CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040435	Stenotrophomonas maltophilia strain PEG-42 chromosome, complete genome	5 crisprs	csa3,DEDDh,WYL,cas3,Cas9_archaeal,DinG	0	0	6	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040435_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040435_1

151152-151251

Orphan

Consensus_repeat	Method
GTGGGTGCCGACCGTTGGTTGGCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040435_1

>merge|NZ_CP040435|1|151152-151251|CRISPRCasFinder
GTGGGTGCCGACCGTTGGTTGGCACTTCTACTGTTCTGGTGGGTGCCAGGCTCGCCTGGCACTGCTCCTGCTCGGGTGGGTGCCGACCGTTGGTCGGCAC

>NZ_CP040435|1|1|151152-151251|CRISPRCasFinder
GTGGGTGCCGACCGTTGGTTGGCAC	TTCTACTGTTCTGGTGGGTGCCAGGCTCGCCTGGCACTGCTCCTGCTCGG
GTGGGTGCCGACCGTTGGTCGGCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040435.1\|WP_116896464.1\|161444_162878_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377670
NZ_CP040435.1\|WP_154348309.1\|140366_140801_+\|hotdog-fold-thioesterase	unknown	unknown	gnl\|CDD\|182360
NZ_CP040435.1\|WP_102947295.1\|160516_161536_+\|ATP-binding-protein	unknown	unknown	gnl\|CDD\|379062
NZ_CP040435.1\|WP_049446096.1\|147573_148983_+\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|181884
NZ_CP040435.1\|WP_049446098.1\|149691_151122_+\|ammonium-transporter	unknown	unknown	gnl\|CDD\|182630
NZ_CP040435.1\|WP_080354832.1\|141721_142756_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|223506
NZ_CP040435.1\|WP_154348312.1\|152820_153975_+\|transglycosylase	unknown	unknown	gnl\|CDD\|225377
NZ_CP040435.1\|WP_154348310.1\|145656_146481_-\|DUF4377-domain-containing-protein	unknown	unknown	gnl\|CDD\|379548
NZ_CP040435.1\|WP_049446094.1\|146554_147349_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NZ_CP040435.1\|WP_154348311.1\|151364_152111_+\|N-acetylmuramoyl-L-alanine-amidase	unknown	unknown	gnl\|CDD\|225567
NZ_CP040435.1\|WP_099472824.1\|154714_155293_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP040435.1\|WP_102947297.1\|159274_160276_+\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|99707
NZ_CP040435.1\|WP_049446090.1\|144892_145504_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	unknown	unknown	gnl\|CDD\|176643
NZ_CP040435.1\|WP_004134334.1\|149330_149669_+\|P-II-family-nitrogen-regulator	unknown	unknown	gnl\|CDD\|223424
NZ_CP040435.1\|WP_088480000.1\|140922_141714_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	unknown	unknown	gnl\|CDD\|153251
NZ_CP040435.1\|WP_049446101.1\|152274_152769_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225580
NZ_CP040435.1\|WP_102947296.1\|160286_160517_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_049446104.1\|154084_154399_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_049446088.1\|142812_144882_+\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|274350
NZ_CP040435.1\|WP_102947298.1\|156854_159275_+\|DDE-type-integrase/transposase/recombinase	unknown	unknown	gnl\|CDD\|366234

Protein	Function_ID	Function_description	E-value
NZ_CP040435.1\|WP_116896464.1\|161444_162878_+\|hypothetical-protein	gnl\|CDD\|377670	pfam06527, TniQ, TniQ. This family consists of several bacterial TniQ proteins. TniQ along with TniA and B is involved in the transposition of the mercury-resistance transposon Tn5053 which carries the mer operon. It has been suggested that the tni genes are involved in the dissemination of integrons.	0.000142011
NZ_CP040435.1\|WP_154348309.1\|140366_140801_+\|hotdog-fold-thioesterase	gnl\|CDD\|182360	PRK10293, PRK10293, 1,4-dihydroxy-2-naphthoyl-CoA hydrolase.	4.97387e-47
NZ_CP040435.1\|WP_102947295.1\|160516_161536_+\|ATP-binding-protein	gnl\|CDD\|379062	pfam13191, AAA_16, AAA ATPase domain. This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.	0.000529548
NZ_CP040435.1\|WP_049446096.1\|147573_148983_+\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|181884	PRK09469, glnA, glutamate--ammonia ligase.	0
NZ_CP040435.1\|WP_049446098.1\|149691_151122_+\|ammonium-transporter	gnl\|CDD\|182630	PRK10666, PRK10666, ammonium transporter AmtB.	1.8036e-175
NZ_CP040435.1\|WP_080354832.1\|141721_142756_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|223506	COG0429, COG0429, Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only].	4.80146e-28
NZ_CP040435.1\|WP_154348312.1\|152820_153975_+\|transglycosylase	gnl\|CDD\|225377	COG2821, MltA, Membrane-bound lytic murein transglycosylase [Cell envelope biogenesis, outer membrane].	6.88596e-117
NZ_CP040435.1\|WP_154348310.1\|145656_146481_-\|DUF4377-domain-containing-protein	gnl\|CDD\|379548	pfam14302, DUF4377, Domain of unknown function (DUF4377). This domain family is found in bacteria and archaea, and is approximately 80 amino acids in length.	1.21031e-26
NZ_CP040435.1\|WP_049446094.1\|146554_147349_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	3.867e-85
NZ_CP040435.1\|WP_154348311.1\|151364_152111_+\|N-acetylmuramoyl-L-alanine-amidase	gnl\|CDD\|225567	COG3023, ampD, N-acetyl-anhydromuramyl-L-alanine amidase [Cell envelope biogenesis, outer membrane].	1.05745e-52
NZ_CP040435.1\|WP_099472824.1\|154714_155293_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	8.18453e-22
NZ_CP040435.1\|WP_102947297.1\|159274_160276_+\|AAA-family-ATPase	gnl\|CDD\|99707	cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.	0.000472228
NZ_CP040435.1\|WP_049446090.1\|144892_145504_+\|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein	gnl\|CDD\|176643	cd00865, PEBP_bact_arch, PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea. PhosphatidylEthanolamine-Binding Proteins (PEBPs) are represented in all three major phylogenetic divisions (eukaryotes, bacteria, archaea). The members in this subgroup are present in bacterial and archaea. Members here include Escherichia coli YBHB and YBCL which are thought to regulate protein phosphorylation as well as Sulfolobus solfataricus SsCEI which inhibits serine proteases alpha-chymotrypsin and elastase. Although their overall structures are similar, the members of the PEBP family have very different substrates and oligomerization states (monomer/dimer/tetramer). In a few of the bacterial members present here the dimerization interface is proposed to form the ligand binding site, unlike in other PEBP members.	9.69988e-52
NZ_CP040435.1\|WP_004134334.1\|149330_149669_+\|P-II-family-nitrogen-regulator	gnl\|CDD\|223424	COG0347, GlnK, Nitrogen regulatory protein PII [Amino acid transport and metabolism].	3.60313e-56
NZ_CP040435.1\|WP_088480000.1\|140922_141714_+\|1-acyl-sn-glycerol-3-phosphate-acyltransferase	gnl\|CDD\|153251	cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.	7.51118e-38
NZ_CP040435.1\|WP_049446101.1\|152274_152769_+\|hypothetical-protein	gnl\|CDD\|225580	COG3038, CybB, Cytochrome B561 [Energy production and conversion].	2.98288e-12
NZ_CP040435.1\|WP_049446088.1\|142812_144882_+\|tetratricopeptide-repeat-protein	gnl\|CDD\|274350	TIGR02917, TPR_domain_protein, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.	1.18695e-24
NZ_CP040435.1\|WP_102947298.1\|156854_159275_+\|DDE-type-integrase/transposase/recombinase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.6263e-08

