacroD1 and MacroD2, and bacterial proteins such as Escherichia coli YmdB; these have been shown to be O-acetyl-ADP-ribose (OAADPr) deacetylases that efficiently catalyze the hydrolysis of OAADPr to produce ADP-ribose and free acetate. OAADPr is a sirtuin reaction product generated from the NAD+-dependent protein deacetylation reactions and has been implicated as a signaling molecule. By acting on mono-ADP-ribosylated substrates, OAADPr deacteylases may reverse cellular ADP-ribosylation.	8.25908e-90
NZ_CP040436.1\|WP_019660022.1\|3605466_3606450_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|183677	PRK12680, PRK12680, LysR family transcriptional regulator.	0
NZ_CP040436.1\|WP_134731279.1\|3594683_3595517_-\|rRNA-methyltransferase	gnl\|CDD\|236779	PRK10864, PRK10864, putative methyltransferase; Provisional.	4.6656e-71
NZ_CP040436.1\|WP_019660183.1\|3584883_3586737_-\|autotransporter-domain-containing-esterase	gnl\|CDD\|238883	cd01847, Triacylglycerol_lipase_like, Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.	6.1849e-66
NZ_CP040436.1\|WP_019660197.1\|3600919_3602026_-\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.75098e-69
NZ_CP040436.1\|WP_019660185.1\|3587251_3588046_+\|thiazole-synthase	gnl\|CDD\|234687	PRK00208, thiG, thiazole synthase; Reviewed.	2.36907e-166
NZ_CP040436.1\|WP_019660021.1\|3606656_3607616_+\|cysteine-synthase-A	gnl\|CDD\|273465	TIGR01139, Cysteine_synthase, cysteine synthase A. This model distinguishes cysteine synthase A (CysK) from cysteine synthase B (CysM). CysM differs in having a broader specificity that also allows the use of thiosulfate to produce cysteine thiosulfonate. [Amino acid biosynthesis, Serine family].	1.81446e-165
NZ_CP040436.1\|WP_019660190.1\|3591677_3592394_+\|fumarylacetoacetate-hydrolase-family-protein	gnl\|CDD\|223257	COG0179, MhpD, 2-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway) [Secondary metabolites biosynthesis, transport, and catabolism].	3.60326e-75
NZ_CP040436.1\|WP_155030030.1\|3588045_3588780_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	3.45739e-88
NZ_CP040436.1\|WP_019660191.1\|3592448_3592853_+\|large-conductance-mechanosensitive-channel-protein-MscL	gnl\|CDD\|234795	PRK00567, mscL, large-conductance mechanosensitive channel protein MscL.	7.72793e-68
NZ_CP040436.1\|WP_155030032.1\|3597208_3597805_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.22592e-27
NZ_CP040436.1\|WP_019660187.1\|3588807_3590655_+\|SLC13-family-permease	gnl\|CDD\|238535	cd01115, SLC13_permease, Permease SLC13 (solute carrier 13). The sodium/dicarboxylate cotransporter NaDC-1 has been shown to translocate Krebs cycle intermediates such as succinate, citrate, and alpha-ketoglutarate across plasma membranes rabbit, human, and rat kidney. It is related to renal and intestinal Na+/sulfate cotransporters and a few putative bacterial permeases. The SLC13-type proteins belong to the ArsB/NhaD superfamily of permeases that translocate sodium and various anions across biological membranes in all three kingdoms of life. A typical ArsB/NhaD permease is composed of 8-13 transmembrane helices.	9.62114e-45
NZ_CP040436.1\|WP_019660192.1\|3593097_3594519_+\|M28-family-peptidase	gnl\|CDD\|349879	cd03883, M28_Pgcp_like, M28 Zn-Peptidase Plasma glutamate carboxypeptidase. Peptidase M28 family; Plasma glutamate carboxypeptidase (PGCP; blood plasma glutamate carboxypeptidase; EC 3.4.17.21) subfamily. PGCP is a 56kDa glutamate carboxypeptidase that is mainly produced in mammalian placenta and kidney, the majority of which is thought to be secreted into the bloodstream. Similar proteins are also found in other species, including bacteria. These proteins contain protease-associated (PA) domain inserts between the first and second strands of the central beta sheet in the protease-like domain. The PA domains may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. The exact physiological substrates of PGCP are unknown, although this enzyme may play an important role in the hydrolysis of circulating peptides. Its closest homolog encodes an important brain glutamate carboxypeptidase II (NAALADase) identical to the prostate-specific membrane antigen (PSMA), which serves as a marker for prostatic cancer metastasis. Hypermethylation of PGCP gene has been associated with human bronchial epithelial (HBE) cell immortalization and lung cancer. PGCP also provides an attractive target for serological analysis in hepatitis C virus (HCV)-induced hepatocellular carcinoma (HCC) patients.	0
NZ_CP040436.1\|WP_155030031.1\|3590806_3591142_-\|Rieske-2Fe-2S-domain-containing-protein	gnl\|CDD\|239550	cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes. The Rieske domain can be divided into two subdomains, with an incomplete six-stranded, antiparallel beta-barrel at one end, and an iron-sulfur cluster binding subdomain at the other. The Rieske iron-sulfur center contains a [2Fe-2S] cluster, which is involved in electron transfer, and is liganded to two histidine and two cysteine residues present in conserved sequences called Rieske motifs. In RO systems, the N-terminal Rieske domain of the alpha subunit acts as an electron shuttle that accepts electrons from a reductase or ferredoxin component and transfers them to the mononuclear iron in the alpha subunit C-terminal domain to be used for catalysis.	1.03249e-18
NZ_CP040436.1\|WP_021202003.1\|3595517_3597029_-\|alanine:cation-symporter-family-protein	gnl\|CDD\|376500	pfam01235, Na_Ala_symp, Sodium:alanine symporter family.	0

>NZ_CP040436.1|WP_019660192.1|3593097_3594519_+|M28-family-peptidase
MRRRVLAIASSLALLAAPAFAAPHTTTLPPASLATAAQLRDQALADDTGWKVVESLTTEIGPRIAGSEADARAVAWAEAKFKALGFDKVWKEPVTFPKWERRSEHAAVTGKNPQPLQITALGGSPGGTVEAEVVRFADLAALQAAPAGSLKGKIAFVDYQMLPFRDGRDYGRGGAIRSKGPSEAIRKGAVGFLMRSAGTDSHRVPHTGITRFDDGLTPVPSAALSVPDADQLARLLARGSTTVKVALDCGWDGTATSYNVIGEITGRSLPKEVVVIGGHLDSWDLGTGAVDDGAGVGITMAAGHLIGQLKQAPKRTIRVIAFANEEQGLYGGKAYAEAHAKDVALHQLAAESDFGAGRIYAFNTGSPNPEGSREATKQIAEVMKPLGIEYQADKGGPGPDVGPLAAKGGAWAWLAQDGSDYFHLHHTADDTLDKIDPKALAQNVAAYTVFAYLAAEADGSFGSEAKATTPPNE
>NZ_CP040436.1|WP_019660191.1|3592448_3592853_+|large-conductance-mechanosensitive-channel-protein-MscL
MGMLTEFKEFAMRGNVIDLAVGVVIGAAFGKIVTALVEKIIMPPLGLLIGKVDFSQLAWTLSPARIGPDGKEIPAVVIGYGDFINTLIQFVIVAFAIFIVVKAINRLSRKKEAAPAAPAEEVVLLREIRDSLKK
>NZ_CP040436.1|WP_019660190.1|3591677_3592394_+|fumarylacetoacetate-hydrolase-family-protein
MSDVSDVIPAVALPRVPVAGGGSFPVHRIYCVGRNFADHAREMGAAVPAADDRGRPMFFSKPADAIVVGHDDAIPYPPATANLHHEVELVVAIGRDAPAGELAVADADALVYGYAVGLDLTRRDLQAAAKDKGHPWDAAKGFDASAPISEIVHAEEVGDLAALNLSLEVNGEVRQQALLDQMIWNVPEILHELSKLWQLRAGDLVFMGTPSGVAALKPGDRFSARLENVAERHGVIAG
>NZ_CP040436.1|WP_019660189.1|3591320_3591602_+|hypothetical-protein
MFNRASAFNQFRTLFAPRKPRHPLVRVAVGLLGLAILAAMVFIGVFVGAAMILVGLAWKLLASRKPGAARPVDPTVVEGEYRVVRKPVLPASR
>NZ_CP040436.1|WP_155030031.1|3590806_3591142_-|Rieske-2Fe-2S-domain-containing-protein
MTAAASLIALDAIADGAFAEVEAVVDGDAESLVLYRDGAQVRAFLNICPHAGRRLDWAPGQFLKSREGHLVCAAHGASFTLDSGDCIAGPCKGDRLRAVPVDIRDGQVYLA
>NZ_CP040436.1|WP_019660187.1|3588807_3590655_+|SLC13-family-permease
MDTALTLTNDMKLVLGLVGFTMAMFLFERIRADVVALVVLVVLGVTGLIAPEEIFGGFSGNAVMSIIATTILGAGLDRTGALNRLAAWLLRRGHGVEQRLLMMTTAIAGLNSSFMQNPSVMALYLPVASRLAARTGLTMQRLLLPISAAIVMGGALTMVGNSPLILLNDLLASANNNLPSGLATIEPLRMFAPLPIGVALLIASLLYFRYYGDRKLIEEETLVNDGVTPARTESYFAKTYGIEGDVFELVVSAESPLVGMTLGEAENLHDAPLLLALKTGNDTRLAPPAEMRIWVGSVLGAMGPRQQINDFAQNQFLRMSSRLKHLGDLFNPSRAGISEAVVPPTSNVIGKSAADLRLRKERGISLLAINRDKQVIREDVRDVQLRAGDMLVFHSIWTDLAQAAKSRDFVVVTDYPTGEQRPHKFKIAMAIFALTILIALTSKLPVALTLMTGVAGMLLTGVLRMDEAYASINWKTVFMMAGLIPLGWAMDSSGAAAWVAGHTIDKLPTGIPVWVLEVALALLTTAFSLVISHVGATIVMVPIAVNLALAAGGNPTAFALIVALSASNNLMTASNPVISMITGPANYTPREMWRVGGPLSLIYTCVVVLMINLMF
>NZ_CP040436.1|WP_155030030.1|3588045_3588780_+|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MTNPFESAGSKAPPKPFTVSEGRREVRSFVLRQGRFTPAQQRAFDERWPRFGLDYTGQPRDLDATFGRPAHKVLEIGFGNGAALRFAAQHDPSRDYIGIEVHAPGVGRLLNALAEDNADHVRLYHHDAVEVLQNEIADGALDEVRIYFPDPWHKKRHNKRRLLQPAFAELLVRKLRPGGRLHCATDWEDYAEQMWDVLDATAGLVNRAGPRGSVPRPDWRQQTHFETRGQKLGHGVWDLLYDRT
>NZ_CP040436.1|WP_019660185.1|3587251_3588046_+|thiazole-synthase
MNVHVSPDSLVIAGKTYGSRLLTGTGKFKDLEETRLATEAAGAQIVTVAIRRTNIGQNPGEPNLLDVLPPERFTILPNTAGCYTAEDAVRTCRLARELLDGHNLTKLEVLGDQKTLYPDVVQTLKAAEQLVKDGFEVMVYTSDDPILAKRLEEIGCAAVMPLAAPIGSGLGIQNKYNLLQIIEDAKVPIIVDAGVGTASDAAIAMELGCDGVLMNTAIAGARNPVLMATAMRKAVEAGREAFLAGRIPRKRYASASSPVDGLIG
>NZ_CP040436.1|WP_019660184.1|3586944_3587145_+|sulfur-carrier-protein-ThiS
MNIQLNGEPRTLPASATLHDLLEAEQLLQRRVAVEVNGEIVSRSRHREHVLAEGDIVEIVHALGGG
>NZ_CP040436.1|WP_019660183.1|3584883_3586737_-|autotransporter-domain-containing-esterase
MQLSKHPIRSLMAAAIALAALPAMAGESPYSKAVFFGDSLTDAGYFRPLLDPGVQPVTGQFTTNPGWVWAQQVANYYGLNGGANGNGQSGDNYAVGGARVSVDEAGGLGVIPSLKSQATRYLAANGGKADGNALYTVWGGANDLFAATRAAAGGASQAQVQGIIGAAVTDQIALVGALKQAGAQYVLVPNLPDVGITPQFRGPNAAAATALSAGYNKALYGGLKQAGIEFIPLDTFSILREVTANPGMYGFTNVTSTACRIDPNNSTASIIGCNPTSYVSPDAANTYLFADGVHPTTAGHQLLGQYAVSVLEGPRLQQVLSHSAQTIGRSRADQVSMHLGGRPADGLSWWGGVRGDLQRYDHADLYDGLAPAGLFGIDWARDGMVFGGFAGFGRLNADFGNSRGDFTQKDTTAGLFAGWYGDRIWINGQVSYTWLSYDVNRKVQLGPATREHGGSPDGSNLTAALNAGYEFGTEGGFRHGPIASVIWQKVKIDGYTESAAAGTLATALGYDRQNVDSTVGRIGWQARFDGGTVKPYAQVTYDHEFEDTKQASAWLQTLPELGSYRVPGLNFDKNYATVVLGARTELFGLQSNFGLSASAGQKRAQDATLFANFSGSF
>NZ_CP040436.1|WP_134731279.1|3594683_3595517_-|rRNA-methyltransferase
MNNPWNNRRPSARPPRATPLPRPEVPATGGGGRGGSDELRLYGLNAVLAAFEARPQALRKLYLLEARIPRLQPLLKWCVANRVGYRVVEDGDLNKLAGTTHHEGVVADMLRAPALPLAQWLQQVGDGPALALWLDGVGNPHNLGAILRSAAHFGAKALLLPAGSTLALSGAAARVAEGGAEAVPLVQLPETAQAMAQLRAAGFGLAATLVEGGDDVFRASLPDRLVYVMGAEGEGMDRGLASQCDLQVSIPGSGAVESLNVASATAVLLAQWASRRG
>NZ_CP040436.1|WP_021202003.1|3595517_3597029_-|alanine:cation-symporter-family-protein
MEATVHFINSIIWSKALIFVCLGAGLFFSLRTRFMQIRGFFEMCRLTVRGEKSDAGVSSFQALAMSMAGRMGIGNIAGVATAIAFGGPGAIFWMWVMGFLGASTSYVECTLAQIYKTKDAEGRYRGGPAYYIEKAMGLKWYALAFAIATIIAAGFLMPGVQANAIADSIINACRGTALCGPLDGQAFGMESVQALKLGIGIVVALLLGVVIFGGVKRIANFAEVVVPFMAAGFILMAIIIMVINYDRVPEMFGIIFQSAFGTHAAFGAMMGLAVEWGIKRGIYANEAGQGSGPHAAAASEVSHPAKQGYVQAFAIYFDTMMVCTATAFLILASGTYNVYSPAGASAPPIFQGLAGIPEGAGYAQAGVEAVLPGWGSAFVSIAIFFFAFTTIMAYYYMAETNLSYVNHNRKRPLTVLVLRLGIIGMVVFGAFHNATLAWALGDIGVGLMAWLNIIAILIIQKPAMLALRDYERQKKLGLDPVFDPDALGIKNADFWRQRKQESV
>NZ_CP040436.1|WP_155030032.1|3597208_3597805_-|GNAT-family-N-acetyltransferase
MPDPRADGGDPGGGSLSGTERALTRPLQGDGFQLRPWRPDDLDSLLRHANDAEVSRGLRDRFPYPYTRGDGEAFLAGRVLAPGTLNLAIEIDGQACGSVGAQQGVAERGHTAELGYWLGRAYWGQGLMTRVVGVFAPWVMDELRLFRLQATVVDFNLGSARVLEKNGFQEEGVERCAVYKRGVLHDLRRFARVRTQLP
>NZ_CP040436.1|WP_111098279.1|3597797_3600923_-|efflux-RND-transporter-permease-subunit
MKLSDISIQRPVFAVVMSLLLLVLGVMSFTRLTLRELPAIDPPIVSVSVDYTGASAAVIESRITQVLEDALAGIEGIDTINARSTNGRSQVSIEFTSNRDIEAAANDVRDAVSRVADRMPEEARPPEIAKVESDADPIIWFNMVSSTMDTLELSDYADRYVVDRFSSLDGVAQVRIGGRQRYAMRIWLDRDQLAARGLTTGDVETALRNENVELPAGRIESTDRDFTLRVERNYIKPEDFATIPLGKGRDGYVVRMGDVAKIELASAERRAYYRSNGEPGIGLGIVKTSTANSLDVARTARAEAERVALTLPKGTQIFVAFDNTTFIEAAVDRVYATLVEAMILVLAVIWLFLGSFRAALIPAVTVPVCLVAAFIALYAFDFSINLLTLLALVLCIGLVVDDAIVVVENVQRRIDLGEPPLVASKRGTTQVAFAVIATTAVLVAVFLPVGFLEGNTGRLFRELAVALAAAVALSAFVALTLTPMMASKLLKPHTGQAPRGLHGFINRNLERLASGYGRVLDHHVDRTWIYLLVMVAALAASWGLLKLLPSELAPAEDRGSFQIMIDGPEGAGYDYTVQQVQQVEALLAPHVGPDKPIVRANPRVPGGWGASEEMHTGRVSIFLQPWRQRSEGTPEVADALQKELDTIRGVRVRTQVGGGLVRSGGQPFQIVLGGPEYAEIAQWRDRILLRMADNPGLVGPDSDYKETRPQMRVNIDRQRAADLGVPVTAIGSALETMMGSRRVTTFVDNGEEYDVLVQAGRDGRASPADLAAIRVRATSGELVPLSNLVTLSEVAEAGTLNRFNRLRSITISAGLAPGYPLGEAIAWAQNVAREELPQYAQVNWKGESREYQSAGGAVLLTFAMALLVVYLVLAAQFESFIHPLTIMLTVPLGVLGALVGLWVSGGTVNLFSQIGIVMLVGLAAKNGILIVEFANQLRDDGRTVREAIIESAMVRLRPILMTSIATVVGAIPLVVAGGPGSASRGTIGIVIIFGVTLSTFLSLFVVPAFYARLAPYTRSPEAVKRELEKQEAESPSVGGHA
>NZ_CP040436.1|WP_019660197.1|3600919_3602026_-|efflux-RND-transporter-periplasmic-adaptor-subunit
MLARIASTLALGLSLALLAGCGGKQEAAARRQGEAVPVTAQVVQSSQWNDTLQALGTAKARESISVTAKVSEIVEKVHFESGQHVAAGAPIVTLRGQAQEAALVQAQATFHEADQLYRRQRELASQRLVSSATLDTQKSIRDAAEARVMQMQADIGDRRVRAPFAGVLGIRQVSPGSLVTPTTVIATLDDIEHMHVDFQVPEVELAALGVGDKVSATSVAWPGRTFEGEVSTIDARIDPVTRAVTVRADFANGDHALRPGMLLDVRLFRPERPALVVPEIAVVQVGRDTFVYRIKADDSVERVDVVTGARRAGVVEIKQGLEAGQRIVVDGTGKLRPGLKVAARDAAPASGAKPDAAPAPAAAEGHGG
>NZ_CP040436.1|WP_155030033.1|3602297_3604361_-|TonB-dependent-copper-receptor
MKMTSRPAGACARLPVALGLAVAASLAHAAPAEEARTLDTMVVTAAAPSSPLHWVTDPRLPRQPVPASDGADYLKTVPGFSAIRNGGTNGDPVLRGMFGSRLNILSNDGNLIGACPSRMDNPLSYIAPESFDRLTIIKGPQSVRWGAGASAGTIRFERDTPRFEEPGLRADASGLVGSRNRNDQVLDLTLGNPAGYVRASGNRSEADDYKDGHGDVVPSKWRKWNGDVAIGWTPDAETLLEISAGAGDAIARYAGRGMDGAAFERTSYAARFEKRNLLGAWETLQANVYYNEADHVMDNYTLRTPNPNSMMPMPMASNVDRRTQGGRASSEWRWQEVQLVAGVDGEDSRHRGRNGMGRGTYRQAAWQTDANFHRYGVFTELTLGAGTDQRWISGLRIDRASARDERQSIGGMMGNRPNPSAGQTRKEWLGSGFLRYEQDLADGLTWYAGLGHSERMPDYWELFSPDHGPSGAVNAFTGVQPERTTQLDMGLQFKGPRVQAWVSAYAGQIQDYILFTYHGSGMMGMSQASNVDARIAGAEAGLEVSLAAQWKLGGTLAYAWGENRDQQRPLPQMPPLEARLSANWEGQRWSAGALLRAVTHQHRVADGQGNVVAQDLGPSAGFATFALNAAYRFSSQLQLSAGVDNLFDRAYSEHLNLAGSADFGFPADPVRINEPGRSLWMKVNYRY
>NZ_CP040436.1|WP_134731273.1|3604433_3604865_-|DUF2946-domain-containing-protein
MTRLSRPQRLLLQLAVLATLLMVLAPLVSRALQAPPMDHTAMAGMDHAAMGHGMHDMTMAGHDPHGASQAAPNRPADPHAMHGEVCEYCVLAMRLLPWLAVLVLQLPLLWRPRLVFPWSQQVLPALRWPAHAARGPPRSSIVR
>NZ_CP040436.1|WP_019660022.1|3605466_3606450_-|LysR-family-transcriptional-regulator
MTLTQLRYLVAIADAELNITLAASRVHATQPGLSKQLKQLEDELGFLLFVRKGRSLESVTPAGTEVIARARAVLAEANNIRTYAANQRRESQGQLILTTTHTQARFVLPPAVAAIKQAYPQVSVHLQQAGEADALDRLNQGDADIAIISTAGGEPTDGIAVPLFRWRRLVVVPKGHPLDRAGRAPDLAALARQPLISYESSTRPNSSLQRAFAANGLVPDLALTALDADLIKTYVRTGLGVGLLAEMAVSSNDEDLRSWPAPDPIAECIAWAVLPRDRVLRDYALELVHVLAPQIDPRDLRRVLDGNQAAAWPVPPTWESLTQTITV
>NZ_CP040436.1|WP_019660021.1|3606656_3607616_+|cysteine-synthase-A
MALYESILDTVGNTPIVRLQRLAPPQVSVYAKVESFNPGGSVKDRLALAIILDAEARGLLKPGDTIVEATSGNTGVALAMVAAARGYKFVATMVETFSVERRKLMRAYGAKVILTPAAERGSGMVRKARELAEQHGWFLASQFANPANPAYHRNTTAAEILRDFAGKRLDYFVSGWGTGGTLTGVGEVLKVARPQTRVIATEPAGAALLKGDDWKPHKIQGWTPDFVPDVLNRDVVDELVSVEDDRAIATARRLAAEEGIFVGISAGATVASALDVAARAEPGSVILAMLPDTGERYFSTPLFADVNEGSDDDWLAGLP
>NZ_CP040436.1|WP_155030034.1|3607829_3608429_+|O-acetyl-ADP-ribose-deacetylase
MKIEVWQGDITTLTVDAIVNAANETLLGGGGVDGAIHRAAGPALRAECERLPELRPGVRCPTGEVRATGAYALPARHVLHTVGPVWHDGQRDEPALLANCYWKSLQLAESLGVQSIAFPAISCGVYGYPLYQAAQIAVTETLAWQRSHARPMRIVLVAFNTATAKAYQQALSAAGQGADGEPRGSMLSPLGDAGFAAAH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040436_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040436_3