>NZ_CP040435.1|WP_049446098.1|149691_151122_+|ammonium-transporter
MKMRLLTGWQARFHLVCLLMLLSALAAGAWPGNAHAQAQVSPLPSESVAVEPLQDPVAAAAAPAVAEAAAAYDRGDVAWMLTSTLLVLLMVVPGLALFYGGLVRSKNVLSVLSQILVVFSLVLLLWVAYGYSAVFSAGNPFFGSFTEFAFLKGFTPDSVGNTPIKGLPDYLFVAFQSTFAGITTALIVGAFAERIKFRAVLLFSALWFTLSYIPMAHIVWGGGYLGELGAIDFAGGTVVHINAGVAGLVAAWFVGKRLGYGQTALKPHNVPFTYIGAMLLWVGWFGFNAGSAAAADTVASLAFLNTVLATAAAVLGWTLVEAIGKGKPSALGAASGAVAGLVGITPACGTVGPLGAIVIGLVAGVVCVWGVTGLKRLLKVDDTADVFGVHGVGGIVGAILTGVFSAQSLGGTKADLDIAHQVWVQVVSVGLTVVWSAVVTTLILLVVRSVVGLRVTEEAERTGLDVTSHGESAYEA
>NZ_CP040435.1|WP_004134334.1|149330_149669_+|P-II-family-nitrogen-regulator
MKLISAIIRPFKLDEVREALSDAGVSGITVTEVKGFGRQKGHTELYRGAEYVVDFLPKIKIETVVTDERADAVIEAIQSSAGTGKIGDGKIFVTAVEQVIRIRTGEIGADAL
>NZ_CP040435.1|WP_049446096.1|147573_148983_+|type-I-glutamate--ammonia-ligase
MSVENVEKLIKDNQIEFVDLRFVDMRGVEQHVTFPVSIVEPSLFEEGKMFDGSSIAGWKGINESDMVLLPDTSSAYVDPFYADPTIVISCDILDPATMQPYGRCPRGIAKRAEAYLKSSGIAETAFFGPEPEFFIFDSVRFANEMGNTFFKVDSEEAAWNSGAKYDGANSGYRPGVKGGYFPVPPTDTLHDLRAEMCKTLEQVGIEVEVQHHEVATAGQCEIGTKFSTLVQKADELLRMKYVIKNVAHRNGKTVTFMPKPIVGDNGSGMHVHQSLSKGGTNLFSGDGYGGLSQLALWYIGGIFKHAKAINAFANSGTNSYKRLVPGFEAPVMLAYSARNRSASCRIPWVSNPKARRIEMRFPDPIQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYDLPPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQEVTKFRAATHPLEYQLYYAS
>NZ_CP040435.1|WP_049446094.1|146554_147349_-|undecaprenyl-diphosphate-phosphatase
MSDLLSALLLGILEGLTEFLPISSTGHLLIAQHWLGARSDFFNIVIQAGAIVAVVLVFRQRLLQLATGFNQRENREYVFKLGAAFLVTAVVGLVVRKAGWSLPETVSPVAWALIIGGVWMLLVEAYTARLPDRDQVTWTVAIGVGLAQVVAGVFPGTSRSASAIFLAMLLGLSRRAAAAEFVFLVGIPTMFAASAYTFLEMAKAGQLGSENWTDVGVAFLAAAVTGFVVVKWLMGYIKSHKFTAFALYRIALGAALLLWLPSGS
>NZ_CP040435.1|WP_154348310.1|145656_146481_-|DUF4377-domain-containing-protein
MNRKLTLLLPLALMAACSQTPAPAGTGGDDVAPAAAKAADQQTLAHLDAQRLQSQHWLLQQATAGDGKRIDALFAREDKPVTLDFADGRLSVSNTCNRMGGGYTFDAGKLSVSAMASTMMACTDKALMALDEAVSSRLQGELKAEQDADGKLTLTNAKGDRLVFTPEPTAETRYGGAGETVFLEVAAKTEKCSHPLIPDYQCLQVREVKFDDKGLKQGEPGKFENFYGNIEGYTHEDGVRNVVRVKRYEVKNPPADAPSQAYVLDMVVESAIEK
>NZ_CP040435.1|WP_049446090.1|144892_145504_+|YbhB/YbcL-family-Raf-kinase-inhibitor-like-protein
MQLSSNSLTNGAPIDREFAAGDAAGFAPDRNPHLAWSGAPAGTRSFLLVCVDPDVPTVPETVGRNDMTVPRDQPRCDFVHWVMADIPASVQEIAAGSCSDGFVVKGKPAPAGPAGSRQGLNDFTGWFAGNPDMAGDYLGYDGPYPPFNDERVHRYFFRVFALDVASLELPARFTAADAYRAMHGHVLAEAALHGTYTLNPALA
>NZ_CP040435.1|WP_049446088.1|142812_144882_+|tetratricopeptide-repeat-protein
MQDQIIQALRQNQADQAVQLAQAWTRDEPGRADAHRWLALALQQQGNAEAAMEALQQALRLAPDDAQLHLQHAGLLLALRQFEGADEALVRTTGLDPNSFSAYLMQAHLAIGRNDFDEAQRISTLAARVEPEHPELLTIDGMVALRRGEADRALALLSAASKALPDDTRVLYALGFAYLGKDMLAFAEQSFRRVLELNPSLSSLHGLVVQLALRQGNVPAAAEAVQVALRQPELDVPAMRRLAGELALRNGQPLQALDYLLPLLETQPEDRQVLQLLLMSWQRLGREEEARARLDAVLDAHDQLHDVWLARLAIEQVGSESAVAAVERWMAAMPTHVPALEARLRLHDMAGEHAQAEAIAERIVSLEPGRVSGESRLVEGLLQRDPAAAVARVQALIEQAPEAHRADLRTWMGEIQDRAGQPQEALRTWMSLQTDQAPQRLPLPPQAKSPPSWPDKGSIEGDASSAPIFLWGAPGSGVERVATGLAAASPVLRSDRYTNTPPDDAFQNYNTLQDLASGVLTPERLVQRWREQLPARGLQSDTVIDWLLWWDNALLWALRPQLPQGRLVLVLRDPRDMLLDWVAYGAAAPLAMTSLAEASEWLTRALTQIATLHEEDLYPHVLLRIDQIGNDPHAMAELLGRLFERPMPPAAQLGAPRLPAGHWRNYRDVMSAAFAQLTPVAVRLGYPEE
>NZ_CP040435.1|WP_080354832.1|141721_142756_+|alpha/beta-fold-hydrolase
MALIPPPVLDAGTPTLHAADYQPPRWLRNPHLQSMLSSSRMRLQRGLLLLAATGAVSEELILDGGDGVRLQGWHSHVEGRQPKGIALLLHGWEGSAESSYMRMAAARMIEQGFDVVRLNFRDHGNTHHLNPGIFHSNLIDEVVHAAGDIAQRWPQLPLVAAGYSLGGNFVLRLALRAPAAGVPLLRVASVCPVLDPALTMDSIENGPAMYDWYFRRKWAGSLRRKRDLFPELSDCDDRVLKLDIRALTAWLVERHTSFGSLQAYFDGYSIAGDRLSALQVPADILMAQDDPVIPYATFSDWQLPRQARLETACWGGHCGFIENWRGDGFSERWVAQRLQRVLQA
>NZ_CP040435.1|WP_088480000.1|140922_141714_+|1-acyl-sn-glycerol-3-phosphate-acyltransferase
MTSPTPAPRGGLARVCRYLYRVPLLLVHISVFLPLILIGMLPPWGELRVGEDTFGAKVVNWWQGGLMWIFGFRLSQIGKPLPGAVLFVANHVSWVDISILHSQRMMGFVAKREIASWPLVGWLAARGQTIFHQRGNTESLGGVMQVMAERLRTGKAVGVFPEGRTRGGHEVGPFHARIFQAAVETGVPVQPVALVYGVKGDAQTIVAFGPGESFAANFLRLLGEPARHTEVHFLEPIGTQDLEGRRRIAETSRARIVAAMSTQ
>NZ_CP040435.1|WP_154348309.1|140366_140801_+|hotdog-fold-thioesterase
MTQVFREAVSIEQLNALSRNTAIESLGIVFSAVGEDWLQATMPVDERTRQPYGILHGGASVVLAETLGSSAGNLCVDPAQQICVGLEINANHVRAVRSGTVTGTARALHVGRSTQLWEIRIEDEQGRLVCISRLTLAVVAAGHG
>NZ_CP040435.1|WP_154348311.1|151364_152111_+|N-acetylmuramoyl-L-alanine-amidase
MHPIRTALMLSACLLLAACASTPQETRNPLATWVPSPNQNARTPVIIVIHHTEQKSVQQSLHTLRTANSGGPVSAHYLIGADGHRYQLVADERRAWHAGAGRWGTITDLNSASIGIELDNDGRSPFSAAQIESLIVLLRDLTTRLNIPPRQVIGHADLAPTRKQDPSRFFPWQQLAEAGFGIWPRAADGAAPGGFDAWNALARFGYPLDNREATVAAFHRRFRGRDDLPKTLDAEDARILHSLLLQTP
>NZ_CP040435.1|WP_049446101.1|152274_152769_+|hypothetical-protein
MRYSKAQVLLHWISAVIILWATVSGFYVALLDVPHTVAETIGFFNVSITSVLIPLFAIRVVIAISNHRDAPASGAEWAALIAHAALYLVTTVVLLTGVLMMEREINVFNLVSFPQPISDPQLTMAFNTAHRYACVVLGGLLFLHIAAVVKHHLSGNAILKRMSW
>NZ_CP040435.1|WP_154348312.1|152820_153975_+|transglycosylase
MTAFNAQSNRRYWSLGTLVLLAGCSTLGTPPETPPAPSPATYVKAEWGALPSVSDNDLQAGFVAWRSSCTRLKNDAVWAKPCATAATVSDKDPAAIRQFLQRDLDVYALRAGGHQADGLITGYYEPIYAGSLTRTAAATVPVYGTPDDLVVVQLDSVYPELKGKRLRGRVEGKVLKPYDDAGTIAAKGAKAPVLAWLTDPMDLQLLQIQGSGRVRLGDGKQVRLAYAEQNGHPYRAIGRWLVDQGQLKKEDVTMDAIRAWARANPARVPELLRSNPSYVFFVRNPDSPEGPRGSLNVPLTAGYSVAVDRSVVPLGSLLWLSTTRPDGTPVVRPVAAQDTGGAIAGEVRADLYWGSGDAAGKLAGDMKQKGNIWMLWPKGVALPQ
>NZ_CP040435.1|WP_049446104.1|154084_154399_+|hypothetical-protein
MTYAKHNAKPGTKSAAKKYYKHWAESGLGKGNVLMEARGEKIVRQVEIYGTKMVWADEHAHSDDRFLLADQPVSFLDFDEDDEISAREFESAWKKAREATGYPV
>NZ_CP040435.1|WP_099472824.1|154714_155293_+|histidine-phosphatase-family-protein
MLVVVRHAQSMANAGFATADPESIALTAAGEEQARALAMTWSAAPDRIFTSPFLRARQTSQPLAERFKMVVAPLGVHEFTYLSPERCVGTSAADRKQWVEDYWSRCDPNYVDGPGAESFAQLVARAARALRILKSYSAHEQVVVFSHGQLMQAMRWICGSKAPSVVNAAAMGAFRKLDLDQPIAHCQRVSFE
>NZ_CP040435.1|WP_102947298.1|156854_159275_+|DDE-type-integrase/transposase/recombinase
MSTDPQFGGLSFEDRHQLYTRIKASELSIRQLENMIAGSGTKTVGRAALRNVRVRHNSIKNGSARTVESHTCELVFAYELELDPEVLGYYVQVPCRRVQRTTASGRNHISTAHVDFLVFRRDHVELVECKPLSWLESQLALPDSLWVKQDAVWTYSPYAQWARQHGLAFRVWVPPTPTGVYLQNLEACYAVAGDALQQHETTAVTKAVGLIAKRPLLLDSLLAEVPGFTPRLALWMLGRSAAFGPWQSTPAARTDRFHLYGTKEQAKEADELLLGAIVKAQSQPAVDDPLLVATATDLQRAHQRLSRLALIEAGSLPATRRMGALQRQVRKAVAEGRSALSACLTKYALSGNRASRLLPEHEQAIETVIALHWNTGRVHRPKDLLYVFEEECLRLGVEPCGRARLDARRRSESPTRHALSTGGFRAYHATRTRTDPRHRSLPPIGYGHTLHVDSSDLDVRCAPNLIHCFPASKAKFYIGIDGATGYPMAHAMVFGSARTDALALLMREYVRRQGFLPKLIHLDRGPENTSRWLQDFCHGEISLRFSPTAGSAWNGIAENAIKQVNEQVAQRFPGSTRPDQMGRKVDGRFKSRNNARTDFVRVHEEFLKFVYHDLPMTPGPDDTTPAEKRVEALAAYGAVGTPCEWDDGFLIRTAIKVETKKRIDRQRGVRTADGWFTSDELLQELRTENASEVRSDCCDPSVMYVKVRGSWFKAFHNKVQSDALLSDQERLFHLLWAPTLRSQSAKRKEEVARARHSRRVQAQAARPATEHLAPAPMTGSDERIDIEPVPPAIAQDIVPFDEREDY
>NZ_CP040435.1|WP_102947297.1|159274_160276_+|AAA-family-ATPase
MKMVQHPAYEGPRKRLRMALDQHRPGHMVFIIGPSGVGKTTMRRSVMQEMFGNPACWDCGRIPLVETFATLPHGAYFSSRQLAVSILQELHAPTLAWLLDGSYLEEDAKLRIRRELAAATSEWASLARTRQTEGEYWGMVQRSLRARSCKYVSIDQVTALLVNHRDKSPADHTLHLMAIAEATGVMFVMTGVHKATQLWSVNSELRRRVTTVWVPPYSDKRRDDKLPFLRLLKSLATRYGLSQDDLLIRMANDILAATGGVFAEVVELLGRADIAAKQEGCNRILKRHIEISYYGSEDLRNLWRDIDAFEMSMVAGSVTERSEHVKARWGSPT
>NZ_CP040435.1|WP_102947296.1|160286_160517_+|hypothetical-protein
MVITDLNQMRWGADARRRRDNLARKPHARRQFAAALIIAIALLSPLAEVAESTSHEGQDIDPSQEGIEALDKAEDF
>NZ_CP040435.1|WP_102947295.1|160516_161536_+|ATP-binding-protein
MKVLQHPAYRRPRDRLRAALDNHRPGHMVFVIGPSGVGKTTMRRSVMREMFGNPNLWEKGKVPAIETFACLPVGAYFSSRYLARELLKELNAPTLTWALEGGSHLSMPPSDIQAEVRDRDLQLGRYQLRLTEAECWSSVKRSMIARDCKYVAIDQISALLVNHRNKSPADHVLHLMTLAESAGSMLIMTGIHRAVQLWSIESEFRRSVTSIWVPPYSVRRREDRAPFLRLLTSLTERHNFSKQDLLIRMAADLLVATGGVYGEVAQLLSRAEDAAKQEGSERILKRHIEASYYSDNDLANLWRDIEDFEDAMEAGSATARAKRLKSSWASSYGEVCREV
>NZ_CP040435.1|WP_116896464.1|161444_162878_+|hypothetical-protein
MQWRLEAPQPGRNGSSLVGPPLMGRCAVKSSTQRFTWSSLPPLQLKGVGTSRVESLEHYVLRQAWTVGVTMANMMSIVGPAIDGGRRGQVMGSGKYCGPSRDFSHRISTLKMLTAQDDLQCGTFWVLEDVLATYGGGRDTTRRRWCPVCYRDWDDDLSYEPLSWIVDIQAECDQHKCKLETTCTRCGADQPSSTDYQRRRRCHKCKQSLSGDGVAAAITGDEAWGQQQLASIIELCATPSQPQIPFENYVRFVKLLVDGHPMRRAYPNALKAEFYRATKNLTRGRTTIRAIVNLCALQSISARDILLSPDAAASEPLLDLWFSYATLKLPVGRHAERLERCAKCFSDVLKSSEKDHYVPQMKVVLRRFRLNRQLLREMHLDVYEEYKLRYEEQGPYSQRVHLNRAMDLALQMVEGDVDQVGSHRKLQQAAKQIGQRCNVSLDVGFSVMLGARNVLKALSENRLRKQRSGGRRPHSVA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040435_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040435_2

2823320-2823468

Orphan

Consensus_repeat	Method
GCTGCCGACCGAACCGACCGTGCCGTTGAGCGCACCACCCACGGTACCGC	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP040435_2

>merge|NZ_CP040435|2|2823320-2823468|PILER-CR
GCTGCCGACCGAACCGACCGTGCCGTTGAGCGCCCCACCCACGGTCCCGCCGACTGCACCCACCGTGCCAACCGCGCCGTTGAGCGCGCCGCCGACTGCGCTGCCGACCGAACCGACCGTGCCGTTGAGCGCACCACCCACGGTACCGC

>NZ_CP040435|2|1|2823320-2823468|PILER-CR
GCTGCCGACCGAACCGACCGTGCCGTTGAGCGCCCCACCCACGGTCCCGC	CGACTGCA
CCCACCGTGCCAACCGCGCCGTTGAGCGCGCCGCCGACTGCGCTGCCGAC	CGAACCGACCGT
GCCGTTGAGCGCACCACCCACGGTACCGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040435.1\|WP_049448353.1\|2834023_2834962_+\|type-II-secretion-system-F-family-protein	unknown	unknown	gnl\|CDD\|224975
NZ_CP040435.1\|WP_154349253.1\|2810854_2811775_-\|DUF2817-domain-containing-protein	unknown	unknown	gnl\|CDD\|349450
NZ_CP040435.1\|WP_088480826.1\|2818449_2819286_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|236764
NZ_CP040435.1\|WP_080354918.1\|2814008_2815823_+\|chloride-channel-protein	unknown	unknown	gnl\|CDD\|238233
NZ_CP040435.1\|WP_154349255.1\|2816656_2817064_-\|MerR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133408
NZ_CP040435.1\|WP_154349260.1\|2828007_2829042_+\|Flp-pilus-assembly-protein-CpaB	unknown	unknown	gnl\|CDD\|274472
NZ_CP040435.1\|WP_154349262.1\|2830445_2831702_+\|fimbrial-protein	unknown	unknown	gnl\|CDD\|349765
NZ_CP040435.1\|WP_099589687.1\|2833038_2833995_+\|pilus-assembly-protein	unknown	unknown	gnl\|CDD\|227300
NZ_CP040435.1\|WP_099589684.1\|2827507_2827984_+\|pilus-assembly-protein-TadE	unknown	unknown	gnl\|CDD\|377921
NZ_CP040435.1\|WP_049448358.1\|2831686_2833036_+\|CpaF-family-protein	unknown	unknown	gnl\|CDD\|227297
NZ_CP040435.1\|WP_049448116.1\|2817127_2817955_+\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|379312
NZ_CP040435.1\|WP_008265168.1\|2818037_2818340_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_154349257.1\|2825030_2826011_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|378964
NZ_CP040435.1\|WP_154349259.1\|2826965_2827511_+\|prepilin-peptidase	unknown	unknown	gnl\|CDD\|227295
NZ_CP040435.1\|WP_154349261.1\|2829059_2830418_+\|type-II-and-III-secretion-system-protein-family-protein	unknown	unknown	gnl\|CDD\|227299
NZ_CP040435.1\|WP_154349252.1\|2809928_2810780_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP040435.1\|WP_154349254.1\|2811906_2813988_+\|TonB-dependent-siderophore-receptor	unknown	unknown	gnl\|CDD\|227113
NZ_CP040435.1\|WP_010485159.1\|2815924_2816641_+\|MgtC/SapB-family-protein	unknown	unknown	gnl\|CDD\|224204
NZ_CP040435.1\|WP_154349251.1\|2809414_2809768_-\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|182471
NZ_CP040435.1\|WP_154349258.1\|2826706_2826898_+\|Flp-family-type-IVb-pilin	unknown	unknown	gnl\|CDD\|226366