3905509-3905623

Orphan

Consensus_repeat	Method
GTTGCCGGCCAGCGGCCGGCACTACCGGGGC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040436_3

>merge|NZ_CP040436|3|3905509-3905623|CRISPRCasFinder
GTTGCCGGCCAGCGGCCGGCACTACCGGGGCAGCAGGATCAGGGGAGGATGCGGGGGCAACAGACCTCGTTTGCGACGAGGGCTGTTGCCGGCCAGCGGCCGGCACTACCGGGGC

>NZ_CP040436|3|3|3905509-3905623|CRISPRCasFinder
GTTGCCGGCCAGCGGCCGGCACTACCGGGGC	AGCAGGATCAGGGGAGGATGCGGGGGCAACAGACCTCGTTTGCGACGAGGGCT
GTTGCCGGCCAGCGGCCGGCACTACCGGGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040436.1\|WP_155030136.1\|3897174_3898446_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	unknown	unknown	gnl\|CDD\|223868
NZ_CP040436.1\|WP_021203736.1\|3898442_3899588_-\|lytic-murein-transglycosylase-B	unknown	unknown	gnl\|CDD\|274066
NZ_CP040436.1\|WP_155030138.1\|3902924_3904997_-\|penicillin-binding-protein-2	unknown	unknown	gnl\|CDD\|274573
NZ_CP040436.1\|WP_019660684.1\|3905000_3905486_-\|rod-shape-determining-protein-MreD	unknown	unknown	gnl\|CDD\|225444
NZ_CP040436.1\|WP_155030137.1\|3901815_3902928_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP040436.1\|WP_019660686.1\|3908031_3908970_+\|carbohydrate-kinase-family-protein	unknown	unknown	gnl\|CDD\|238917
NZ_CP040436.1\|WP_155030135.1\|3895853_3897074_-\|serine-type-D-Ala-D-Ala-carboxypeptidase	unknown	unknown	gnl\|CDD\|224600
NZ_CP040436.1\|WP_005411067.1\|3893999_3894278_-\|YbeD-family-protein	unknown	unknown	gnl\|CDD\|179161
NZ_CP040436.1\|WP_005419402.1\|3906701_3907748_-\|rod-shape-determining-protein	unknown	unknown	gnl\|CDD\|237562
NZ_CP040436.1\|WP_019660690.1\|3912733_3913495_-\|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE	unknown	unknown	gnl\|CDD\|234689
NZ_CP040436.1\|WP_155030140.1\|3910669_3912598_-\|aminopeptidase	unknown	unknown	gnl\|CDD\|341062
NZ_CP040436.1\|WP_155030139.1\|3909810_3910542_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_134729970.1\|3900572_3901667_-\|rod-shape-determining-protein-RodA	unknown	unknown	gnl\|CDD\|274033
NZ_CP040436.1\|WP_019660675.1\|3893301_3894012_-\|lipoyl(octanoyl)-transferase-LipB	unknown	unknown	gnl\|CDD\|237681
NZ_CP040436.1\|WP_021203905.1\|3914226_3914487_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_021203904.1\|3914562_3914898_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_019660693.1\|3914965_3915388_+\|low-affinity-iron-permease-family-protein	unknown	unknown	gnl\|CDD\|377225
NZ_CP040436.1\|WP_021203734.1\|3894541_3895615_+\|lipid-A-deacylase-LpxR-family-protein	unknown	unknown	gnl\|CDD\|378338
NZ_CP040436.1\|WP_134730128.1\|3909190_3909811_-\|HAD-family-hydrolase	unknown	unknown	gnl\|CDD\|223620
NZ_CP040436.1\|WP_005419409.1\|3913575_3914028_+\|nucleoside-deaminase	unknown	unknown	gnl\|CDD\|238612

Protein	Function_ID	Function_description	E-value
NZ_CP040436.1\|WP_155030136.1\|3897174_3898446_-\|septal-ring-lytic-transglycosylase-RlpA-family-protein	gnl\|CDD\|223868	COG0797, RlpA, Lipoproteins [Cell envelope biogenesis, outer membrane].	2.56016e-52
NZ_CP040436.1\|WP_021203736.1\|3898442_3899588_-\|lytic-murein-transglycosylase-B	gnl\|CDD\|274066	TIGR02282, Membrane-bound_lytic_murein_transglycosylase_B, lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	1.68458e-136
NZ_CP040436.1\|WP_155030138.1\|3902924_3904997_-\|penicillin-binding-protein-2	gnl\|CDD\|274573	TIGR03423, pbp2_mrdA, penicillin-binding protein 2. Members of this protein family are penicillin-binding protein 2 (PBP-2), a protein whose gene (designated pbpA or mrdA) generally is found next to the gene for RodA, a protein required for rod (bacillus) shape in many bacteria. PBP-2 acts as a transpeptidase for cell elongation (hence, rod-shape). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP040436.1\|WP_019660684.1\|3905000_3905486_-\|rod-shape-determining-protein-MreD	gnl\|CDD\|225444	COG2891, MreD, Cell shape-determining protein [Cell envelope biogenesis, outer membrane].	4.58195e-29
NZ_CP040436.1\|WP_155030137.1\|3901815_3902928_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	3.57452e-146
NZ_CP040436.1\|WP_019660686.1\|3908031_3908970_+\|carbohydrate-kinase-family-protein	gnl\|CDD\|238917	cd01942, ribokinase_group_A, Ribokinase-like subgroup A. Found in bacteria and archaea, this subgroup is part of the ribokinase/pfkB superfamily. Its oligomerization state is unknown at this time.	6.17048e-117
NZ_CP040436.1\|WP_155030135.1\|3895853_3897074_-\|serine-type-D-Ala-D-Ala-carboxypeptidase	gnl\|CDD\|224600	COG1686, DacC, D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane].	5.8131e-149
NZ_CP040436.1\|WP_005411067.1\|3893999_3894278_-\|YbeD-family-protein	gnl\|CDD\|179161	PRK00907, PRK00907, hypothetical protein; Provisional.	1.56476e-63
NZ_CP040436.1\|WP_005419402.1\|3906701_3907748_-\|rod-shape-determining-protein	gnl\|CDD\|237562	PRK13927, PRK13927, rod shape-determining protein MreB; Provisional.	0
NZ_CP040436.1\|WP_019660690.1\|3912733_3913495_-\|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE	gnl\|CDD\|234689	PRK00216, ubiE, bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE.	6.97097e-138
NZ_CP040436.1\|WP_155030140.1\|3910669_3912598_-\|aminopeptidase	gnl\|CDD\|341062	cd09599, M1_LTA4H, Peptidase M1 family including Leukotriene A4 hydrolase catalytic domain. This model represents the N-terminal catalytic domain of leukotriene A4 hydrolase (LTA4H; E.C. 3.3.2.6) and the close homolog cold-active aminopeptidase (Colwellia psychrerythraea-type peptidase; ColAP), both members of the aminopeptidase M1 family. LTA4H is a bifunctional enzyme, possessing an aminopeptidase as well as an epoxide hydrolase activity. The two activities occupy different, but overlapping sites. The activity and physiological relevance of the aminopeptidase is poorly understood while the epoxide hydrolase converts leukotriene A4 (LTA4) into leukotriene B4 (LTB4), a potent chemotaxin that is fundamental to the inflammatory response of mammals. It accepts a variety of substrates, including some opioid, di- and tripeptides, as well as chromogenic aminoacyl-p-nitroanilide derivatives. The aminopeptidase activity of LTA4H is possibly involved in the processing of peptides related to inflammation and host defense. Kinetic analysis shows that LTA4H hydrolyzes arginyl tripeptides with high efficiency and specificity, indicating its function as an arginyl aminopeptidase. Thermodynamic characterization using different biophysical methods shows that structurally distinct inhibitors of the LTA4H occupy different regions of the binding site; while some (RB202, ARM1 and SC57461A) bind to the hydrophobic hydrolase side, both bestatin and captopril are located at the hydrophilic peptidase side. LTB4H overexpression is associated with different pathological conditions and diseases such as cystic fibrosis, coronary heart disease, sepsis, shock, connective tissue disease, and chronic obstructive pulmonary disease. It is also overexpressed in certain human cancers, and has been identified as a functionally important target for mediating anticancer properties of resveratrol, a well-known red wine polyphenolic compound with cancer chemopreventive activity.	0
NZ_CP040436.1\|WP_134729970.1\|3900572_3901667_-\|rod-shape-determining-protein-RodA	gnl\|CDD\|274033	TIGR02210, Rod_shape-determining_protein_RodA, rod shape-determining protein RodA. This protein is a member of the FtsW/RodA/SpoVE family (pfam01098). It is found only in species with rod (or spiral) shapes. In many species, mutation of rodA has been shown to correlate with loss of the normal rod shape. Note that RodA homologs are found, scoring below the cutoffs for this model, in a number of both rod-shaped and coccoid bacteria, including four proteins in Bacillus anthracis, for example. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan, Cellular processes, Cell division].	7.28716e-143
NZ_CP040436.1\|WP_019660675.1\|3893301_3894012_-\|lipoyl(octanoyl)-transferase-LipB	gnl\|CDD\|237681	PRK14342, PRK14342, lipoyl(octanoyl) transferase LipB.	4.41703e-141
NZ_CP040436.1\|WP_019660693.1\|3914965_3915388_+\|low-affinity-iron-permease-family-protein	gnl\|CDD\|377225	pfam04120, Iron_permease, Low affinity iron permease.	4.49619e-63
NZ_CP040436.1\|WP_021203734.1\|3894541_3895615_+\|lipid-A-deacylase-LpxR-family-protein	gnl\|CDD\|378338	pfam09982, DUF2219, Uncharacterized protein conserved in bacteria (DUF2219). This domain, found in various hypothetical bacterial proteins, has no known function.	2.39929e-109
NZ_CP040436.1\|WP_134730128.1\|3909190_3909811_-\|HAD-family-hydrolase	gnl\|CDD\|223620	COG0546, Gph, Predicted phosphatases [General function prediction only].	5.172e-28
NZ_CP040436.1\|WP_005419409.1\|3913575_3914028_+\|nucleoside-deaminase	gnl\|CDD\|238612	cd01285, nucleoside_deaminase, Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a water molecule to form a hydroxide ion that performs a nucleophilic attack on the substrate. The functional enzyme is a homodimer. Cytosine deaminase catalyzes the deamination of cytosine to uracil and ammonia and is a member of the pyrimidine salvage pathway. Cytosine deaminase is found in bacteria and fungi but is not present in mammals; for this reason, the enzyme is currently of interest for antimicrobial drug design and gene therapy applications against tumors. Some members of this family are tRNA-specific adenosine deaminases that generate inosine at the first position of their anticodon (position 34) of specific tRNAs; this modification is thought to enlarge the codon recognition capacity during protein synthesis. Other members of the family are guanine deaminases which deaminate guanine to xanthine as part of the utilization of guanine as a nitrogen source.	1.98884e-42

>NZ_CP040436.1|WP_019660684.1|3905000_3905486_-|rod-shape-determining-protein-MreD
MSRLRDKPWVLPASLVVALLLGLLPLPALLQPLRPYWLALVLAYWVIEAPERVGLGIAFASGVIADLLYGGVLGEQALRLVMLAFILQRFRARIRFFPMSQQMLAIGGLLFNDRIVSALVHILVGEPTLPWSYWWAPLLGMGLWPLVFVLLDAVRFGKRGR
>NZ_CP040436.1|WP_155030138.1|3902924_3904997_-|penicillin-binding-protein-2
MIPRRQVKNPHAEAEQFRRRAALGFLGVLVCLLGLGGWYFKLQVLDHDVYATRSEANRIKPRPVVPGRGMIYDRNGRLLAENVPAFRLDVTPDKVKDMDATLEGLAKIINISPEELEAFNKSRKARRKFLPVTLKLRMSDEEMARFAVDRWRFPGVELEPYLTRRYPYGDLFAHIIGYVGRVDDKDLEILGEGNAALTHIGKSGLERYYEQQLRGRVGYEQVETNVQGRAIRTIGRVAAQSGADLRLSIDADLQRAMVAAFGDQEGSAVAMDPRTGEVLAMVSLPSYDPNLFVNGISHADFKALNENPSRPQFNRLVLGGVAPGSTLKPLIGLAGLDSGVRRPEDKVLSTGMFYLPGTSRGWGDAHRGGHGWTDLRKSIAESVNTYYYKLALDLGIERFDHYMEYYGFGQPTGIDLTGEIGGILPSPAYKRKTRKEAWFPGDTVNISIGQGDWKVTPLQLARGVSALADGQLRTPHLVIQQREGFDSDWTAMPAGESKPISPNPNNVQAVREGMMATMRPGGSGWRVAVGAPYVMAGKTGTAQVISRKGTAAVNPKSLPMHLRHRALFVGFAPVENPVIAIAVAVEGGGYGGSAAAPIARKVFDAYLLGKMPEGMQPLDSERGTTAIGATAFDNEDASARQAGDLAAAQVGEHPVLIGVPAPAPAPAPQPDAQAAALPATPRPTPAEPAR
>NZ_CP040436.1|WP_155030137.1|3901815_3902928_-|rod-shape-determining-protein-RodA
MRVFLRWAGDMLRRFFSTLDWVLCLALGALMVIGLATLKSAGGDSLVIAQGARFAVGMAALWGISRVPILRIRSATPMIYAISMIPLLAVFVLGTGKYGRQWLDLKFFYLQPAELLKVSLPMMVAWYLHRMPLPPRFNTVLVALVIIGVPTGLVMLQPDFGTGVLIAASGVFVLLLAGLPWWWVGLGVGGVAAVAPVAWFWLLRPYQKDRIMMFLDPEMDALGAGWNIIQSKIAIGSGGFDGKGWGEGSQSHLNFIPEQTTDFAFSVLSEEFGWIGVATVLALYLLVIGRCLWIASQSRDSYSRLLAGATGLAFFVYVLVNGGMISGLLPVVGVPMPLISYGGTSAVSLLAGFGLVMAVRSHNPVHGGYG
>NZ_CP040436.1|WP_134729970.1|3900572_3901667_-|rod-shape-determining-protein-RodA
MEWKRLLGGCREAVRTIDLPLLVALLILMGVGLAVLHSVSGPVAGQAARFAGGLVAMWLLSRVSLLRLRAWTPALYALSMLPLMAVYVVGTGKYGQRWLNLGVFYLQPSELLKLSLPLMMAWYLHRQPLPPSPRTVLTAAVLIGMPAVLILMQPNLGTATLVTASGVFALLLAGLHWGWVATGATGLAVAAPLAWFGLLRQYQKDRVLTFLDPAADPLGTGWNILQSRIAIGSGGWQGRGWGQGTQATLDFLPEYTTDFAFSVLAEEFGWIGVATVFALYLLVVGRCLWIAVHARDTHARLLAGSLGLAFFVYVLVNGGMISGLLPVVGIPMPLISYGGTSAVSLLAGIGLVMAVRGHRPVHGG
>NZ_CP040436.1|WP_021203736.1|3898442_3899588_-|lytic-murein-transglycosylase-B
MIRRTLACMLTLGLVACATQPKSPPSSPQASSTPRQPSAKAHGPAEAAPEAAAATAPPVDLTPVPFEVARARFIADTAKRYGLRPEQISSVLDQAQVRQPIIAAMSRPAERVKPWNEYRPMFISKARIDGGRAFLAQHRAELDRVQQRTGVPAEVIVAIIGVETSYGKNAGNHRVLDALYTLAFYYPRSGDPAKLEREVRRELFFRDELAKLFELGREEKLDITTLKGSYAGAMGMGQFMPSSYLDYAVDGNGDGRRDLFTSYDDVFSSIANYFVKKGGWVRGGQVAVPATLAPGREEFNPTEWMPTWSLADLAQRGYQPSAAVQPGATATPITLEGSTGKQYWLGFQNYYAITRYNLSKMYAMAVFQLSQAIAGQELPPA
>NZ_CP040436.1|WP_155030136.1|3897174_3898446_-|septal-ring-lytic-transglycosylase-RlpA-family-protein
MNIRWLVPSLIVLALAACSSAPKKPATAGHGGKPSGTVVQGRGSRPAHCPEGSPYAAAKEDPNTRGNYTAGGLYKPGVRDSTPDYIPNVACIPEPEVTAEERSAIGNKSPYVVLGKSYKVLDDTRNYVERGTASYYGAKFHGRLTSNREVYDMYQFTAAHKTLPLPSFARVTNLDNGESVIVRVNDRGPFHDGRVVDLSYAAAVRLGITQRGTGNVEVRALQPGEGNLLAQKPSRRERRAAETAVAAASTRPVTAARATADSDIDRLVKRLPADATPARGQPATTQGVASAVPDVAVSSLPPSAPPVRSPTMAPVAVASAAPRTVAPSAVRTVPATAAAPSLSQQVVGAVMVQVASFSSRDNANRAMGQLNAAGIVGATISDIAAGGRTLFRLRVPASDHASAAELAGRIAGLGLGSPQIVKD
>NZ_CP040436.1|WP_155030135.1|3895853_3897074_-|serine-type-D-Ala-D-Ala-carboxypeptidase
MNFRSAAIALAATLVVGLASAQTPLPTPATPAPAAAAAAPATVATPPAPVPSVSKAWVLMDYATGQVLAGENIHEQLAPASITKVMTSYVVAAEVKNGKVRADDQVMMSERAWREGGAGTDGSYSGFPVNQTARLEDMEKGMAIQSGNDAAIALAEHVAGSEEAFASLMNSYAAKIGMKNSHFVNAHGLTAEGHHSTAYDLALLGRAMVRDYPETYAYNKIKEFQVGNIKQPNRNLLLWRDGSVDGIKTGHTSEAGYCLMSSAQRGDQRLIAVVLGGASEKQRADDSLALLNWGFRFFETHRLYEPGKPVAEHKVWKGTADKVQLGVAQPMLVSVPRGRYNDLKPSIDVPKTLEAPFTAGQQIGTVKVTLDGKVVAEAPLVAVAAVEQAGFFKRLWDSFWMWWESE
>NZ_CP040436.1|WP_021203734.1|3894541_3895615_+|lipid-A-deacylase-LpxR-family-protein
MSPPSHRRLAALGLYGLLAAALPLAAQAAEQCGPDAMRDHPPQVNFRVDNDLFGGRHQDQGYTNGALLTLVSPNLVDYTDDPCLPRMARWVNRYLEGLHPGRFEQQNMIFSIGQGIFTPTDFSRRDLIEDDRPYAGVLIANFGFNARSGDRLQTTQLTLGVVGPWAQGKQVQNAVHEVLGDEKFKGWDNQLHNEPLFMLTHERMRRWPGDASVNADGWGWDAISHYGGSIGNLETKANLGGEVRFGWKLPDDFGSTPLRPAGENTAPTRGGRPSGWSWHLFATSDAAWVIRDITLDGNTFRNSHSVDKRHVVAYGGYGVAVMYGRWKFAAARYHSTREFNGQRQSPVFGSFTISRSL
>NZ_CP040436.1|WP_005411067.1|3893999_3894278_-|YbeD-family-protein
MEIKSDNPDHGFQFPGQFELSAMGPANRGLEHELPRLLLAAGIDVVNERISWKHSSNGKYVSVRIVFKAESREQYDLAHQALRDHPEVKWTL
>NZ_CP040436.1|WP_019660675.1|3893301_3894012_-|lipoyl(octanoyl)-transferase-LipB
MDAVADSCPAEAAPEHRAPRPAVVRDLGRQAYEPVWRAMQRFTDQRSDNDADELWVVEHDPVFTLGQAGKDEHVLAPGEIPVLHVDRGGQVTYHGPGQIVVYPLLRLPRLGIGVRDYVCRIEQALIDTLAEWNIGAERREGAPGVYVGGAKIAALGIRVRRGCTFHGLAFNVAMDLEPFHRINPCGYQGLQVTSVVDLGGPSGMEAVKPVLLEHLARQFGLLLQPTHELPDLSAAA
>NZ_CP040436.1|WP_005419402.1|3906701_3907748_-|rod-shape-determining-protein
MFKKLRGMFSNDLSIDLGTANTLIYVRGQGIVLNEPSVVAVRQDRAIGGTRSVAAVGAEAKQMLGRTPGHITTIRPMKDGVIADFTYTEAMLKHFIKKVHKSRVLRPSPRVLVCVPAGSTQVERRAIKESAEEAGARDVFLIEEPMAAAIGAGMPVTEARGSMVIDIGGGTTEVAVISLNGIVYSASVRIGGDRFDESITNYVRRNHGMLIGEATAERIKVELGCAYPQAEVIEMEISGRNLAEGVPKMIKISSNEVLEALHEPLSGIVSAVKLALEQTPPELCADVAERGIVLTGGGALLRDLDRLISEETGLHVQVADDPLTCVARGGGRALELVDMHGNEFFAPE
>NZ_CP040436.1|WP_019660686.1|3908031_3908970_+|carbohydrate-kinase-family-protein
MSALICGSLAFDTIMVFPDQFKNHILPDKVHILNVSFLVPRMRREFGGCAGNIAYNLHLLGGQPIPMGTVGSDFGPYREYFEGLGIDLSRVRVIDELFTPQAFITTDHDNNQITAFHPGAMMRSYENHVRGVPGVTLGLVGPDGREGMIQNAQEFHEDGIPFIFDPGQAMPLFNGPELRAFIDQADYVVVNDYESNLLQERTGWDEKEIVSRVKAYITTRGPKGAVIHTPEKSYDIPPAHERRVVDPTGCGDAFRAGLIYGIQKGYDWLTIGRMGNLMGALKVEHPGTQNQRFTFDEFNEQFKQQFGYALSA
>NZ_CP040436.1|WP_134730128.1|3909190_3909811_-|HAD-family-hydrolase
MVAAGSAVHALSAIRHWVFDMDGTLTVAVHDFAAIRRALEIAAEEDILDHIAALPDAPAQAKRAWLLDHERALAEDALPAPGALKLLRALSAAGCRLGILTRNDHALAKLTLDAIGVGALFDDADIIGRDEAVPKPSPDGLQQHLRRWGIGAAEAVMVGDHAYDLECGRAAGTHTVLVNLPENPWPGRADWHFADCRALLAAWQGA
>NZ_CP040436.1|WP_155030139.1|3909810_3910542_-|hypothetical-protein
MKRLILLTACTLALAACSNPEEERKAQEAAAAAVQAQKEAKAEDVAKQYDMAVAAQDWERARLHGASLLDQYKDTAAAERIAAGFDEVKVKGDAARDLRRMQALWQYNQIPVGNKGNQVSAQIYSKERVDVDGSGAKPVQLVFRDHPEWKRHAYLVLQAGDFRCPQCTVKVTVDDGKPVSMAAWRPKTDEAIALFITDQKALWKLARKGKSISIEFPVKAGGTRTAVFETGGVDASRMPQWWQ
>NZ_CP040436.1|WP_155030140.1|3910669_3912598_-|aminopeptidase
MRNPLMLLPLAVALAAGCSQEAAAPAAAPTAAKAPAAPVNAENRSHDESSYAEPDKVVIKDIALDLKLDFDQKQIGGTATYTLEWKQKDARQLVLDTRELTVSKVEAVAADGARSPLKFELAAADKVFGSKLTIEAPEQPAKVEVSYHTAPTASGLQWLAPSMTEGKKLPFMFSQSQAIHARSWVPLQDTPSVRFTYSAHVVSRPDVMVLMSADNDPKAARDGDYTFKMPQPIPSYLLAIAAGDLVFEPISGRSGVWAEPTMVNKAAKEFEDTEKMIGAAEKLYGEYRWGRYDMLVLPPSFPFGGMENPRLTFATSTVIVGDKSLVSLVAHELAHSWSGNLVTNASWKDIWLNEGFTTYVQGRITEALYGKEMAEMEKQIDQTDLLAEVKDMSPADQALALPPLNERDPDEALSQVAYVKGAWFLEFLEQRFGRETFDPFLRGWFDDHAFQSANTDQFVDYMKKNLLPKNPSAVTEAELKAWLDEPGIPAFAAKAQSRNFSSVDTARIAFASAGTVPSSQVIADWSTQEWVRFIDGLGATQPLDKLATLDKAFHFTGTPNGEIAMRWYPLAIRSGYEQANDGAAAFIERVGRRKLILPIYAELVKTPKGLELAKQAFEKAKPGYHPITTASVQDMLAKAEAK
>NZ_CP040436.1|WP_019660690.1|3912733_3913495_-|bifunctional-demethylmenaquinone-methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol-methylase-UbiE
MSESPYKAGTTHFGFRDVAAKDKQKLVGQVFTSVARNYDLMNDLMSLGVHRAWKRYYVATAQVKPGDRVLDLAGGTGDIAALLKERVGAEGSVVLGDINAGMLSVGRDRLTNRGLVLGLDYVQCNAEALPFPDNSFDLVTIAFGLRNVTDKDAGLREMYRVLKVGGQARVLEFSEVTADWFKPIYDFHSFKILPKLGKLFANDSDSYQYLAESIRKHPPQDELKAMMAQAGFERCHYKNLTGGIVSIHSGYKL
>NZ_CP040436.1|WP_005419409.1|3913575_3914028_+|nucleoside-deaminase
MITTPDYQALLQTAIAEARQGLAEGGVPIGAALYHNDGRLLGCGHNRRVQEGDPSVHGETDAFRKAGRQRRYQDTIMVTTLAPCWYCSGLVRQFNIGTVVVGESRTFQGGIDWLRENGVNVIDLDNQECVDLLGDFISRHPDIWNEDIGE
>NZ_CP040436.1|WP_021203905.1|3914226_3914487_+|hypothetical-protein
MCAHAVRPTPDPILESIRERLQQHFALHRRSASFWSAYQGLQLELVRGQPRDHERLCNAMATMAEQMGAVEHAQLISNRHTGSTSR
>NZ_CP040436.1|WP_021203904.1|3914562_3914898_+|hypothetical-protein
MHAEVPTIPPVINVDAELDHWRRQHAEGALPHNSFGSYVPWIKFACDSLITQPRASEAERDEMFQTQYALQIMPRLSEAQAREFVDLCWQHVYQSSPVRSLQAPRLQRMRA
>NZ_CP040436.1|WP_019660693.1|3914965_3915388_+|low-affinity-iron-permease-family-protein
MKARNLFNTIAKKAAAATGSPWTFLAAVAIVVIWGISGPVFGFNDTWQLVINTGTTIITFLMVFLIQHTQNADTAAMQIKLDELIRATAEANNELLDLEELDEARLEEIRAEYEQMAREAGDALARVRACHAARRDDEAI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040436_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040436_4