Protein	Function_ID	Function_description	E-value
NZ_CP040435.1\|WP_049448353.1\|2834023_2834962_+\|type-II-secretion-system-F-family-protein	gnl\|CDD\|224975	COG2064, TadC, Flp pilus assembly protein TadC [Cell motility and secretion / Intracellular trafficking and secretion].	7.06202e-13
NZ_CP040435.1\|WP_154349253.1\|2810854_2811775_-\|DUF2817-domain-containing-protein	gnl\|CDD\|349450	cd06231, M14_REP34-like, Peptidase M14-like domain similar to rapid encystment phenotype 34 (REP34). This family includes Francisella tularensis protein rapid encystment phenotype 34 (REP34) which is a zinc-containing monomeric protein demonstrating carboxypeptidase B-like activity. REP34 possesses a novel topology with its substrate binding pocket deviating from the canonical M14 peptidases with a possible catalytic role for a conserved tyrosine and distinct S1' recognition site. Thus, REP34, identified as an active carboxypeptidase and a potential key F. tularensis effector protein, may help elucidate a mechanistic understanding of F. tularensis infection of phagocytic cells. A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The A forms have slightly different specificities, with Carboxypeptidase A1 (CPA1) preferring aliphatic and small aromatic residues, and CPA2 preferring the bulky aromatic side chains. Enzymes belonging to the N/E subfamily enzymes are not produced as inactive precursors and instead rely on their substrate specificity and subcellular compartmentalization to prevent inappropriate cleavages. They contain an extra C-terminal transthyretin-like domain, thought to be involved in folding or formation of oligomers. MCPs can also be classified based on their involvement in specific physiological processes; the pancreatic MCPs participate only in alimentary digestion and include carboxypeptidase A and B (A/B subfamily), while others, namely regulatory MCPs or the N/E subfamily, are involved in more selective reactions, mainly in non-digestive tissues and fluids, acting on blood coagulation/fibrinolysis, inflammation and local anaphylaxis, pro-hormone and neuropeptide processing, cellular response and others. Another MCP subfamily, is that of succinylglutamate desuccinylase /aspartoacylase, which hydrolyzes N-acetyl-L-aspartate (NAA), and deficiency in which is the established cause of Canavan disease. Another subfamily (referred to as subfamily C) includes an exceptional type of activity in the MCP family, that of dipeptidyl-peptidase activity of gamma-glutamyl-(L)-meso-diaminopimelate peptidase I which is involved in bacterial cell wall metabolism.	6.24951e-65
NZ_CP040435.1\|WP_088480826.1\|2818449_2819286_-\|OmpA-family-protein	gnl\|CDD\|236764	PRK10808, PRK10808, outer membrane protein A; Reviewed.	8.16829e-36
NZ_CP040435.1\|WP_080354918.1\|2814008_2815823_+\|chloride-channel-protein	gnl\|CDD\|238233	cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel. The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function.	3.84756e-93
NZ_CP040435.1\|WP_154349255.1\|2816656_2817064_-\|MerR-family-transcriptional-regulator	gnl\|CDD\|133408	cd04781, HTH_MerR-like_sg6, Helix-Turn-Helix DNA binding domain of putative transcription regulators from the MerR superfamily. Putative helix-turn-helix (HTH) MerR-like transcription regulators (subgroup 6) with at least two conserved cysteines present in the C-terminal portion of the protein. Based on sequence similarity, these proteins are predicted to function as transcription regulators that mediate responses to stress in eubacteria. They belong to the MerR superfamily of transcription regulators that promote transcription of various stress regulons by reconfiguring the operator sequence located between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their N-terminal domains are homologous and contain a DNA-binding winged HTH motif, while the C-terminal domains are often dissimilar and bind specific coactivator molecules such as metal ions, drugs, and organic substrates.	4.15119e-37
NZ_CP040435.1\|WP_154349260.1\|2828007_2829042_+\|Flp-pilus-assembly-protein-CpaB	gnl\|CDD\|274472	TIGR03177, pilus_cpaB, Flp pilus assembly protein CpaB. Members of this protein family are the CpaB protein of Flp-type pilus assembly. Similar proteins include the FlgA protein of bacterial flagellum biosynthesis.	4.65531e-32
NZ_CP040435.1\|WP_099589687.1\|2833038_2833995_+\|pilus-assembly-protein	gnl\|CDD\|227300	COG4965, TadB, Flp pilus assembly protein TadB [Intracellular trafficking and secretion].	3.06437e-35
NZ_CP040435.1\|WP_099589684.1\|2827507_2827984_+\|pilus-assembly-protein-TadE	gnl\|CDD\|377921	pfam07811, TadE, TadE-like protein. The members of this family are similar to a region of the protein product of the bacterial tadE locus. In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria. All tad loci but TadA have putative transmembrane regions, and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues.	0.00013888
NZ_CP040435.1\|WP_049448358.1\|2831686_2833036_+\|CpaF-family-protein	gnl\|CDD\|227297	COG4962, CpaF, Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion].	1.40641e-151
NZ_CP040435.1\|WP_049448116.1\|2817127_2817955_+\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.03784e-23
NZ_CP040435.1\|WP_154349262.1\|2830445_2831702_+\|fimbrial-protein	gnl\|CDD\|349765	cd03111, CpaE-like, pilus assembly ATPase CpaE. This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster. The function of these proteins are unkown. The Caulobacter pilus assembly contains 7 genes: pilA, cpaA, cpaB, cpaC, cpaD, cpaE and cpaF. These genes are clustered together on chromosome.	1.37799e-39
NZ_CP040435.1\|WP_154349257.1\|2825030_2826011_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|378964	pfam12833, HTH_18, Helix-turn-helix domain.	1.68427e-18
NZ_CP040435.1\|WP_154349259.1\|2826965_2827511_+\|prepilin-peptidase	gnl\|CDD\|227295	COG4960, CpaA, Flp pilus assembly protein, protease CpaA [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion].	2.35663e-11
NZ_CP040435.1\|WP_154349261.1\|2829059_2830418_+\|type-II-and-III-secretion-system-protein-family-protein	gnl\|CDD\|227299	COG4964, CpaC, Flp pilus assembly protein, secretin CpaC [Intracellular trafficking and secretion].	1.11661e-98
NZ_CP040435.1\|WP_154349252.1\|2809928_2810780_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.53318e-34
NZ_CP040435.1\|WP_154349254.1\|2811906_2813988_+\|TonB-dependent-siderophore-receptor	gnl\|CDD\|227113	COG4772, FecA, Outer membrane receptor for Fe3+-dicitrate [Inorganic ion transport and metabolism].	2.15673e-156
NZ_CP040435.1\|WP_010485159.1\|2815924_2816641_+\|MgtC/SapB-family-protein	gnl\|CDD\|224204	COG1285, SapB, Uncharacterized membrane protein [Function unknown].	1.17667e-50
NZ_CP040435.1\|WP_154349251.1\|2809414_2809768_-\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	gnl\|CDD\|182471	PRK10452, PRK10452, multidrug/spermidine efflux SMR transporter subunit MdtJ.	4.62137e-24
NZ_CP040435.1\|WP_154349258.1\|2826706_2826898_+\|Flp-family-type-IVb-pilin	gnl\|CDD\|226366	COG3847, Flp, Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion].	1.86537e-09