4359584-4359684

Orphan

Consensus_repeat	Method
TTGCCGGCCAGCGGCCGGCATTACC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040436_4

>merge|NZ_CP040436|4|4359584-4359684|CRISPRCasFinder
TTGCCGGCCAGCGGCCGGCATTACCAGGGTTCGTGGGGTTGCCGGCCAGCGGCCGGCATTACCAGGGTTCGTGGGGTTGCCGGCCAGCGGCCGGCACTACC

>NZ_CP040436|4|4|4359584-4359684|CRISPRCasFinder
TTGCCGGCCAGCGGCCGGCATTACC	AGGGTTCGTGGGGTTGCCGGCCAGCGGCCGGCATTACCAGGGTTCGTGGGG
TTGCCGGCCAGCGGCCGGCACTACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040436.1\|WP_155030314.1\|4362438_4363377_+\|2-dehydropantoate-2-reductase	unknown	unknown	gnl\|CDD\|183829
NZ_CP040436.1\|WP_155030309.1\|4352548_4353733_-\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224582
NZ_CP040436.1\|WP_019661680.1\|4359689_4360439_-\|ferredoxin--NADP-reductase	unknown	unknown	gnl\|CDD\|99792
NZ_CP040436.1\|WP_005420226.1\|4361488_4362280_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|237896
NZ_CP040436.1\|WP_019661678.1\|4357014_4358187_+\|cellulose-binding-protein	unknown	unknown	gnl\|CDD\|225932
NZ_CP040436.1\|WP_010482266.1\|4368976_4369237_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_032959053.1\|4351813_4352524_+\|transposase	unknown	unknown	gnl\|CDD\|376616
NZ_CP040436.1\|WP_155030313.1\|4360523_4361492_+\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|224054
NZ_CP040436.1\|WP_155030312.1\|4356295_4356823_+\|DUF1203-domain-containing-protein	unknown	unknown	gnl\|CDD\|377693
NZ_CP040436.1\|WP_155030307.1\|4350583_4350838_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_155030316.1\|4364378_4365176_-\|hydrolase-TatD	unknown	unknown	gnl\|CDD\|182449
NZ_CP040436.1\|WP_019661686.1\|4367868_4368258_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040436.1\|WP_155030311.1\|4354472_4355999_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|312032
NZ_CP040436.1\|WP_111103948.1\|4358365_4359538_+\|cellulose-binding-protein	unknown	unknown	gnl\|CDD\|225932
NZ_CP040436.1\|WP_155030315.1\|4363373_4364300_+\|epimerase	unknown	unknown	gnl\|CDD\|187576
NZ_CP040436.1\|WP_026347220.1\|4368348_4368888_-\|pseudouridine-synthase	unknown	unknown	gnl\|CDD\|211334
NZ_CP040436.1\|WP_155030308.1\|4350916_4351714_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117
NZ_CP040436.1\|WP_155030310.1\|4353729_4354476_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|226927
NZ_CP040436.1\|WP_019661670.1\|4349498_4350500_+\|energy-transducer-TonB	unknown	unknown	gnl\|CDD\|223880
NZ_CP040436.1\|WP_155030317.1\|4365243_4367748_+\|ATP-dependent-helicase-HrpB	unknown	unknown	gnl\|CDD\|273901

Protein	Function_ID	Function_description	E-value
NZ_CP040436.1\|WP_155030314.1\|4362438_4363377_+\|2-dehydropantoate-2-reductase	gnl\|CDD\|183829	PRK12921, PRK12921, oxidoreductase.	1.41426e-105
NZ_CP040436.1\|WP_155030309.1\|4352548_4353733_-\|ABC-transporter-permease-subunit	gnl\|CDD\|224582	COG1668, NatB, ABC-type Na+ efflux pump, permease component [Energy production and conversion / Inorganic ion transport and metabolism].	6.81308e-47
NZ_CP040436.1\|WP_019661680.1\|4359689_4360439_-\|ferredoxin--NADP-reductase	gnl\|CDD\|99792	cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.	4.63374e-69
NZ_CP040436.1\|WP_005420226.1\|4361488_4362280_+\|ABC-transporter-permease	gnl\|CDD\|237896	PRK15066, PRK15066, inner membrane transport permease; Provisional.	2.65469e-155
NZ_CP040436.1\|WP_019661678.1\|4357014_4358187_+\|cellulose-binding-protein	gnl\|CDD\|225932	COG3397, COG3397, Uncharacterized protein conserved in bacteria [Function unknown].	9.42126e-70
NZ_CP040436.1\|WP_032959053.1\|4351813_4352524_+\|transposase	gnl\|CDD\|376616	pfam01797, Y1_Tnp, Transposase IS200 like. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS200 from E. coli.	1.57762e-15
NZ_CP040436.1\|WP_155030313.1\|4360523_4361492_+\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|224054	COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms].	4.22361e-99
NZ_CP040436.1\|WP_155030312.1\|4356295_4356823_+\|DUF1203-domain-containing-protein	gnl\|CDD\|377693	pfam06718, DUF1203, Protein of unknown function (DUF1203). This family consists of several hypothetical bacterial proteins of around 155 residues in length. Family members are present in Rhizobium, Agrobacterium and Streptomyces species.	1.27461e-32
NZ_CP040436.1\|WP_155030316.1\|4364378_4365176_-\|hydrolase-TatD	gnl\|CDD\|182449	PRK10425, PRK10425, 3'-5' ssDNA/RNA exonuclease TatD.	1.92651e-109
NZ_CP040436.1\|WP_155030311.1\|4354472_4355999_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|312032	pfam08386, Abhydrolase_4, TAP-like protein. This is a family of putative bacterial peptidases and hydrolases that bear similarity to a tripeptidyl aminopeptidase isolated from Streptomyces lividans. A member of this family is thought to be involved in the C-terminal processing of propionicin F, a bacteriocidin characterized from Propionibacterium freudenreichii.	3.69037e-18
NZ_CP040436.1\|WP_111103948.1\|4358365_4359538_+\|cellulose-binding-protein	gnl\|CDD\|225932	COG3397, COG3397, Uncharacterized protein conserved in bacteria [Function unknown].	1.28955e-59
NZ_CP040436.1\|WP_155030315.1\|4363373_4364300_+\|epimerase	gnl\|CDD\|187576	cd05266, SDR_a4, atypical (a) SDRs, subgroup 4. Atypical SDRs in this subgroup are poorly defined, one member is identified as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is related to, but is different from, the archetypical SDRs, GXGXXG. This subgroup also lacks most of the characteristic active site residues of the SDRs; however, the upstream Ser is present at the usual place, and some potential catalytic residues are present in place of the usual YXXXK active site motif. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	3.97138e-57
NZ_CP040436.1\|WP_026347220.1\|4368348_4368888_-\|pseudouridine-synthase	gnl\|CDD\|211334	cd02566, PseudoU_synth_RluE, Pseudouridine synthase, Escherichia coli RluE. This group is comprised of bacterial proteins similar to E. coli RluE. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA molecule to pseudouridines (5-ribosyluracil, psi). No cofactors are required. Escherichia coli RluE makes psi2457 in 23S RNA. psi2457 is not universally conserved.	6.68479e-89
NZ_CP040436.1\|WP_155030308.1\|4350916_4351714_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.32653e-22
NZ_CP040436.1\|WP_155030310.1\|4353729_4354476_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|226927	COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism].	1.42368e-107
NZ_CP040436.1\|WP_019661670.1\|4349498_4350500_+\|energy-transducer-TonB	gnl\|CDD\|223880	COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane].	6.49774e-17
NZ_CP040436.1\|WP_155030317.1\|4365243_4367748_+\|ATP-dependent-helicase-HrpB	gnl\|CDD\|273901	TIGR01970, ATP-dependent_RNA_helicase_HrpB, ATP-dependent helicase HrpB. This model represents HrpB, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti has been designated HelO. HrpB is typically about 800 residues in length, while its paralog HrpA (TIGR01967), also uncharacterized, is about 1300 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. [Unknown function, Enzymes of unknown specificity].	0

>NZ_CP040436.1|WP_111103948.1|4358365_4359538_+|cellulose-binding-protein
MHLSHRAVFALSVVAGLALSGSAFAHGTMTKPLSRVKQCHEGNPENPTNPACAAAKAIGGAQPFYDWSAIAHGNANGNHRELVRDGELCSASIPKYRGLDLNRTDWPTTPIRADARGRYTFEFYAPAPHATREWKFYVTRDGWQPGSPLRWADLQEFCTLGNVPVDGKTYKLDCPLPKRSGQHIIYNTWQRSDSGEAFYTCMDVRFEGGNGVIPPPQWQDAGPVTARGALEAGTTLTLRVFNANGNDLERPEVTLAAGQTAPAQWPMALASKVNGSAQHARVGVMKNGVITPVASATENRVYLKPGHRFELETQIPGPGPVDPVDPPGGDFDFVYPAGLGSYKPGETVVKGTDGKLYACRPFPEGAWCNINADAYRPGTGFAWRDAWIAY
>NZ_CP040436.1|WP_019661678.1|4357014_4358187_+|cellulose-binding-protein
MSFRSTPLLLATSFAAAGLCLAGNAFAHGTMTTPVSRVYACFQGNPENPTNPACAAAKAIGGSQAFYDWNGINQANANGNHQAVVPDGKLCSGNNPTFRGLDVNRSDWQTTPIHADANGRFTFVFKATAPHATRDWRFFVTRDGWQPGSPLRWADLQEFCTLGNTPLSADGTYKLQCTLPQRSGQHVIYNTWQRSDSTEAFYTCMDVRFEGGGGGTTPAPQWQDAGPVTARGELPVGTTLALRVFNASGNDVERVEATLASGQTSAAQWPLALARKVNASAQHARVGVLANGAITPTASATANRVYLKDGNRFQLDTKVPDPGTPSPGGDFDHVYPAGIGGYVPGQTVVKGTDGKLYACRPFPEGAWCNVNAEAYRPGVGAAWRDAWIAY
>NZ_CP040436.1|WP_155030312.1|4356295_4356823_+|DUF1203-domain-containing-protein
MHTWYLGGIDHRPFLHLFEMSDCALAALGIQRRWAGASGGHPCRISLSDPAPGSELLLLSHAHLPLHSPYRAAGPIFVQRGVTRCVLPPGEVPPYVQRRVISMRAYDHAALMCGAQVCAGTEVADHLDALFADPSVAFVQLHNAAHGCFSCQADRVGTGTASRDLHDVIDATPVT
>NZ_CP040436.1|WP_155030311.1|4354472_4355999_-|alpha/beta-fold-hydrolase
MQRLHLALAAALASLMLAGCSQPPSPGAEGATDAPGRLFGTIDFQPCTLSTVGASANVEAQCATLQVPEDRAQPDGRRIGLRIAWLESGSSGASQPDPVFFLAGGPGQAASEVAVIVDTALRQVRKQRDVFLIDQRGTGGSNPLSCLGADGKELPMDEDAAPSEASLRDYAQRCAASLQGRADARFYTTTEAIADLDAVRAALGVDQLNLVGGSYGTRVAQRYAGTYPQHTRSIVIDGVVPNELVVGGDFARTFEDAIALQSAQCRKDVTCSKRFPTDTRAQLRSVVETLRRAPVPVEYRDPGTYGTRKDVLTPDSVVGLAFAFSYVPQYASLLPLVLDEAAHGRYAPLASLARGANRSMDFQINRGMHWSVICSEDAPRYHAPAEDPERLFGNEVASAFFAACPVWPHRPAPATDAVPLRSDVPALLLSGELDPVTPPRYAEQVLKGLPNGRALVARGQGHGTLTAGCMPRLLGQFIDTTDAKALDAGCLDTLSYVPAFTSFNGWEP
>NZ_CP040436.1|WP_155030310.1|4353729_4354476_-|ATP-binding-cassette-domain-containing-protein
MIVADNLHKAFDTRTGRIQAVSNVGFRAEDGRITGLLGPNGAGKTTTMRMLYTLMTPDQGSITVDGIDAARNPVEVRRHLGVLPDARGVYKRLTARENIAYFGELHGLSAERIRERIEVLSHALDMSDILDRQTDGFSQGQRTKTAIARALVHDPRNVILDEPTNGLDVMTTRALRRFLLGLREEGRCVILSSHIMQEVAALCDHIVIIAKGTLMAAGSADELRAQAGESNLEDAFVKLIGSEEGLHA
>NZ_CP040436.1|WP_155030309.1|4352548_4353733_-|ABC-transporter-permease-subunit
MSMMSTLMTVMRKELRDLSRDRRTLLLTLLFGPLLYPVLLLGMGKLAESRVRTQIEQPLQIPTIGADNAPNLVRFLAAQGLNAAPAPKDLAEAIRTQDIDVALRISDEFGKDWAEGKPALVEVIKDSTRRAAEVPSARLEAALATYNGQVGALRLMARGIDAQVARPLDVARQDLASAEAKRGMILSMLLPVLLTLTSFIGGAYLVMDATAGERERQSLEPLLATPGSRSAIVSGKIAAACVVGFVSLLLTLVAFKVSAQIAPGNIGRQFNMNVGSMLQMLLVMLPMLLIGTSLLTFLSAAAKSMKEAQSHMTWLMLLPMLPGYALVAYPLKSEMWQYAVPFLSQNQMLLKVIRHETITPTVWAIYLGASLGLAAMLWFAAVRRYHNERLAISG
>NZ_CP040436.1|WP_032959053.1|4351813_4352524_+|transposase
MPRQARLMLAGQAYHVIQRGVNKGAIFVDDIDRQLFLHLLHSAFLKHRVALHAYVLMDNHIHLLATPSTQRGLADAMRMQGNNYVQAFNQRHGRTGPLWQGRFHSSMIDSDAYLLSVYRYIERNPVRAGIAVSAEDHPWSSVHGNLQRRDDPMLTPHPAFRALAATARNRTAVYARFLRDVNASADLPAIRSHSAKQRPLGDAAFLRMVEKTLGRPVAMRRQGRPRKEGTGGAETT
>NZ_CP040436.1|WP_155030308.1|4350916_4351714_+|helix-turn-helix-domain-containing-protein
MADQTPTGLIDPALADADDGPIVLAGQLRVPGRRRTARHQHVRGQLLGAHHGLLRIEAGDLHWLLPAGHVAWIPPLLPHALVGADAFDGWSLYVRADAGLDLPPLPRIFQPDVLLQAAVTRALRWPHQALDAAQARLAGVIADEIRASTPLPLALPQPQDRRLRRIAAALARSPDDLRSVEAWAAISGLSSRSLARRWQAETGMTLSQWRQRLRVLLSLPRLLAGEPVISVALSMGYDTPSSFINVFKRVMGVTPARYAKGDGGD
>NZ_CP040436.1|WP_155030307.1|4350583_4350838_-|hypothetical-protein
MQPQDILPDHQNEVQVNGLIVRKGSVGAFLASVRDWQDPASDDATRATAEADLRGLLPGLHALGLFQVLAARDPALQRLIDSLS
>NZ_CP040436.1|WP_019661670.1|4349498_4350500_+|energy-transducer-TonB
MSHVSTITAARRWLPVALALALAACSGKEESAAPAPAAAPTAAAPAAPVVAAKVQSMGTEQLRESASQALRENRMYAPAGDNAIEYYLALRDKTPDDASVKSALTDLLPYTLIAAEQHLGREDYTEAQRLVALIEKVDASAPALPRLKDGLSKGVENAAKRTETEAEKAKKDAEERSKQQIEQQRLAEQRAKEADAAKQIAAQQDAARRDNERQEAERQAAARREAEQKQQQAAAQQASAARQAAAAAAPTLRPISTPAPRYPAEALRSGTSGEVLVEITVGTDGSVVNARVLRATSGRTFDREALNAVKRWRFEPVSAPVTTRRTLVFAPGG
>NZ_CP040436.1|WP_019661680.1|4359689_4360439_-|ferredoxin--NADP-reductase
MPVQFPLKLVGCRMLAPTVGHYQFVRDDGQPLDFQPGQFIQVHFSYADGTETKRSYSLATIHDHALGPGEAVDIAVSFVPGGAATALFEALEPGGQISASGPYGRFCLNPGDHNARYLLIATGTGVTPYRSMLPLLEKAMAERDVQIVLLQGARSPGELLYSEDFYSFAEKHANFRYVPCLSRELPAEPHPDVQHGYVQQALAGFTPDPATDIAYLCGNPDMVDACAELLKAAGLGNPQIRREKYVSSK
>NZ_CP040436.1|WP_155030313.1|4360523_4361492_+|ATP-binding-cassette-domain-containing-protein
MGAKASSLASQNDMAPALRVRDLRKTYDNGTQALKGVSLEVAPGDFFALLGPNGAGKSTLIGIISSLVNLSEGQVEVFGSDLVRNRSATMRLIGLVPQEINFNLFEKPFDILVNYAGFYGVPREEAEQRAEEELKRAHLWEKAQVMSRTLSGGMKRRLMIARAMMTRPRLLILDEPTAGVDIEIRRDMWRVLKEINAAGTTIILTTHYLEEAEYLCRHLAIINHGQIVEQGPMRTLLAKLDVEGFLLDIDGDLPAQLPVIEGATLTAPDPHTLDIDMPRAMDLNRVFATLNESGIRVRSMRTKSNRLEELFVRLTGNMEKPA
>NZ_CP040436.1|WP_005420226.1|4361488_4362280_+|ABC-transporter-permease
MSTTELTDGQRNRIALMTIVRREVARIMRIWGQTLVPPAITMTLYFLIFGNLIGSRVGDMGGYTYMQFIVPGLVMMSVIQNSYGNISSSFFGAKFGRHVEELLVSPMPNWVILWGYVAGAVLRGLMVGVIVLIIAMFFTPVRIPHPIVMLTTVILGATIFSLAGFINAVYAKKFDDVAIVPTFILTPLTYLGGVFYSVKLLPGWAEAATHANPIFYMVNAFRYGLLGSSDVPLPVAYGLMIGFVVVLTALALWLLRRGVGMRS
>NZ_CP040436.1|WP_155030314.1|4362438_4363377_+|2-dehydropantoate-2-reductase
MRILILGAGGTGGYFGGRLAQAGVDVTFLVRPARAAQLDRDGLVIRSPLGDASFPVQHVTADALPALAAQKPFDLVILSCKAYDLDSSIDAIAPAVGANTTVLPILNGLHHYNALDLRFGRDAVLGGLCFISATKAPGGAVLHLGKPAKLTFGERDGGAASARVRAFAAACAQANLDHLASERIGQEQWIKYTFLTALAAATCLLRADIGTIVATDDGEAIVRGLYDECLAVAEAAGEPVPEAAQDTARGTLTQAGSALKASMLRDLEAGQQVEAEQIVGDMLARARRADQEALLLQVAYSSLQAYQALRVA
>NZ_CP040436.1|WP_155030315.1|4363373_4364300_+|epimerase
MTPALQASPLPARVLILGLGWSGRVLAAQLQARGVAVSGTVRDPSAAPHDGLLRHPLRADTAPSPALLEEIAQAEAVLCSVPPDAAGDPALRLLLPALRASPALRWVGYLSSTSVYADRAGGWIDERSAADATETAGVQRLLAEAQWRALAGQRGIASAVFRLPGLYGPGRNALVQLAQGRARHVVRPGQVFNRLHVDDLATVIIAAMRRPARQGLYLPSDDEPAPPQDVLAFAAKLGGFALPPAVAWDDPALSPTLRRFYESNKRIDSRGTREALGWAPRFPTYREGLTDLAASLAGHGTALPNSAL
>NZ_CP040436.1|WP_155030316.1|4364378_4365176_-|hydrolase-TatD
MHLIDIGANLTHDSFDRDRDAVLDRARQAGVVQMVITGASREHSPLAVQLAQQHPGFLYATAGVHPHHAVEYTEECDAEMRELHDHPAVVAVGECGLDYFRDFSPRPAQHRAFERQLQLAAENGKPLFLHQRDAHTDFMAQMKNFEGRIGPAVVHCFTGERDELFDYLDQDWYIGITGWLCDERRGAHLRELVKNIPANRLMIETDAPYLLPRTLKPMPKDRRNEPMFLSHIVEELARDRGEDVAVTAANATAATRAFFRLPDAG
>NZ_CP040436.1|WP_155030317.1|4365243_4367748_+|ATP-dependent-helicase-HrpB
MNAPLFPISPLLPQIQQHLAVQPRLVLEAPPGAGKTTQVPLALLDAPWLQGRKIILLEPRRVAARSAALFMARQLGEEVGGTVGYRIRFENKVSARTRIEVVTEGILTRMLQDDPMLEEVGAILFDEFHERHLSGDLGLALALDVQAQLRDDLRLVVMSATLDGERLARFLDAPRLSSEGRSYPVAISHFPARRDEALELQVRRAVQQALAEHPGDLLVFLPGQREIARVQAGLQESLDGNVEVLALHGELPVEQQARVLQMASDGRRRVVLATNVAESSVTLPGVRVVIDSGQAREPRYDPNSGFTRLDVVSIAQASADQRAGRAGRVAEGVAWRLWPQSQRLEPQRRAEIDQVELAGLALELAAWGSSDLRFLDPPPAGPMGAARELLQRLGALSSSGAITELGRRVLALGTHPRMAAMLLAAPDARAQALAADLAALLEARDPLRQGGDALAARWRALAAFRNGRTPGDANRSGLAAIDAAARQWRRRLRCEATPPASIEAHELGDLLAHAFPDRIGFQHPSDPLRYLLANGRSARLHELSDLRGEPWLVASELRFEARDALLLRAAPVDEGQLRNAWPERFVTEDVVRWDSERRALVALRETRFDRIVLDSRSAGRVDPQHAAQALTDAVAELGLQALPWTEGLRQWQARVESLRRWMPELGLPDCSDDALLATRAQWLQPAFAGRTRLDALDESSFGEALKSPLDWPQRQLVERHAPTRITVPSGLERPITYALDSESGDPLPPVLAVKLQELFGLADTPRIADGRVPLTLHLLSPGGRPLQVTQDLRNFWESTYAEVKKEMKGRYPRHPWPDDPWTATATHRAKPRGT
>NZ_CP040436.1|WP_019661686.1|4367868_4368258_+|hypothetical-protein
MSKLTVITDRALERALDLAHSAGDGLKSAGGSLRHLGPQASDWIKTGAALGAVKTGGKVATKFARRNPAVTIAAAAVGVGLLGYALYRKQQKKKAANGHVVNGQAQRINARDRRNDTVVDEHSDIGSDA
>NZ_CP040436.1|WP_026347220.1|4368348_4368888_-|pseudouridine-synthase
MLIAFNKPFNVLCQFTDRSVPPRPTLAGFGLPPRVYAAGRLDHDSEGLLLLTDNGTLAHKLTDPRHKADKTYWVQVEGTPSDEQLQRLRDGVELNDGPTLPAKIERLDPAPSLWTRDPPVRFRKTVPDSWLAITIREGRNRQVRRMTAAVNLPTLRLVRVSMGPYRLDDLQPGQWRQIG
>NZ_CP040436.1|WP_010482266.1|4368976_4369237_-|hypothetical-protein
MKKVFYIAVAVLVLARLIDFVFYGGHAYDLVATVGFAVLFAGALLEERARAMNPPPVRLRRRANVIAACGIALVLGSFLLEWKVFG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	MK814752	Gordonia phage Lutum, complete genome	41121-41153	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	MH779504	Gordonia phage Getalong, complete genome	42518-42550	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	MH651185	Gordonia phage Phistory, complete genome	39492-39524	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	MK376961	Gordonia phage Asapag, complete genome	40139-40171	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_048141	Gordonia phage Kenna, complete genome	39957-39989	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_048018	Gordonia phage Apricot, complete genome	39932-39964	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_017805	Deinococcus gobiensis I-0 plasmid P1, complete sequence	334252-334284	7	0.788
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	MG945892	UNVERIFIED: Microviridae sp. isolate 1823-1702, partial genome	2537-2569	8	0.758
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_021289	Burkholderia insecticola plasmid p1, complete sequence	819274-819306	9	0.727
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NZ_AP014579	Burkholderia sp. RPE67 plasmid p1, complete sequence	622679-622711	9	0.727
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_016626	Burkholderia sp. YI23 plasmid byi_1p, complete sequence	483094-483126	9	0.727
NZ_CP040436_1	1.1\|2677268\|33\|NZ_CP040436\|CRISPRCasFinder	2677268-2677300	33	NC_010625	Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence	1323565-1323597	11	0.667

1. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to MK814752 (Gordonia phage Lutum, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

2. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to MH779504 (Gordonia phage Getalong, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

3. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to MH651185 (Gordonia phage Phistory, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

4. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to MK376961 (Gordonia phage Asapag, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

5. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_048141 (Gordonia phage Kenna, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

6. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_048018 (Gordonia phage Apricot, complete genome) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gtcggatacgttgcggttgcggttgagcaggtt	Protospacer
* .**   ***** ****** ************

7. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_017805 (Deinococcus gobiensis I-0 plasmid P1, complete sequence) position: , mismatch: 7, identity: 0.788

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gaaggtgccgttgaggttgacgttcatgacctt	Protospacer
** **************** **** *  *  **

8. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to MG945892 (UNVERIFIED: Microviridae sp. isolate 1823-1702, partial genome) position: , mismatch: 8, identity: 0.758

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
cctggtgctgttaaggttgccgttgaggacaat	Protospacer
  ******.***.************** * . *

9. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_021289 (Burkholderia insecticola plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gttcttgccgtcgagcttgccgttgagcatcgg	Protospacer
* *  ******.*** *************

10. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NZ_AP014579 (Burkholderia sp. RPE67 plasmid p1, complete sequence) position: , mismatch: 9, identity: 0.727

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gttcttgccgtcgagcttgccgttgagcatcgg	Protospacer
* *  ******.*** *************

11. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_016626 (Burkholderia sp. YI23 plasmid byi_1p, complete sequence) position: , mismatch: 9, identity: 0.727

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
gttcttgccgtcgagcttgccgttgagcatcgg	Protospacer
* *  ******.*** *************

12. spacer 1.1|2677268|33|NZ_CP040436|CRISPRCasFinder matches to NC_010625 (Paraburkholderia phymatum STM815 plasmid pBPHY01, complete sequence) position: , mismatch: 11, identity: 0.667

gatggtgccgttgaggttgccgttgagcaggtt	CRISPR spacer
atctttgccgtcgagcttgccgttgagcatcgg	Protospacer
. .  ******.*** *************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

573185 : 582150

Enterobacteria_phage(42.86%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155028923.1\|573185_574241_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.2e-79	46.2
WP_021202693.1\|574255_575143_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.1e-96	58.5
WP_057496705.1\|575139_575712_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.2e-45	51.1
WP_019660972.1\|575708_576602_+	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	4.8e-28	36.5
WP_155028924.1\|576677_578081_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	6.5e-48	29.1
WP_019660974.1\|578093_579440_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	2.9e-29	26.3
WP_155030408.1\|579483_582150_-	helicase	A8C6A2	Antheraea_pernyi_nuclear_polyhedrosis_virus	1.1e-48	30.5