>NZ_CP040435.1|WP_088480826.1|2818449_2819286_-|OmpA-family-protein
MKLHRIARSGQMAAMLGLVLGMGLLAACRSHAPAAEGPAEATAVHFPEASKASLKEGIYPDVADLRRFAPGMTKRQLYTLLGTPHFNEGMWGVREWNYLFNFRTAQGAEYFTCQFQVRFDSKGVAQGGYWKPESCAAVIEPPRPPAPPAPAPLPEQPLRLSADALFGFDSAVLSAEGQQAVQGILAQVREAAQVQSIRVTGYTDRIGSASYNQTLSQRRAEAVRSALVQGGVPAASISAEGRGAAEPIVQCEQRNRRELIACLAPNRRVQIAGMAQPR
>NZ_CP040435.1|WP_008265168.1|2818037_2818340_-|hypothetical-protein
MVHAMNAQFLPLSMKTETTLSVYGQLGNHAVVRIPGRRLPGLILQADTVAGFLAQLQEAQACLRSGRAQRTDAELDMLIDVLQQWYALIESRLADAGEAL
>NZ_CP040435.1|WP_049448116.1|2817127_2817955_+|class-I-SAM-dependent-methyltransferase
MTSTPPVDQNTLWNGPGGQIWVAQQAILDGLFQPMADLLVAELPQTVTQLLDIGCGTGASLLAAAAARPAAHCTGLDISAPMLAMAHQRAEAAGLDADFIVADAQQHPLPPAHFDWIQSRLGVMFFEDTEAAFGNLHRAARPGAGLRFIAWRSAAENPFMTTAERAIGDELDLPPRAPGAPGQFAFADGQHVQRLLQAAGWTQVETIAVDLPCSIARDALPTYVGQLGPLGLALRNLPEERATSLRNTALAAFNPFIEGDRVRVDAACWLVRARA
>NZ_CP040435.1|WP_154349255.1|2816656_2817064_-|MerR-family-transcriptional-regulator
MRELDIGEVVKRSGVPASTLRYYEQLGLLQAQGRRGLRRQYDEQVLERLALIGLGQAAGLSLQQIGASLPPQHGCISLDRKALLAQADVLQRQITQLQRVRRHLQRAAACPEAQDARQCGSFQKLLRAQQRMAGR
>NZ_CP040435.1|WP_010485159.1|2815924_2816641_+|MgtC/SapB-family-protein
MRFIETFQAGPFADTVVSLLAAFVLGTLIGAERQYRQRTAGLRTNVLVAVGAAAFVDLGMRIAGSAEAVRVISYVVSGVGFLGAGVIMKEGMNVRGLNTAATLWCSAAVGSCTGADMLAEGVLLTVLIIAGNTLLRPLVNAINRIPINEAATEATYEVRLSVDAEAVPRVRERLVDALEAAQYPVGDVQLVEHADAPTDVIAVLVSTAVSADELDVVLARMEHVPGVLHATWEVSTRD
>NZ_CP040435.1|WP_080354918.1|2814008_2815823_+|chloride-channel-protein
MTVAITVAAYHAATMSPSALPSRLHLAFQGLRLRLRGSDLWFIALALLVGLIAGYLTLLQSGIARWLQGTLYGLDEGMRLSSLPSLTWTALLVLPLGGLLVGLVSLAATRLKRPLLDAVEANALHGGRMSMRDNLIVLTQTLLSNGCGASVGLEASYTQMGAGSGSQLGRVMRLRRNDVRILVGAGAAGAIAAAFGAPLAGAFYAFEIVIGAYTPAALAPVAVAALAGAFVADQAGIEAYLLPAASTIDVRAADYAIYGLLGCCCAMVGIVIMRLIASIEGTVKRSPLPLWGRPVVGGLLLIPLALASPQVLSSGHGALHLDLTTHLPLIWIGGLLTLKCLASGISLGFGFRGGLFFASLFMGTLVGALFAGLLAMATGVPVIDATSAALAGMAALAAAVVGAPMTMAMLVLEGTHDFLLTSVVMSAVLVSSTLVRQWFGYSFSTWRMHLRGETIKSARDVGWVQNLNAGRLMRKGVATAPADLDAAAFRQRFPLGSGSRVILIDSEGHYAGIVQIPRVYGDGVKPETMIGELAGNRDVSLSPAADVVSVMQRFDQTQADELAVVAADGQVLGVVSEAFVRKRYAEELDKRQRELMGERVDDTD
>NZ_CP040435.1|WP_154349254.1|2811906_2813988_+|TonB-dependent-siderophore-receptor
MPIHALQPARLPLAAALALCLLPATHAFAQDGATTLDSIQVSGSWLGTGLHDSVKSFAGARTVVERQRIEASGAASIGDAMRRIPGVQVTDNSGTAGSSVSLNIGVRGLTGRYSPRSTVLLDGVPLAVAPYGQPQLSFAPTSLSNIESIDVVRGGGAVRYGPQNVGGIINFSTRAIPTEAGLHGEAGVRYTAYDHGGGDSTQYNAFLGGTGDNGLGAALLYSGQDGRGWRQGSDDRFNDLALKFAYAIDEQQELRAKLSYYDVRSLTPGGLTRAQYEADPFQNTRPTDFWKGHRTGIDLGYTNTLSANSEFEVLAYYNESNRASSLINAANTQLTVQPRDYRVLGIEPRYTQRLHWGASVHDITAGYRFLRERGNDRSYTVTRRTGVASATTRFDNATDAHAFYIDDRIAIGQWRITPGVRMEWIDMDRRQAGGTATFSSRNDKALPSLNVAYLLTPQLTVFGNYTTSFGPVQNIQLNSQTARNPLNPEVAKTAELGARWQDGALRAEVTVFKMRFDNQILQVPGITPPTFQNIGATDHKGVESALEYRFAEDSALAGLELYANYTWTKAIQQSGDNRGLDVPFYSRDTDSVGARYALAGWTFNVSSTHQSGQFSDAANTWEETADARVGRVPGVRLWNAQVAWQVPGLGDSEIALGVNNLADKRWYTRNVDGNAGRMAAAPRTFYVQGRYRF
>NZ_CP040435.1|WP_154349253.1|2810854_2811775_-|DUF2817-domain-containing-protein
MSQAAFYPVGTSGQPWGAAERELWRGRQQRLRRYDEEVLPRIEALASRFDKVAYGQLDYAGETYTLFALRSRDWNPALPAALVTGGVHGYETSGVMGALEFLEKHAADYAGKANLLVAPCVNPWGFERINRWNFDAIDPNRNFRADGPARESTALIELITPIQGQFVLHIDLHETTDSDESEFRPALAAREGKPFEPGLIPDGFYLVDDSENPQAAFQQAVIAAVEKVTHIAPADDKGEIIGSPVVAHGVIEYPLVKLGLCAGITGAKYTTTTEVYPDSPRATPQQCNDAQVAAVCSALDYALAHR
>NZ_CP040435.1|WP_154349252.1|2809928_2810780_+|LysR-family-transcriptional-regulator
MPYSPESLQAFVEAAALGSFSAAARRLRKTQSTVSTAIAHLEADLGVSLFDRSGRYPQLTEAGRQVLGHAQEILAADARLQQLSVRLAAPVESRLTVVFSDVYQLDPGQRILQRFAEAFPEIELEWLDAEGEDVLELVGSGRAGLGLLPRQERYPDGLMARPLAHHSELSVYVAREHPLASAGRRTAAQLARHRQVRLSAEVDQSRVVTGLAWTATDYLMVMEMAEDGLGWAELPRALVQRYDRGRLVELVLPGWPRRIHSDLLWRRDTPPGPAALWWADALG
>NZ_CP040435.1|WP_154349251.1|2809414_2809768_-|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter
MSRTVPARGALVAWACLTVAIVAEVVGTSFMAHAARDGGWTGYLIMAGALALSYFFLAQSVRRIAVGVAYAVWEGLGLTLLTVVGLTVFGESLSLQQLVGLVLAVVGIVCVTLGEAH
>NZ_CP040435.1|WP_154349257.1|2825030_2826011_-|helix-turn-helix-domain-containing-protein
MVDGGVGDSDESGLRSIDLATLSGVLRVCDVELLLLDGNGPRAAFASRVHEEALFCSISCGFHCRGRFMLPPDWAMLGYLHATDETLSWCHGVPLTPGMALTVMPEGISEFTLSPGTHMTLMLVPVARVQRKLTELSLRSTPPAGQALSLFNLASDTTPLAQHYQQLHVQLGQGASLQPEETEKLLHEHVQALLGAGAADRPGCSRARRTHYLIAQRAENFMRLNLRRNIYMNEICDAAGVSERGLRYAFEDLFGTSPNRYLSMLRLCAACRSLSMADSSRRSVKAIALSCGLWDLSRFADNYRKVFGELPRDTLMRAPAQIGQPA
>NZ_CP040435.1|WP_154349258.1|2826706_2826898_+|Flp-family-type-IVb-pilin
MNASIRKFLKDEDGVTALEYGLLAAVIAGVLIALGSTQIQTFFSTLFENLTKLANKASGTTPA
>NZ_CP040435.1|WP_154349259.1|2826965_2827511_+|prepilin-peptidase
MTLLGLLAIGVCLRIAISDLYARRVPNAWLLSACAITVVLLIAGQFSAPRLPWISHVAGAALGLVALLPFYALRWMGAGDVKFFSALGLMLGWQALLPIWIAASIAAGVHAAVVLVSRRLGPVLPIGLQAQMIRASSQWHSHPVLRGMQSARQGRQGIPYAAYLAMAAIGWILFSTYGGLT
>NZ_CP040435.1|WP_099589684.1|2827507_2827984_+|pilus-assembly-protein-TadE
MNIHRPRLQRGVVSIEFALMLMLGLLPLLLFTFSGVMIMAAQQTLATASAEGARASLRYGTANERRTAACVAARGSMQWLLNFSGQPVDCSNGGSNAVTVSAQAPCAGLATVQCITVTVSYDYASHPFLPGTATLYKWVMKAPIRSVAVAQLDLGSGN
>NZ_CP040435.1|WP_154349260.1|2828007_2829042_+|Flp-pilus-assembly-protein-CpaB
MLKLTRIAAVALIALAVLLAVVALMIGRRSAAPASVAPVAHSEAQAITVVEAVARLPAGEPISANGVRLAQRSTPVAGAATSMSAVVGKVPVQDIAEGTAISAGSLAQGFSLQLRAGERALAVPVDELVGAGNRILPGDFVDVFLNLRNAQPNVNSPGEAAQTRLLLSRLRVLSYGQQDIAPASDAAVASSEADTRNDPRAADITGSSNQSTGSETTQPARSAVLAVPVADANRLLLGAQQGKLFLALRNPADSGQPDLALFPQARGVIDPLRGLDAEQQLALQRPENHAFAGIDGDALAGRSSTPARNYPEAPARAPAPRRSAPRAPGIEIIRGDGSAPRGSL
>NZ_CP040435.1|WP_154349261.1|2829059_2830418_+|type-II-and-III-secretion-system-protein-family-protein
MTERRHCPRPSPRQRWLALLLVLLAPATSVAADDLVLQAREQRPWTLPGDLERVAIADPGVADIVMLRGQRQALLVGKAPGTTTLLLWHRKQTEPQRLQVRVQSAVQGAADAGANGLVFTQQDNQGLLQGSTDSVLSHMQEQKPAAMALGKDGMLADASTVNSGGVVQVEVKVVEFNKTALKQIGISFQNRNGSFAYGFARPGGQLPGNTGILSGMKEGNSGNEAESPISSAFRLVFGSTKGLWNADVDLLQSNGMARVLAEPTLVALSGQSASFLAGGELPILEPQGLGTTTITYKPFGIGLTVTPTVLSPNRIALKVAPEASDLDYSNAIALNGVQIPSITTRRADTTVELGDGESFVIGGLVSSNVVSNVGKIPLLGDLPIIGSFFRNFDYKRQDKELVIIVTPRLVQPLARNTELPLPGDREAKPNLPEWGAWLLGPISQDPVPGFSR
>NZ_CP040435.1|WP_154349262.1|2830445_2831702_+|fimbrial-protein
MPYATAQPLHPQGPPMNLVLYGMDRELLPRLAAKLPPTTTLHWQDSSAPTSAQDLQRGPQSLVLLDFRPEHAAASSVLAQQLQQTEPDLMLVAVGATSPGQVEGVVMALRVGLRDVLDLDSDNTGIEAALRRALSPRPAAAAQHTHKARLIVLLGVRAGVGTSTLAAHLSVLAQQTRALAQGEALHQDGLLMELAQPSGDLALYLNLDSRFHYEDALRNASRIDATLARTAMARHDSGLVLLDRASGSDAVPPSDPGALLLRLRGVFASVLCDAGGCPLRQLPPLLLDQADEIWLVIDASIATLVSLDQALKHLAGQREREKRLQLVINRHDDSSGMSPEQIARRFEVPLLATLPERPRVRLAASQGHLLLQDAPRDPYLRALAPLVSRLDPAACPVQAQGLRERLSLALGGSQWKTR
>NZ_CP040435.1|WP_049448358.1|2831686_2833036_+|CpaF-family-protein
MEDKVTPFPHAATRPVLPDTAPAHVPFAQTEQYQKVLSAAHEHLLNSIEDERIDIDSWAPDTIARWVQVQTVGFIQEWRIPINEEEMQVVAEGLVKELTGFGPLDDLLHDPSIEDILINGFRDVHVSQGGQLKRATQRFTDDTHLLRILRRILAPLGRRLDDSNPMVDARLPNGGRLNAIISPLAVDGPMVSIRKFRKDPFTPDELLAKGTFDAPMQALLKAMVLGRCNILVSGGTSSGKTSLLNALASYVPPNERVITVEDTAELSLNHPHVVRLESRIGGAEGQGAVSIRDLVRNSLRMRPDRIVVGEVRGAEVLEMLQAMNTGHDGSMATIHANSPRDCLYRIEMLAGFAGFQGSEDSLRRQIASAIDFIVQISRLGSGRRVLVSITEITGVSDNLITTQEMFRHELQIDGNGKETDRWIGLGFHPHSHKLEPFRQQLRESLYGDF
>NZ_CP040435.1|WP_099589687.1|2833038_2833995_+|pilus-assembly-protein
MGTGLLLGVLSIISVLLALAVWLWGTASSREQRQASLQHAEQQLARGSAGSGAPAGPSIAAANDPARTASGARRVLPLDGLLQRAGLQTGWKLPIMLLVPGLVLSVVAMLRLGTAWMFPLTLLLYLLGCWLWVMRRTSKLRAQLLHMLPDFLDNLVRLTALGNSLQAAFQVASMQTSAPLRGLLDTTVRYARSGMDLDRALALAAQPYRMDVLKVLSVVIGVSVRIGGRSDQILQRMGDFMRDLEQAQQELAATTSETRMSAWVLGLLPPACAVLMAIASPDFFQPVLHDPLGHKILLIALGLELVGGFLLYRLAKSL
>NZ_CP040435.1|WP_049448353.1|2834023_2834962_+|type-II-secretion-system-F-family-protein
MSASAWFALSLLVLAAGVALLGIGGWVRSHREHRTSATLKTALQPREDARDSETAPQRDSLGWLERFGRALSGGRLEAALLTNEDRLLLDLAGWNTRRGTAIYLGLRLLLAVLVLALVLTFSSVTGLARIMVIIGALAAGLLLPKFILSAWVKRRRRAVENELPLLIDLLRLLQGVGFSMDQSLQTLGDKLRDALPVLGGELQEANVAYTHGRTRAQSLRRLSEVYAYDDLTSLMQLILQVHAHGGAVQEPLRQFSIRLREQRRNTLKEKVGKLSVKMTVVMMLTLLPALMLVLAGPALVALATTMSKMGSP

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040435_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040435_3

3158857-3158958

Orphan

Consensus_repeat	Method
GCGCCAACCAAGGTTGGCGACTACC	CRISPRCasFinder

1 spacers

DEDDh,csa3

The CRISPR arrays of NZ_CP040435_3

>merge|NZ_CP040435|3|3158857-3158958|CRISPRCasFinder
GCGCCAACCAAGGTTGGCGACTACCGCGGTACAGCGCTCTGGTAGATGCCCACCTTGGTGGGCGCCGATGCATGGCAGCGCCAACCAAGGTTGGCAACTACC

>NZ_CP040435|3|2|3158857-3158958|CRISPRCasFinder
GCGCCAACCAAGGTTGGCGACTACC	GCGGTACAGCGCTCTGGTAGATGCCCACCTTGGTGGGCGCCGATGCATGGCA
GCGCCAACCAAGGTTGGCAACTACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040435.1\|WP_099590089.1\|3174111_3175206_+\|5-methyltetrahydrofolate--homocysteine-methyltransferase	unknown	unknown	gnl\|CDD\|236539
NZ_CP040435.1\|WP_080354824.1\|3171445_3171709_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_154349353.1\|3153386_3154661_+\|kynureninase	unknown	unknown	gnl\|CDD\|130873
NZ_CP040435.1\|WP_107379849.1\|3168189_3171363_+\|multidrug-efflux-RND-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|273335
NZ_CP040435.1\|WP_154349352.1\|3151235_3151874_+\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|377290
NZ_CP040435.1\|WP_088479865.1\|3161022_3165999_-\|glutamate-dehydrogenase	unknown	unknown	gnl\|CDD\|377452
NZ_CP040435.1\|WP_005417403.1\|3150606_3150906_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_005410242.1\|3158963_3159908_-\|5'-nucleotidase	unknown	unknown	gnl\|CDD\|377624
NZ_CP040435.1\|WP_088479863.1\|3157495_3158182_+\|DUF2461-domain-containing-protein	unknown	unknown	gnl\|CDD\|274138
NZ_CP040435.1\|WP_049445646.1\|3159955_3160729_-\|NAD-kinase	unknown	unknown	gnl\|CDD\|179876
NZ_CP040435.1\|WP_049445634.1\|3152628_3153150_+\|3-hydroxyanthranilate-3,4-dioxygenase	unknown	unknown	gnl\|CDD\|183930
NZ_CP040435.1\|WP_049445632.1\|3151946_3152609_+\|carbonate-dehydratase	unknown	unknown	gnl\|CDD\|238448
NZ_CP040435.1\|WP_049445653.1\|3166905_3168174_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|169982
NZ_CP040435.1\|WP_014037755.1\|3173168_3174098_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|369777
NZ_CP040435.1\|WP_154349356.1\|3166249_3166906_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379522
NZ_CP040435.1\|WP_019337352.1\|3171866_3173015_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173847
NZ_CP040435.1\|WP_049445639.1\|3154692_3156060_+\|FAD-dependent-monooxygenase	unknown	unknown	gnl\|CDD\|223727
NZ_CP040435.1\|WP_154349354.1\|3156059_3157499_+\|exodeoxyribonuclease-I	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236979
NZ_CP040435.1\|WP_006453002.1\|3150913_3151228_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_154349355.1\|3158237_3158789_+\|DUF2939-domain-containing-protein	unknown	unknown	gnl\|CDD\|378575

Protein	Function_ID	Function_description	E-value
NZ_CP040435.1\|WP_099590089.1\|3174111_3175206_+\|5-methyltetrahydrofolate--homocysteine-methyltransferase	gnl\|CDD\|236539	PRK09490, metH, B12-dependent methionine synthase; Provisional.	0
NZ_CP040435.1\|WP_154349353.1\|3153386_3154661_+\|kynureninase	gnl\|CDD\|130873	TIGR01814, kynureninase, kynureninase. This model describes kynureninase, a pyridoxal-phosphate enzyme. Kynurinine is a Trp breakdown product and a precursor for NAD. In Chlamydia psittaci, an obligate intracellular pathogen, kynureninase makes anthranilate, a Trp precursor, from kynurenine. This counters the tryptophan hydrolysis that occurs in the host cell in response to the pathogen. [Energy metabolism, Amino acids and amines].	2.14929e-180
NZ_CP040435.1\|WP_107379849.1\|3168189_3171363_+\|multidrug-efflux-RND-transporter-permease-subunit	gnl\|CDD\|273335	TIGR00915, Probable_aminoglycoside_efflux_pump, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. Proteins scoring above the trusted cutoff (1000) form a tight clade within the RND (Resistance-Nodulation-Cell Division) superfamily. Proteins scoring greater than the noise cutoff (100) appear to form a larger clade, cleanly separated from more distant homologs that include cadmium/zinc/cobalt resistance transporters. This family is one of several subfamilies within the scope of pfam00873. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Unknown substrate].	0
NZ_CP040435.1\|WP_154349352.1\|3151235_3151874_+\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|377290	pfam04299, FMN_bind_2, Putative FMN-binding domain. In Bacillus subtilis, family member PAI 2/ORF-2 was found to be essential for growth. The SUPERFAMILY database finds that this domain is related to FMN-binding domains, suggesting this protein is also FMN-binding.	4.11114e-49
NZ_CP040435.1\|WP_049445632.1\|3151946_3152609_+\|carbonate-dehydratase	gnl\|CDD\|238448	cd00883, beta_CA_cladeA, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	1.29388e-109
NZ_CP040435.1\|WP_014037755.1\|3173168_3174098_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|369777	pfam08241, Methyltransf_11, Methyltransferase domain. Members of this family are SAM dependent methyltransferases.	1.28718e-24
NZ_CP040435.1\|WP_005410242.1\|3158963_3159908_-\|5'-nucleotidase	gnl\|CDD\|377624	pfam06189, 5-nucleotidase, 5'-nucleotidase. This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (EC:3.1.3.5).	1.21892e-153
NZ_CP040435.1\|WP_088479863.1\|3157495_3158182_+\|DUF2461-domain-containing-protein	gnl\|CDD\|274138	TIGR02453, conserved_hypothetical_protein, TIGR02453 family protein. Members of this family are widely (though sparsely) distributed bacterial proteins about 230 residues in length. All members have a motif RxxRDxRFxxx[DN]KxxY. The function of this protein family is unknown. In several fungi, this model identifies a conserved region of a longer protein. Therefore, it may be incorrect to speculate that all members share a common function.	3.85446e-91
NZ_CP040435.1\|WP_049445646.1\|3159955_3160729_-\|NAD-kinase	gnl\|CDD\|179876	PRK04761, ppnK, inorganic polyphosphate/ATP-NAD kinase; Reviewed.	2.09141e-156
NZ_CP040435.1\|WP_049445634.1\|3152628_3153150_+\|3-hydroxyanthranilate-3,4-dioxygenase	gnl\|CDD\|183930	PRK13264, PRK13264, 3-hydroxyanthranilate 3,4-dioxygenase; Provisional.	8.81388e-108
NZ_CP040435.1\|WP_088479865.1\|3161022_3165999_-\|glutamate-dehydrogenase	gnl\|CDD\|377452	pfam05088, Bac_GDH, Bacterial NAD-glutamate dehydrogenase. This family consists of several bacterial proteins which are closely related to NAD-glutamate dehydrogenase found in Streptomyces clavuligerus. Glutamate dehydrogenases (GDHs) are a broadly distributed group of enzymes that catalyze the reversible oxidative deamination of glutamate to ketoglutarate and ammonia.	0
NZ_CP040435.1\|WP_049445653.1\|3166905_3168174_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|169982	PRK09578, PRK09578, MexX/AxyX family multidrug efflux RND transporter periplasmic adaptor subunit.	1.75004e-88
NZ_CP040435.1\|WP_154349356.1\|3166249_3166906_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|379522	pfam14246, TetR_C_7, AefR-like transcriptional repressor, C-terminal region. This family comprises the C-terminal domain of transcriptional regulators of the TetR family. It includes the AefR transcriptional regulator from P. syringae. It is found in association with pfam00440.	1.05599e-13
NZ_CP040435.1\|WP_019337352.1\|3171866_3173015_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173847	cd01158, SCAD_SBCAD, Short chain acyl-CoA dehydrogenases and eukaryotic short/branched chain acyl-CoA dehydrogenases. Short chain acyl-CoA dehydrogenase (SCAD). SCAD is a mitochondrial beta-oxidation enzyme. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of SCAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. This subgroup also contains the eukaryotic short/branched chain acyl-CoA dehydrogenase(SBCAD), the bacterial butyryl-CoA dehydorgenase(BCAD) and 2-methylbutyryl-CoA dehydrogenase, which is involved in isoleucine catabolism. These enzymes are homotetramers.	4.99817e-178
NZ_CP040435.1\|WP_049445639.1\|3154692_3156060_+\|FAD-dependent-monooxygenase	gnl\|CDD\|223727	COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion].	8.52614e-39
NZ_CP040435.1\|WP_154349354.1\|3156059_3157499_+\|exodeoxyribonuclease-I	gnl\|CDD\|236979	PRK11779, sbcB, exonuclease I; Provisional.	0
NZ_CP040435.1\|WP_154349355.1\|3158237_3158789_+\|DUF2939-domain-containing-protein	gnl\|CDD\|378575	pfam11159, DUF2939, Protein of unknown function (DUF2939). This bacterial family of proteins has no known function.	1.82907e-30

>NZ_CP040435.1|WP_154349355.1|3158237_3158789_+|DUF2939-domain-containing-protein
MKKLTSLAVLLVLALAAWWFGGPYMTVHGLSKAIEERDTARLQRYVDFPRVRSSLRAQLNDYLVRQAGPDVAASPFGALLYGLGDQLGGAAVETMVTPTGIGAMLQGHVLWKRGRNELQGGDAFGATEPARPLKNAEHHFEALDRFVIDVDRGPDQPPMKVVLEPQGLRWKVVDLQLGMSGSP
>NZ_CP040435.1|WP_088479863.1|3157495_3158182_+|DUF2461-domain-containing-protein
MSTYFSDASFKFLRSLARHNDKAWFNDHRQQYEDHVRQPFLRLLGDLQPALAEISEHFRADTRGVGGSLFRIHRDARFSNDKSPYKTWQGARLFHERRREVAAPSFYVHLQPGESFVGAGLWHPEPETQRRVRHFILDNPGSWKAAAHAPALRKRFDFEESEKLVRPPRGFPADFEFIDDLKHRNWVMWRSLDDATMTGPRLLSTLGKDLAGLGPFVDYLCAALDLEF
>NZ_CP040435.1|WP_154349354.1|3156059_3157499_+|exodeoxyribonuclease-I
MADSFLFYDLETFGQDPRRTRISQYAAIRTDTDLNEIDTPVSFFVRPADDLLPSPMATLVTGITPQQALAEGISEAEAFDRINEQLSRPGTCALGYNTLRFDDEFVRYGLFRNFHDPYEREWRNGNSRWDLLDMLRLMRAMRPDGIQWPLREDGATSFKLEHLAEANHVREGDAHEALSDVRATIGMARLFKQSQPRLWEYALKLRDKRFVGGLLDVAAMKPVLHISMRYPASRLCAAPVLPLAMHPTINNRVIVFDLEGEIDDLLELPADVIAQRLYMRASDLPEGVARVPLKEVHLNKVPALIAWNHLRADDHARLGLDVTAIEAKVERLRAFAPQLAEKARQVYNQPRAATVADVDASLYDGFLGSGDKPLLALARTTAPEQLAALEGRFRDPRLPELLFRYRARNHPDSLAPPERQRWQDYRRQRLLGDGGLGELNLPQYQQQLDALAAEAPDDTRRQALLQSLRDWGQHLQETL
>NZ_CP040435.1|WP_049445639.1|3154692_3156060_+|FAD-dependent-monooxygenase
MIAHASRSLSIIGAGLAGSLLAILLSRQGWRITLYERRGDPRVADYESGRSINLALAERGRNALRQAGVEDEVMARAVMMRGRMVHPRDGEPQLQRYGRDDSEVIWSIHRSDLNTTLLELAEQAGATVHFHRRLHTVDFDAGYARFIDDRDDSPHDIHFDTLIGADGAGSALRAAMNRRAPLGEDIAFLDHSYKELEIPPAADGSFRIERNALHIWPRGHYMCIALPNHEGTFTVTLFLPNQGDPSFATINTGAQAEALFAREFADTLPLIPNLRADWEQHPPGLLGTLTLERWHQQGRAVLIGDAAHAMVPFHGQGMNCAFEDCVALARHLMEADDLEGAFAAFETERKPNARAIQQMALENYLEMRDRVADPAFLLQRELEQELQRRWPTRFVPHYTMVTFLHTPYAEALRRTELQRNLLAAATEGHDSLDNIDWAALEAQIHAQLPVLEGAH
>NZ_CP040435.1|WP_154349353.1|3153386_3154661_+|kynureninase
MSDLLSRTHAIALDAADALRPLRNEFLIPRHGGGEQTYFVGNSLGLQPRGAQAAVQEVMKQWGELAVEGHFTGPTQWLSYHRLVSAQLARVVGALPSEVVAMNTLSVNLHLMMVSFYRPTAERPVILMEAGAFPTDRHAVEAQIRFHGFDPAECLVEVQPDEVNGTISLAAIERAIAEHGPRLALVLWPGVQYRTGQAFDLDAITRAARLQGARIGFDLAHSVGNLPLRLHDIAPDFAVWCHYKYLNSGPGAVAGAFVHERHHRDTTLPRFAGWWGHEEATRFQMAPQFTPAIGAEGWQLSNPPILGLAPLRASLDLFERAGMEALRSKSLALTGMLEALVRARLSSVLDIITPAEPQRRGCQLSLRVIGGRERGRALFEHLRGIGVLGDWREPDVIRISPTPLYNRYLDVHHFVEEVEAWAGL
>NZ_CP040435.1|WP_049445634.1|3152628_3153150_+|3-hydroxyanthranilate-3,4-dioxygenase
MLASPINLHAWIEEHRHLLKPPVGNKMIDNGDFIVMVVGGPNSRTDYHYDEGPEWFYQLEGEMVLKVQEDGAVRDIPIRAGEIFLLPAKVPHSPRRPPGGIGLVVERKRLPHEMDGVIWHCERCNHKLHEEYFALLNIETDLPKVFARYHASLELRTCSQCGHVDPLPTPAAG
>NZ_CP040435.1|WP_049445632.1|3151946_3152609_+|carbonate-dehydratase
MKDIHKLLQNNRDWADRIEKEDPEFFHQLAKQQHPEYLWIGCSDSRVPANQIIGMAPGEVFVHRNVANVVAHTDLNCLSVVQYAVDQLKVKHILIVGHYGCGGVHACLHNTRVGLADNWLRHVGDVMQKHTGILDAIDTDELKHARLCELNVIEQVANLCRSTIVQDAWARGQKLMVHGWVYSLKDGRVREMGIDVGSQEELQPAYEKALSYVPRKGKRD
>NZ_CP040435.1|WP_154349352.1|3151235_3151874_+|FMN-binding-negative-transcriptional-regulator
MFTPRAFAETDLLWLDRLLARDPFVTVLTVGSDGLPELTRMPVLYRRDGDQIELRGHWARANPQSRHSGAAKVLVDGPHGYVSANWYPDKEPAARVPTWNYAAAELRGQLQTFDDADALAELVGAISDRFEASVGQAWQFDATRAEHGPELRAIVGFRFQVEQVQLKLKLSQNHPDANQRAVIAELEQLGTPSSIELAQWMRWHREQAARSD
>NZ_CP040435.1|WP_006453002.1|3150913_3151228_+|hypothetical-protein
MNDITASRDSWWLASLGNTLIWARLRVRPAGTAEVLDSDGNTLSYDSEDTARSQLFDAEFVEYDGLDEEDALVRGFSLHEVQPPQADSDEGLRGRMIQSLGGRA
>NZ_CP040435.1|WP_005417403.1|3150606_3150906_+|hypothetical-protein
MTLFFALCFVGVAVAGFSAFVIFWPLTLVHVRDRHPALAERFGSGAFLKPDALAWLLRRDYRQQPDRSLSGLATPAWVSLLTLLAGLGMAALLWLASLW
>NZ_CP040435.1|WP_005410242.1|3158963_3159908_-|5'-nucleotidase
MGDNSPRLLTVAVTSRALFDLEESHALFESDGVAAYAEFQRQHEDDILGPGVAFPVVRKLLALNQGASPENPRVEVILLSRNSADTGLRIFNSIQHYGLGIIRATFTAGEPTWPYVKPFGTDLFLSANPESVRSALRHGIAAATILPKPPGETAAAAADQIDTGRPAGQLRIAFDGDAVIFGDESERISREQGVEAFGRHERERAREPLSGGPFRGFLSALHTLQEVFPAGESAPIRTALVTARSAPAHERVIRTLREWGVRLDEALFLGGRHKGPFLQAFGADIFFDDSQHNIDSAREHVAAGHVPHGVANEG
>NZ_CP040435.1|WP_049445646.1|3159955_3160729_-|NAD-kinase
MSDTPRIAFLASTTEPAQMARAAMVSRYGDYTPEQADVLCPLGGDGFMLQTLHRHGHLGKPVFGMKLGTVGFLMNQYRGDDDVQARIARAEPANLRPLEMVALTESGTSTGSLAYNDVSLLRQTRQAAHIGIDLNGQERVAELIGDGVLVATPAGSTAYNYSAHGPVLPLGSHTIALTPLAPYRPRRWRGAILKADTEVRFRVLDPYKRPISVTADSHETRDVVEVTIRESKDRRVTLLFDPEHNLEDRILSEQFVF
>NZ_CP040435.1|WP_088479865.1|3161022_3165999_-|glutamate-dehydrogenase
MKPQKTAAKTVKNKTKPAEAEVAVTAGFSLEPVYTALRKRYPAAAQAEAVAFATDFYKRMESDEFPHHSAEEWAALAAETLEFARARKAGKANVRVFNPTAKANGWESPHTVLQIVNDDMPFLVDTVTMSLAEQGVGVHVLGHPVLRFTRDKAGKLVKVGEGDAESVMLLEIDRQPAEAMAAIEQAINKALDEVRAIVRDWQPMKDKALALADDLGSRQLPVDAASRKEAQEFLRWAADNHFTFFGYREYRVEKQGKEEVLAPLNDTGLGLMRGKDKSAARPVKTLAAQGLNATSGLKDALILTKTNARSRVHRAGYMDYIGVLEFDAKGKIIGEQRFLGLFTSSAYNRRPWEIPLVRQRHEHVMKQSGLAPASHSGKALRHILETLPREELFQSSEDELLRTAMGVLGLQERVRSRLFLRRDKYSRFISALVYLPRERFNTDVRLRIEAMLKDALHGEYVDSSVVLGESPLAQVHLIVRPKPGEMLDVDTAELEQKLAQVLRNWQDDLREALVARHGETEGLRIAARIGKALPAGYIEDNSTAVAANDVSQLDALTGPDDLRLSLQAVPRESGDGLRLKLYRQLDDIPLSDALPMMENMGLRVIAERPYRLSVDNAPVYVQDFEVESTAGAIDAASVDEAFGETFARVWHGDAENDGFNRLVLAAGLHWRQVAMLRGYCKYLLQTGVPFSQAYVEGTFARYPLLARLLVELFEARFDPATGHESKDDIAAGQAQLKAHFDVLAAGDDATLKVLKTVVDARKGDRDAQMQAARDALLKLMDRVSSLDEDRILRSFMGVIDATLRTSYYQTDANGQHGHVISFKFDSALVPDLPKPRPYREIFVYGPRVEGTHLRFGAVARGGLRWSDRREDFRTEVLGLVKAQMVKNTVIVPVGAKGGFFAKTPPVNGDRDAIFANGVACYKLFIQGLLDITDNIVNNKIVPPVDVVRHDMDDPYLVVAADKGTATFSDIANGLAIAHGFWMGDAFASGGSVGYDHKGMGITARGAWESVKRHFRALGRDSQTQDFTAVGVGDMSGDVFGNGMLLSRHIRLVAAFDHRHIFLDPNPDAATTFVERERLFTVPRSSWADYDAKLISKGGGVYPRSLKSIEITPQVREALGLDDNVKALSPNDLMSAILKAPVDLLWNGGIGTYVKAASEQHSDVGDRANNALRVNGGELRCKVVGEGGNLGMTQLGRIEAAQAGVLLNTDFIDNSAGVDTSDHEVNIKILLNDVVRAKKLTVEQRNKLLASMTDEVAELVLNDNYRQNQALSLMERMAVKRLGSKQHFIRTLEQQGLLDRQIEFLPSDAELSQRKARGQGLTRPELSVLLSYSKLVAFAQLLDSDIPEDPYLSKELQRYFPTPLQKKYADAMERHRLKREIIATAVTNQTINRMGATFLMRMQEDTGRSIAEVAKAYTISRETLDARALWAQIDALDGKVPESVQIDALEVIWKLQRSFVRWLLSRPGAMPGITEAVNRYQGPFNDIRVASGVLPDSQRPTYEALVAEWKEKGLPSALAQQLAELHFLEPAFDIIELARTRKLKPVDVSKVHFRLGDALQLPWLFEQVDALEVNGRWHAVARGVLRDELAANHRNLAGQVLGTKGSSAEAKVAAWMGRDDNSLRFTLAMLAELAEQKTLDYPTVSVAVQRLGQLAAHGA
>NZ_CP040435.1|WP_154349356.1|3166249_3166906_+|TetR-family-transcriptional-regulator
MNPASLPVALDARDERVFDAVRELLAQQGMQMSMDAVAQHAGCSKQTLYSRYGSKQELLRRVMQRHVGHATGAMVRALRSDDLRASLLQFAIDFLEHFNQPHVGQACRLIAADASQFPEEARTLYRHGAGALTLHLAEWIETVCMQGQLRHDDPHFMAELLLSMIAGQDFDKQRFHTPHRDDALLRRRWAEFSVDSFLRAFAPQPSAAPSTNQPRSSS
>NZ_CP040435.1|WP_049445653.1|3166905_3168174_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MIAPLRTLALTCAVAVALAACKKPEQQTPPPPEVGVIDAKPQTLPLQRELVGRLSPFRSADVRARVPGVLLKRVYQEGSQVKQGQPLFLIDPAPLRASLNASEAQLASARATYANAKVAADRARSLAPQQFVSKSDLDNAESAERTALAAVKQAEAAVTSSRINLGYTEVTAPISGVANKQQVTEGALVGQGDVTLLTTVDQLDPLYVNFSLSVDELTQLRAQQAKGALALSGDGKATVNVKLADGSTYSEPGTLDFSSTTVDPATGAVSLRALLPNPQQILLPGAFVSFQANLGERNNAYLVPQQALLRDTTGGYVMVVGADGKVVRKNVKTDGAQNGNWLVSDGLAAGDKVIVAGVQKVKEGAPAVAKPWTPGQDANGKPAAGGAAPAGAAPAAGKAPADAAKPEQADAAKPAATDSNKQ
>NZ_CP040435.1|WP_107379849.1|3168189_3171363_+|multidrug-efflux-RND-transporter-permease-subunit
MPKFFIEHPVFAWVVAILISLSGVIAILNLGVESYPNIAPPQVTVSATYPGASADTTEKSVTQVIEQQLTGIDHLLYFSSSSASNGRAQITLTFETGTDPDIAQVQVQNKVSLATPRLPSEVTQQGVVVAKANAGFLMVIALQSDTPAINRDALNDIVGSRVLDQVSRIPGVGSTQQFGSEYAMNIWLNPEKMQGYGLSASQVLAAVRAQNVQFAAGALGSDPSPEGQHFTATVSAEGRFSSPQEFENIILRANADGSRVLLKDIARVAFGANNYGFDTQYNGKPTGAFAIQLLPGANALNVADAVRGKMDELQPSFPSGVTWFSPYDSTTFVKISIQEVVKTLFEAVFLVFLVMLIFLQNFRATLIPTLVIPVALLGTFLGMWMIGFTINQLTLFAMVLAIGIVVDDAIVVIENVERIMTEEGLAPKPATQKAMTQITGAVVAITVVLAAVFIPSALQGGAAGEIYKQFALTIAISMAFSAFLALGFTPALCATFLKPTHNDNPNIVYRTFNKYYDKISHTYVGHITSAVRHAPRWMILFVVLTALCGFLFTRMPGSFLPEEDQGYALAIVQLPPGSTKGQTNEVFGQMRGILEKQDGYEGMLQVAGFSFVGSGENVGMGFIRLKPWEERKFTAPEFIQNMNGAFYGIKEAQIFVVNLPTVQGLGQFGGFDMWLQDRSGAGYEQLTQARNILLGQAAQKPDHLVGVRPNGLENAPQLQLHVDRVQAQSMGMSVSDVYSTIQLMLAPVYVNDFFYEGRIKRVTMQADGPYRTGQESLKSFYSPSSLTKNADGTNSMIPLNTVVKSEWVSAPPSLSRYNGYSAINIVGSQAPGTSSGEAMQTMESIVNDDLPAGFGYDWSGMSYQEILAGNAATLLLVLSIVVVFLCLAALYESWSIPVAVLLVVPLGVLGALGLSMLRGLPNDLFFKIGLITVIGLAAKNAILIVEFAVEQRAAGKNLRDATIEAARLRFRPILMTSFAFIMGVIPMAISTGAGANSRHAIGTGVIGGMLFATLLGLLMIPVFFVVVRRMLGDKLDEPSKEFMERQRDADAAHRPDR
>NZ_CP040435.1|WP_080354824.1|3171445_3171709_-|hypothetical-protein
MTLVTPIAAILLLAYFFPHEGSRGNTPLTQVLLGAGIGAAVNVMLGLWFNRAPRQKGEAAPHHFFFVPMQWAALALVVVCVAVALLR
>NZ_CP040435.1|WP_019337352.1|3171866_3173015_-|acyl-CoA-dehydrogenase
MDFSFTEEQLMLQDVARRIAQEKIAPSAEHHDRTGEFPLDNIRLLGENGLMGIEVPTEYGGAGMDPVAYVLAMVEVAAADAAHSTIMSVNNSLFCNGILTHGTEEQKQKYVRAIAEGEAIGAFALTEPQSGSDATAMRCRAVKQADGTFVINGKKSWITSGPVAKYIVLFAMSEPDKGARGITAFLIDTDKAGFGRGKTEPKLGIRASATCEIEFNDYVAQAEDVLGQEGEGFKIAMSVLDAGRIGIASQAIGIARAAYEATLEYVKERKAFGAAIGTFQMTQAKIADMKCKLDAALLLTLRAAWVKGQGKRFSTEAAVAKLTASEAAMWITHQAVQIHGGMGYSKEMPLERYFRDAKITEIYEGTSEIQRLVIARNETGLR
>NZ_CP040435.1|WP_014037755.1|3173168_3174098_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MDLEDWSTRLKVFADATRVRLLALLEQEELTVAELSAITRLAQPRVSTHLARLKEAGLVRDRRAGVSAYYRFDEAQLDPAQRALWHALSNGSDDPLLRQDAERVAAVLAHRASDQNWADSVAGDMERHYSPGRTWEALARTALPLLETGDVLDIASGDGVLAELVAPHAKRYICIDTSARVVAAASERLRRLPNVEVREGDMHALPFKDGSFDLVVLMHALTYASKPAQAVTEAARVLRPGGRLLLCSLARHEHKAAVEAYGHVNLGFSDKELRKFVDKAGLQVSSLETVTREKRPPHFEVISLIANKP
>NZ_CP040435.1|WP_099590089.1|3174111_3175206_+|5-methyltetrahydrofolate--homocysteine-methyltransferase
MSALPWLHPDRVNALLDALRQRILIIDGAMGTMIQRHGLQEDDYRGERFADGYDHAHGPGCDHGTPEGHDLKGNNDLLLLTRPQVIADIHTAYLEAGADLVETNTFNATSVSQADYHLEHLVYELNKAGAAVARACCDAATASTPDKPRFVIGVLGPTSRTASISPDVNDPGFRNTSFDELRDTYREAIDGLIDGGADTIMVETIFDTLNAKAALYAIEEAFDARGARLPIMISGTITDASGRTLSGQTAEAFHASLAHARPLSIGLNCALGAEAMRPHVETLSQVSDCHVSAHPNAGLPNAFGEYDETPEEMATTLRGFAEDGLLNLVGGCCGSTPDHIRAIAQAVAGLPPRALPGSQEQQAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040435_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040435_4

3357060-3357181

TypeII

Consensus_repeat	Method
TAAAGGGGGCGCGCCGACAGGCGCGGGGATTAGGAAGAATGCG	CRISPRCasFinder

1 spacers

Cas9_archaeal

The CRISPR arrays of NZ_CP040435_4

>merge|NZ_CP040435|4|3357060-3357181|CRISPRCasFinder
TAAAGGGGGCGCGCCGACAGGCGCGGGGATTAGGAAGAATGCGCGGGCACCCCAGCGCGCCAACGGCGGGCTGGGGTGCTAAAGGGGGCGCGCCGACAGGCGCGGGGATTAGGAGGAATGCG

>NZ_CP040435|4|3|3357060-3357181|CRISPRCasFinder
TAAAGGGGGCGCGCCGACAGGCGCGGGGATTAGGAAGAATGCG	CGGGCACCCCAGCGCGCCAACGGCGGGCTGGGGTGC
TAAAGGGGGCGCGCCGACAGGCGCGGGGATTAGGAGGAATGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040435.1\|WP_088480185.1\|3362352_3362925_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP040435.1\|WP_005417823.1\|3360050_3360254_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_154349404.1\|3350112_3350874_-\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|180993
NZ_CP040435.1\|WP_154349408.1\|3360421_3360994_-\|DUF3011-domain-containing-protein	unknown	unknown	gnl\|CDD\|371422
NZ_CP040435.1\|WP_046985297.1\|3351006_3351849_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	unknown	unknown	gnl\|CDD\|185333
NZ_CP040435.1\|WP_049445791.1\|3361735_3362020_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_099588923.1\|3348132_3349059_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|369561
NZ_CP040435.1\|WP_057501891.1\|3349620_3350106_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_088480194.1\|3347249_3348143_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223669
NZ_CP040435.1\|WP_154349406.1\|3354902_3356693_+\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|185635
NZ_CP040435.1\|WP_088480195.1\|3346171_3347227_+\|sugar-phosphate-isomerase/epimerase	unknown	unknown	gnl\|CDD\|224007
NZ_CP040435.1\|WP_049445810.1\|3358033_3359941_+\|1-deoxy-D-xylulose-5-phosphate-synthase	unknown	unknown	gnl\|CDD\|235470
NZ_CP040435.1\|WP_154349409.1\|3362938_3363271_+\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	unknown	unknown	gnl\|CDD\|137367
NZ_CP040435.1\|WP_049445789.1\|3362032_3362266_+\|DUF1653-domain-containing-protein	unknown	unknown	gnl\|CDD\|377930
NZ_CP040435.1\|WP_057502001.1\|3361125_3361332_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_049445800.1\|3353647_3354199_+\|lipocalin-family-protein	unknown	unknown	gnl\|CDD\|381213
NZ_CP040435.1\|WP_006380555.1\|3363293_3363467_-\|DUF1328-domain-containing-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_154349405.1\|3354361_3354838_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377000
NZ_CP040435.1\|WP_154349407.1\|3357262_3357928_+\|HNH-endonuclease	Cas9_archaeal	cas9_archaeal	gnl\|CDD\|224321
NZ_CP040435.1\|WP_049447631.1\|3351923_3352949_-\|NADP-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|176190

Protein	Function_ID	Function_description	E-value
NZ_CP040435.1\|WP_088480185.1\|3362352_3362925_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.01734e-13
NZ_CP040435.1\|WP_154349404.1\|3350112_3350874_-\|SDR-family-oxidoreductase	gnl\|CDD\|180993	PRK07478, PRK07478, short chain dehydrogenase; Provisional.	2.21173e-136
NZ_CP040435.1\|WP_154349408.1\|3360421_3360994_-\|DUF3011-domain-containing-protein	gnl\|CDD\|371422	pfam11218, DUF3011, Protein of unknown function (DUF3011). This bacterial family of proteins has no known function. Most members belong to Proteobacteria.	3.8983e-30
NZ_CP040435.1\|WP_046985297.1\|3351006_3351849_+\|methylated-DNA--[protein]-cysteine-S-methyltransferase	gnl\|CDD\|185333	PRK15435, PRK15435, bifunctional DNA-binding transcriptional regulator/O6-methylguanine-DNA methyltransferase Ada.	5.39325e-94
NZ_CP040435.1\|WP_099588923.1\|3348132_3349059_+\|alpha/beta-hydrolase	gnl\|CDD\|369561	pfam07859, Abhydrolase_3, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.04078e-76
NZ_CP040435.1\|WP_088480194.1\|3347249_3348143_+\|alpha/beta-hydrolase	gnl\|CDD\|223669	COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only].	7.4741e-21
NZ_CP040435.1\|WP_154349406.1\|3354902_3356693_+\|acyl-CoA-dehydrogenase	gnl\|CDD\|185635	PTZ00456, PTZ00456, acyl-CoA dehydrogenase; Provisional.	0
NZ_CP040435.1\|WP_088480195.1\|3346171_3347227_+\|sugar-phosphate-isomerase/epimerase	gnl\|CDD\|224007	COG1082, IolE, Sugar phosphate isomerases/epimerases [Carbohydrate transport and metabolism].	5.37305e-35
NZ_CP040435.1\|WP_049445810.1\|3358033_3359941_+\|1-deoxy-D-xylulose-5-phosphate-synthase	gnl\|CDD\|235470	PRK05444, PRK05444, 1-deoxy-D-xylulose-5-phosphate synthase; Provisional.	0
NZ_CP040435.1\|WP_154349409.1\|3362938_3363271_+\|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter	gnl\|CDD\|137367	PRK09541, emrE, EmrE family multidrug efflux SMR transporter.	3.08873e-38
NZ_CP040435.1\|WP_049445789.1\|3362032_3362266_+\|DUF1653-domain-containing-protein	gnl\|CDD\|377930	pfam07866, DUF1653, Protein of unknown function (DUF1653). This is a family of hypothetical bacterial proteins of unknown function.	7.65893e-33
NZ_CP040435.1\|WP_049445800.1\|3353647_3354199_+\|lipocalin-family-protein	gnl\|CDD\|381213	cd19438, lipocalin_Blc-like, bacterial lipocalin Blc, Arabidopsis thaliana temperature-induced lipocalin-1, and similar proteins. Escherichia coli bacterial lipocalin (Blc, also known as YjeL) is an outer membrane lipoprotein involved in the storage or transport of lipids necessary for membrane maintenance under stressful conditions. Blc has a binding preference for lysophospholipids. This group includes eukaryotic lipocalins such as Arabidopsis thaliana temperature-induced lipocalin-1 (TIL) which is involved in thermotolerance, oxidative, salt, drought and high light stress tolerance, and is needed for seed longevity by ensuring polyunsaturated lipids integrity. This group belongs to the lipocalin/cytosolic fatty-acid binding protein family which have a large beta-barrel ligand-binding cavity. Lipocalins are mainly low molecular weight extracellular proteins that bind principally small hydrophobic ligands, and form covalent or non-covalent complexes with soluble macromolecules, as well as membrane bound-receptors. They participate in processes such as ligand transport, modulation of cell growth and metabolism, regulation of immune response, smell reception, tissue development and animal behavior. Cytosolic fatty-acid binding proteins, also bind hydrophobic ligands in a non-covalent, reversible manner, and have been implicated in intracellular uptake, transport and storage of hydrophobic ligands, regulation of lipid metabolism and sequestration of excess toxic fatty acids, as well as in signaling, gene expression, inflammation, cell growth and proliferation, and cancer development.	4.32984e-60
NZ_CP040435.1\|WP_154349405.1\|3354361_3354838_+\|hypothetical-protein	gnl\|CDD\|377000	pfam03168, LEA_2, Late embryogenesis abundant protein. Different types of LEA proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress. The function of these proteins is unknown. This family represents a group of LEA proteins that appear to be distinct from those in pfam02987. The family DUF1511, pfam07427, has now been merged into this family.	2.42145e-05
NZ_CP040435.1\|WP_154349407.1\|3357262_3357928_+\|HNH-endonuclease	gnl\|CDD\|224321	COG1403, McrA, Restriction endonuclease [Defense mechanisms].	6.76544e-19
NZ_CP040435.1\|WP_049447631.1\|3351923_3352949_-\|NADP-dependent-oxidoreductase	gnl\|CDD\|176190	cd05288, PGDH, Prostaglandin dehydrogenases. Prostaglandins and related eicosanoids are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES.	1.32087e-167

>NZ_CP040435.1|WP_154349406.1|3354902_3356693_+|acyl-CoA-dehydrogenase
MSSYTAPLSDLRFALHDVLKVEPLFARLGFTDATADVVDAVLEEAGRFSATVLAPLNSVGDEIGCVLDQATGEVTTPPGFKQAYDQFVDGGWTGLTASPALGGQGLPHTLGVPLNEMINAANLAWGNFPLLSHGAIEALKQHGEAWQHDAFLKPLIEGRWTGTMCLTEPHCGTDLGLLKTKAEPNADGSYSITGTKIFITAGEHDLTGNIVHLVLAKLPDAPPGAKGISLFVTPKFKVDREGNVGERNALRCGSIEHKMGIKGSVTCVMNFDGAQGYLVGQPHKGLQAMFTMMNTARLGVGLQGIGLSERAYQNALKYSRERLQSRALSGAKFPDKPADPILVHPDVRRMLLTVKSLVEGSRLLALHAATLIDVAHHAEDAAERERADTLVSFLTPISKACQTEWGIENTYNALQCFGGHGYIREHGMEQLARDARITTLYEGTTGIQALDLIGRKTASSQGAGLKLMLAEIEAFAKEHEGNEALAEFIGPLRAKAAEWGKLTMDVLQRAAGNPDELGAASYDYLFYSGYVVLAYWWARSVAAADASAHGAAFAQGKRETARFYFARVLPRTLSHAAAIQAGAAPLMAMDDERFGA
>NZ_CP040435.1|WP_154349405.1|3354361_3354838_+|hypothetical-protein
MLHRFRIALIVLCTLALVACNNGIVKRVSEPAASLQQLTVRADGNWSVALRLQNFSSMPMTFDDVALALTVGDSDAGTLLAKPGISIGGTSADVINVELVPSSAARLVVADALAGNRTLAYGLKGTVAATPQEKKQRSFDISSRSTLNQAPGLPGVLR
>NZ_CP040435.1|WP_049445800.1|3353647_3354199_+|lipocalin-family-protein
MPLRPALLACLLLAALPVIAAEPVRAVDALDIDRYAGQWHEIAHLPVSFQKQCVGEITANYGLRRDGRISVTNACRNGDGERVVAEGVARPVAGHPGQLQVRFVPDWLSWVPLVWADYWVLALDPDYQWALIGEPDRKYLWILSRVPEMDRARFEQLKEKAEAMGYDLKPLRLMAPLRDTPAN
>NZ_CP040435.1|WP_049447631.1|3351923_3352949_-|NADP-dependent-oxidoreductase
MSDSSTTSRIVLASRPQGAPSAANFRLEQAALPALADGEVLLRNRYLSLDPYMRGRMDEGPSYAPPVAVGAVMEGQTVAEVLQSNAEGVAAGELVLAPGGWQTHAVLPAKALGRRLDPSGLPLSTALGVYGMPGFTAYSSLHEIARLKPGETLVVAAATGPVGATVAQLAKLQGARVVAIAGGEAKRAYLQTLGVDVALDHRAADFVVQLRAAVPAGIDVYFENVGGHVLDAVLPLLNDFARIPVCGTIATYNERGVEQPGPDRLPALFSQILRQRLTVRGFIVHDFIHLWPDFEREMPQWLRDGRIQYREDVVEGLENAPEAFFGLLQGRNFGKLVVKLD
>NZ_CP040435.1|WP_046985297.1|3351006_3351849_+|methylated-DNA--[protein]-cysteine-S-methyltransferase
MDSTATTALDARVERVCRHLQTSLDEPSLQELADIAGCSPTRLHRLFKQATGLTPKQYAAALRADRLRTGLEQQERITDAFHDAGFGSSGRFYENAPKLLGMTPKQWRAGGRGEVIHFALAESSLGSVLVASSGTGVVAILLGDDPETLLQSLQQRFRQAELVGADQGYEQLVAQVVGLVEDPSRGATLPLDIRGTAFQQRVWQALQQIPRGQTASYADVAARIGAPRSSRAVARACASNPLAVAVPCHRVVRRDGDLSGYAWGVARKRELLRREKASTA
>NZ_CP040435.1|WP_154349404.1|3350112_3350874_-|SDR-family-oxidoreductase
MRLNNKIALITGASAGIGRASALRFAAEGARLVLNARRPEPLQALAEQIRAAGGEAVVHAADVADPGTAQALVDLAQRSFGGLDIALNNAGMLGPGVPAAEFPVDAWREVMATNLDAAFHAARAQLPALLARGGGSLVFVGTFVGHTVGFPGMAAYASSKAGLIGLSQVIAAEYGAHGVRSNVLLPGGTDTEMGRQAAPTGDARDFVRSLHALKRMAEPEEIANAALFLASDESSFVTGTAMRVEGGVSITRT
>NZ_CP040435.1|WP_057501891.1|3349620_3350106_+|hypothetical-protein
MPSPAQHAAHALPMLLDATDGSIQLGNLPTLIGPTLSRDEASVAFAALVRGERDVGTGYHWLSLHRLSLGGAPAGISLCFHGQQLDMVAMGVSLPGAPLEDGWPTQAAIDAEVAFMRRILATALGRKLTGGLARFDWGEAWARFDPKGFMASSGIRYAPRS
>NZ_CP040435.1|WP_099588923.1|3348132_3349059_+|alpha/beta-hydrolase
MQLEPALQQFVDAVASQPLPDDLRELRAISEGALPTLQGAPQPVARVIEHTVIARDGHALEVRLYTPEGLPDGPAPALLFAHGGGWFQCSLAVYDGPCRALANAGGCVIVAVGYRLAPEHPFPVPLHDVADAWQWLQDNAERLGLDPQRLAIGGDSAGGNLATACCLLLRERGLPQPCHQLLLYPALDAGMGSDSYREYASGYYLSAELMRRCWKGYLGDLHPPLALASPAHATDLRGLAPASVLSCEYDPLRDEAEQYARRLQAAGIGCTLERLPGMIHACIHLQGVAVSTGVAVQRAGDLLRQALT
>NZ_CP040435.1|WP_088480194.1|3347249_3348143_+|alpha/beta-hydrolase
MTTSLSAGAAGDASLRHHYLRIDGQRVHCVSAGHGEPVLLIPGWPQTWYAWRHVLHALAQAGFEAIAVDPPGIGESDRPIHGYDTGSAAAVLHQTMQALGHDRYQVVGHDIGMWIAYALASDQPQAVRQLAVTEAVIPGLAPEPGIFAAPADNIFLWHFMFNQVADLPEALISGRERAYLEFMFDRWSYRRDAVAADTYIAAYSRPGALRAGFAWYRAIPETIRQNKLRAQRRLPMPVLAIGAEHATGDAPMLTLQPHADDVRGSIVPGCGHFIMEEAPQAFLAQLLPFLQEAHHAA
>NZ_CP040435.1|WP_088480195.1|3346171_3347227_+|sugar-phosphate-isomerase/epimerase
MQTLKGPSLHLAQFAGDQAPFNSLAGIAEWAAGHGFKALQIPAWDARLFDLATAADSQDYCDEIRGTLAEHGLQVSELTTHILGQLVAVHPAYDELCDGFAPEALRGNPKARSEWAQQQLHLAARASRRLGLQDMGTFSGSFAWPYLFPFPQRPPGLIDAAFDELARRWRPILDTCEDNGINLCYEIHPSEDLHDGTSFERFFERVGQHQRCRILFDPSHFVLQQLDYLEYLDIYHPLIRMFHVKDAEFRPSGRQGIYGGYADWTERAGRFRSLGDGQVDFKSIFSKLAQYDYQGWATLEWECCLKDQEAGAREGAAFIRDHIIPVTDKIFDDFAGAPISTAQMQQMLGIA
>NZ_CP040435.1|WP_154349407.1|3357262_3357928_+|HNH-endonuclease
METDTTRLGLIEAGAPFSAPGAEASPNATTLHRPGSVRLLSLDAHGRVLDWITWKDAACLYAREAVAWTLGDPCLHIHGGTNRFSGLQSGMDLHPIIAARGHARSRAIDPTPNLTNQALFARDAHLCMYCGQQFNRPTLTRDHVMPLSKGGLDCWENVVTACFHCNSRKSDRTPQQAGMPLLAVPYRPSWIEHLILSNRNILADQMAFLKAQLPKRSKLST
>NZ_CP040435.1|WP_049445810.1|3358033_3359941_+|1-deoxy-D-xylulose-5-phosphate-synthase
MIDSARYPRLARIQTPDDLRTFDESELRAVADELRAYLIESVGKSGGHFAAGLGVIELTVALHYLYQTPQDQLVWDVGHQTYPHKILTGRRDEIHTVKQKDGVAPFPKREESEYDTFGVGHSSTSISAALGMAIARQSEGDNRQVVAVIGDGAMTAGMAFEALMHAGGMEPEPNLLVILNDNNMSISEAVGGLTKMLGRATGSRTLNALREGGKKILGDKKNNPARFVKRWEEHWKGMFVPSTMFEEMGFHYTGPIDGHDMPALLSTLKTLRASKGPKLLHVMTTKGKGYEPAEGDQIGYHAVGPFDPDKGLVAKAGAKKPTYTDVFSDWLCDAAAAEPRLYGITPAMREGSGLVRFSKEYPQRYFDVAIAEQHAVTLAAGMATQGGKPVVAIYSTFLQRAYDQLVHDVAIQDLDVLFAIDRAGVVGPDGATHAGNLDLSFLRCVPNMVVMAPSNEAECRQMLSTGLQHPGPAAVRYPRGTGTGVAAGTDLSTLPIGKGELRLQGSRIALLAFGSTVAAAEQVGRELGLSVVNMRFIKPLDRELVLAVAAQHEGLVTIEDNVVAGGAGSGVGELLNAEGVLRPILHLGLPDSYQHHASREDLLAEAGIDAAGIRAAVLKRWPQLGAGTPPLSAAG
>NZ_CP040435.1|WP_005417823.1|3360050_3360254_-|hypothetical-protein
MLIRLQCEQRQWRVLHPDRPEPIEFRDGARAYDFAETLARLHFVDTGQRAAVRVEASGAFVEAVSYG
>NZ_CP040435.1|WP_154349408.1|3360421_3360994_-|DUF3011-domain-containing-protein
MGKALTWRTLACTLLPMLAAAGGAQAQSYGYGYDDDRYGGREGSGIVRCESIKNRSNECRLEGRARMIRQLSGSPCVEGETWGQSRYGVWVTQGCRAEFVGEYRRGGGWGNGGGWGNGNGNGNGNGWGGGEVITCHSNGHRQEYCDARIRRGVRLVRQDSRSACIEGQTWGWDRRGIWVSDGCRAQFQVN
>NZ_CP040435.1|WP_057502001.1|3361125_3361332_-|hypothetical-protein
MVITVQCNARHWSVLDPQAHDATRYARGAEAFDVAAARALEHHRRTGQRSTVRVEALGSTVDALHVGD
>NZ_CP040435.1|WP_049445791.1|3361735_3362020_+|hypothetical-protein
MKSLLLIPALLVLAACASPDKAPTHAEAAATSPATPVVGGDRDAHGCIGSAGYQWCEHSQRCERPWELAQAQGLANTAEAIDAYCAKPASPARK
>NZ_CP040435.1|WP_049445789.1|3362032_3362266_+|DUF1653-domain-containing-protein
MAELSPLPTLAPGRYRHFKGGEYEVLEIVRSSETLQPMVLYRALYGEGGLWVRPYAMFVEQVPGEHGPQPRFARIDA
>NZ_CP040435.1|WP_088480185.1|3362352_3362925_+|TetR/AcrR-family-transcriptional-regulator
MSASPSRSRRKAPDSVRQSLLQATIEVIGGHGLAALTVQDVAQAAGVSKGALFHHFSSKQALVDEAIGALIGEFEARVRALLQENPEGHGRFSRAYVQANFEHLLQQEQDNDIGLTLGNLMEPALLAHWRDWKRAMLAEFPGEATDPRLYAARCAADGYWATAYGRPLDEEERINALAMAEQALKLCDPL
>NZ_CP040435.1|WP_154349409.1|3362938_3363271_+|QacE-family-quaternary-ammonium-compound-efflux-SMR-transporter
MNPYAYLAAAIVLEVIATSLLKASDGMSRLAPTLGALVGYGLCFYLLSVTMKSIPTGIAYAIWSGVGIVLISLIGLVVFKQRLDAPALIGIGLICAGVLVINLFSRSNAH
>NZ_CP040435.1|WP_006380555.1|3363293_3363467_-|DUF1328-domain-containing-protein
MIKWAIIFAIIGVIAGVLGFGGIAGAAVGIAKFLFWAGIIIAVVLFLLGMTVAKKVS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040435_5

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040435_5

4186433-4186528

Orphan

Consensus_repeat	Method
GTGCCAACCAAGGTTGGCACCTACCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040435_5

>merge|NZ_CP040435|5|4186433-4186528|CRISPRCasFinder
GTGCCAACCAAGGTTGGCACCTACCAGGGCATGTTCCAGTAGATCCACGCCATGCGTGGATGGCGGTGAAGTGCCAACCAAGGTTGGCACCTACCA

>NZ_CP040435|5|4|4186433-4186528|CRISPRCasFinder
GTGCCAACCAAGGTTGGCACCTACCA	GGGCATGTTCCAGTAGATCCACGCCATGCGTGGATGGCGGTGAA
GTGCCAACCAAGGTTGGCACCTACCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040435.1\|WP_049443926.1\|4191119_4191548_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319923
NZ_CP040435.1\|WP_010481344.1\|4191615_4192047_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|341391
NZ_CP040435.1\|WP_088479131.1\|4177423_4178113_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP040435.1\|WP_049443995.1\|4185012_4185579_+\|DUF1415-domain-containing-protein	unknown	unknown	gnl\|CDD\|377792
NZ_CP040435.1\|WP_049443943.1\|4182207_4183335_-\|NAD(P)-dependent-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176239
NZ_CP040435.1\|WP_154349650.1\|4180949_4182047_-\|Fis-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225822
NZ_CP040435.1\|WP_154349654.1\|4190513_4191029_+\|lactoylglutathione-lyase	unknown	unknown	gnl\|CDD\|319900
NZ_CP040435.1\|WP_049443939.1\|4185575_4186379_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187662
NZ_CP040435.1\|WP_049443925.1\|4192494_4194333_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	unknown	unknown	gnl\|CDD\|234729
NZ_CP040435.1\|WP_154349653.1\|4189278_4190391_-\|pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|223110
NZ_CP040435.1\|WP_049443951.1\|4176752_4177355_+\|membrane-protein	unknown	unknown	gnl\|CDD\|336958
NZ_CP040435.1\|WP_154349651.1\|4183352_4184819_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143470
NZ_CP040435.1\|WP_057500519.1\|4188735_4189140_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040435.1\|WP_049443924.1\|4194536_4195814_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273776
NZ_CP040435.1\|WP_049443945.1\|4179317_4180214_-\|DMT-family-transporter	unknown	unknown	gnl\|CDD\|223769
NZ_CP040435.1\|WP_032129038.1\|4195849_4196575_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224059
NZ_CP040435.1\|WP_006471121.1\|4180432_4180915_+\|YajQ-family-cyclic-di-GMP-binding-protein	unknown	unknown	gnl\|CDD\|213038
NZ_CP040435.1\|WP_154349652.1\|4186534_4188565_-\|oligopeptidase-A	unknown	unknown	gnl\|CDD\|341051
NZ_CP040435.1\|WP_154349655.1\|4196585_4197884_+\|FtsX-like-permease-family-protein	unknown	unknown	gnl\|CDD\|274576
NZ_CP040435.1\|WP_154349649.1\|4178109_4179117_-\|ATP-binding-cassette-domain-containing-protein	unknown	unknown	gnl\|CDD\|236863

Protein	Function_ID	Function_description	E-value
NZ_CP040435.1\|WP_049443926.1\|4191119_4191548_+\|VOC-family-protein	gnl\|CDD\|319923	cd07262, VOC_like, uncharacterized subfamily of vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	3.74265e-40
NZ_CP040435.1\|WP_010481344.1\|4191615_4192047_-\|CBS-domain-containing-protein	gnl\|CDD\|341391	cd04623, CBS_pair_bac_euk, Two tandem repeats of the cystathionine beta-synthase (CBS pair) domains present in bacteria and eukaryotes. The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase).	5.78909e-33
NZ_CP040435.1\|WP_088479131.1\|4177423_4178113_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	2.23486e-96
NZ_CP040435.1\|WP_049443995.1\|4185012_4185579_+\|DUF1415-domain-containing-protein	gnl\|CDD\|377792	pfam07209, DUF1415, Protein of unknown function (DUF1415). This family consists of several hypothetical bacterial proteins of around 180 residues in length. The function of this family is unknown.	9.86856e-101
NZ_CP040435.1\|WP_049443943.1\|4182207_4183335_-\|NAD(P)-dependent-alcohol-dehydrogenase	gnl\|CDD\|176239	cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase. Benzyl alcohol dehydrogenase is similar to liver alcohol dehydrogenase, but has some amino acid substitutions near the active site, which may determine the enzyme's specificity of oxidizing aromatic substrates. Also known as aryl-alcohol dehydrogenases, they catalyze the conversion of an aromatic alcohol + NAD+ to an aromatic aldehyde + NADH + H+. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	0
NZ_CP040435.1\|WP_154349650.1\|4180949_4182047_-\|Fis-family-transcriptional-regulator	gnl\|CDD\|225822	COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription].	5.13699e-21
NZ_CP040435.1\|WP_154349654.1\|4190513_4191029_+\|lactoylglutathione-