DBSCAN-SWA_2

918425 : 975063

Rhizobium_phage(25.0%)

tail,capsid,terminase,protease,integrase

attL 922286:922311|attR 986669:986694

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155029013.1\|918425_920072_-\|protease	M48 family metalloprotease	NA	NA	NA	NA
WP_019659535.1\|920214_920505_+	glutaredoxin 3	A0A2L0UZG6	Agrobacterium_phage	3.4e-07	41.7
WP_005408260.1\|920501_920894_+	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_012479261.1\|921218_922223_+	isocitrate dehydrogenase	NA	NA	NA	NA
922286:922311	attL	NA	NA	NA	NA
WP_155029014.1\|922423_923167_+	isochorismatase family protein	NA	NA	NA	NA
WP_155029015.1\|923220_924129_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021202979.1\|924207_924966_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_155029016.1\|926263_926632_+	hypothetical protein	NA	NA	NA	NA
WP_004154551.1\|926912_928157_-\|integrase	site-specific integrase	A0A0F7L7C7	uncultured_marine_virus	2.8e-10	27.9
WP_109337022.1\|928223_928595_-	hypothetical protein	NA	NA	NA	NA
WP_004154554.1\|929369_929726_+	hypothetical protein	NA	NA	NA	NA
WP_155029017.1\|929892_930660_+	hypothetical protein	NA	NA	NA	NA
WP_004154555.1\|930656_931124_-	hypothetical protein	NA	NA	NA	NA
WP_004154556.1\|931594_931855_-	hypothetical protein	NA	NA	NA	NA
WP_150359510.1\|932070_932670_-	hypothetical protein	Q8HAP4	Burkholderia_phage	1.7e-13	41.1
WP_155029018.1\|932973_933135_-	hypothetical protein	NA	NA	NA	NA
WP_080354124.1\|934846_935437_+	response regulator	NA	NA	NA	NA
WP_004154560.1\|935458_935911_-	hypothetical protein	Q7Y5G6	Xanthomonas_virus	1.1e-09	32.9
WP_049397869.1\|935907_936216_-	hypothetical protein	NA	NA	NA	NA
WP_049397868.1\|936212_936659_-	lysozyme	A0A2P9FI97	Pseudomonas_phage	5.0e-26	52.3
WP_049434054.1\|936655_936847_-	LPXTG cell wall anchor domain-containing protein	NA	NA	NA	NA
WP_004154562.1\|936855_938529_-\|terminase	phage terminase large subunit	A0A2R2ZGE7	Ralstonia_phage	5.6e-179	56.7
WP_155029019.1\|938528_938774_-	hypothetical protein	NA	NA	NA	NA
WP_005412393.1\|938770_939040_-	hypothetical protein	NA	NA	NA	NA
WP_155029020.1\|939066_939552_-	hypothetical protein	NA	NA	NA	NA
WP_049434056.1\|939551_942365_-	hypothetical protein	A0A142EZL1	Stenotrophomonas_phage	5.5e-38	42.7
WP_155029021.1\|942390_944928_-	DUF1983 domain-containing protein	NA	NA	NA	NA
WP_155029022.1\|944967_948132_-	hypothetical protein	L7TQZ1	Rhizobium_phage	4.3e-47	23.6
WP_155029023.1\|948138_950313_-	hypothetical protein	NA	NA	NA	NA
WP_049397861.1\|950316_950715_-	hypothetical protein	NA	NA	NA	NA
WP_155029024.1\|950747_951221_-	hypothetical protein	NA	NA	NA	NA
WP_155029025.1\|951217_953350_-	hypothetical protein	L7TLW2	Rhizobium_phage	1.6e-66	31.5
WP_155029026.1\|953349_953940_-	hypothetical protein	A0A2R2ZGD2	Ralstonia_phage	4.6e-27	42.4
WP_004154574.1\|954039_954993_-\|capsid	Major capsid protein 10A	L7TJ83	Rhizobium_phage	7.1e-62	42.4
WP_004154576.1\|955019_955805_-\|capsid	capsid assembly protein	A0A1B1IVZ8	uncultured_Mediterranean_phage	1.4e-20	30.6
WP_004154577.1\|955804_955948_-	hypothetical protein	NA	NA	NA	NA
WP_004154578.1\|955964_957521_-\|tail	Head-to-tail joining protein	L7TJ79	Rhizobium_phage	1.5e-85	37.6
WP_005412406.1\|957513_957666_-	hypothetical protein	NA	NA	NA	NA
WP_004154580.1\|957686_957866_-	hypothetical protein	NA	NA	NA	NA
WP_004154581.1\|957930_958467_-	adenylate kinase	A0A2H4J8A1	uncultured_Caudovirales_phage	1.4e-30	46.1
WP_155029027.1\|958562_958880_+	hypothetical protein	NA	NA	NA	NA
WP_049397854.1\|958883_959090_-	hypothetical protein	NA	NA	NA	NA
WP_004154583.1\|959077_959911_-	hypothetical protein	M1HMA9	Pelagibacter_phage	2.0e-36	36.0
WP_004154584.1\|959907_960057_-	hypothetical protein	NA	NA	NA	NA
WP_049434075.1\|960053_960344_-	hypothetical protein	NA	NA	NA	NA
WP_004154585.1\|960340_960589_-	hypothetical protein	NA	NA	NA	NA
WP_004154586.1\|960739_961105_-	hypothetical protein	NA	NA	NA	NA
WP_050483582.1\|961101_961440_-	hypothetical protein	A0A2H4P845	Pseudomonas_phage	9.6e-22	53.2
WP_004154587.1\|961421_963296_-	DNA polymerase I	A0A076YNV1	Mesorhizobium_phage	1.7e-160	48.2
WP_155029028.1\|963308_963965_-	hypothetical protein	NA	NA	NA	NA
WP_004154588.1\|963975_964224_-	hypothetical protein	NA	NA	NA	NA
WP_004154589.1\|964389_966021_-	toprim domain-containing protein	L7TLT7	Rhizobium_phage	3.7e-151	56.6
WP_004154591.1\|966007_966187_-	hypothetical protein	NA	NA	NA	NA
WP_080101784.1\|966183_966585_-	hypothetical protein	NA	NA	NA	NA
WP_004154593.1\|966581_966944_-	putative N-acetylmuramoyl-L-alanine amidase	I6Q9Z5	Yersinia_phage	2.5e-15	40.6
WP_004154594.1\|966944_967424_-	RusA family crossover junction endodeoxyribonuclease	A0A2I7QZP6	Vibrio_phage	1.4e-05	31.1
WP_004154595.1\|967365_968031_-	hypothetical protein	A0A076YJ33	Mesorhizobium_phage	1.5e-26	40.9
WP_154267700.1\|968030_968189_-	hypothetical protein	NA	NA	NA	NA
WP_005412421.1\|968188_968473_-	hypothetical protein	NA	NA	NA	NA
WP_005412422.1\|968465_968609_-	hypothetical protein	NA	NA	NA	NA
WP_155029029.1\|968653_971089_-	T3/T7 RNA polymerase	L7TQW5	Rhizobium_phage	4.0e-162	40.3
WP_019659529.1\|971650_972946_+	trigger factor	NA	NA	NA	NA
WP_019659528.1\|973020_973647_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	5.9e-57	57.9
WP_049466059.1\|973773_975063_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.2e-135	58.0
986669:986694	attR	NA	NA	NA	NA

DBSCAN-SWA_3

1733665 : 1764280

Pseudomonas_phage(56.52%)

tail,transposase,integrase

attL 1732726:1732740|attR 1764776:1764790

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1732726:1732740	attL	NA	NA	NA	NA
WP_155029293.1\|1733665_1734427_-	DNA adenine methylase	Q5ZQW7	Pseudomonas_phage	4.0e-76	56.2
WP_155029294.1\|1734590_1735358_-	hypothetical protein	NA	NA	NA	NA
WP_155029295.1\|1735363_1737736_-	hypothetical protein	J9RWA5	Pseudomonas_phage	5.7e-137	39.1
WP_155029296.1\|1737614_1737842_-	hypothetical protein	NA	NA	NA	NA
WP_155029297.1\|1737841_1738072_-	hypothetical protein	A0A0S0MV97	Pseudomonas_phage	8.8e-19	62.7
WP_155029298.1\|1738084_1738912_-	DUF2163 domain-containing protein	D2K0A8	Staphylococcus_phage	2.0e-36	32.4
WP_155029299.1\|1738863_1740567_-	hypothetical protein	A0SMQ4	Pseudomonas_virus	3.0e-111	42.0
WP_155029300.1\|1740566_1741547_-	hypothetical protein	J9SVR7	Pseudomonas_phage	2.5e-06	27.8
WP_155029301.1\|1741550_1742528_-	hypothetical protein	A0A2D2W2D5	Stenotrophomonas_phage	2.4e-17	28.2
WP_155030424.1\|1742530_1746067_-\|tail	phage tail tape-measure protein	A0A1V0E8B0	Vibrio_phage	1.6e-21	25.0
WP_155029302.1\|1746214_1746733_-	hypothetical protein	NA	NA	NA	NA
WP_155029303.1\|1746732_1747497_-	hypothetical protein	Q5ZQX2	Pseudomonas_phage	7.2e-57	47.0
WP_155029304.1\|1747499_1747661_-	hypothetical protein	NA	NA	NA	NA
WP_088610836.1\|1747657_1748137_-	hypothetical protein	A0A0S4L2X9	Pseudomonas_phage	4.0e-29	45.8
WP_155029305.1\|1748133_1748664_-	DUF1320 domain-containing protein	Q5ZQX5	Pseudomonas_phage	2.9e-33	44.8
WP_155029306.1\|1748671_1749145_-	hypothetical protein	NA	NA	NA	NA
WP_125892632.1\|1749306_1750254_-	hypothetical protein	R9U4B8	Rhizobium_phage	1.5e-72	45.6
WP_155029307.1\|1750307_1750667_-	DUF2190 domain-containing protein	NA	NA	NA	NA
WP_155029308.1\|1750731_1751886_-	peptidase	Q5ZQY0	Pseudomonas_phage	2.2e-73	50.7
WP_155029309.1\|1752111_1752687_-	phage virion morphogenesis protein	A0A2H4J9E5	uncultured_Caudovirales_phage	3.4e-35	52.4
WP_155029310.1\|1752686_1753961_-	hypothetical protein	J9STS2	Pseudomonas_phage	6.1e-85	61.2
WP_155029311.1\|1753964_1755485_-	DUF935 family protein	Q5ZQY4	Pseudomonas_phage	3.4e-159	56.5
WP_155029312.1\|1755481_1757218_-	hypothetical protein	A0A219VH72	Ochrobactrum_phage	5.2e-103	43.5
WP_046428350.1\|1757218_1757776_-	DUF3486 family protein	A4JWJ3	Burkholderia_virus	7.3e-35	47.6
WP_046428353.1\|1757780_1758077_-	hypothetical protein	A0A0S4L0A3	Pseudomonas_phage	1.2e-31	62.2
WP_046428354.1\|1758084_1758399_-	hypothetical protein	Q5ZQY8	Pseudomonas_phage	1.4e-11	35.8
WP_155029313.1\|1758395_1758749_-	hypothetical protein	NA	NA	NA	NA
WP_155029314.1\|1758657_1759140_-	hypothetical protein	NA	NA	NA	NA
WP_155029315.1\|1759136_1759868_-	hypothetical protein	J9Q7Y7	Salmonella_phage	1.1e-35	50.6
WP_155029316.1\|1760069_1760453_-	hypothetical protein	NA	NA	NA	NA
WP_155029317.1\|1760473_1760992_-	hypothetical protein	NA	NA	NA	NA
WP_155029318.1\|1761021_1761234_+	hypothetical protein	NA	NA	NA	NA
WP_155029319.1\|1761230_1761539_+	hypothetical protein	NA	NA	NA	NA
WP_155029320.1\|1761554_1762472_+	hypothetical protein	Q5ZR03	Pseudomonas_phage	6.9e-22	33.0
WP_155029321.1\|1762474_1764280_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6QIE0	Burkholderia_phage	3.8e-125	43.8
1764776:1764790	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040436

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection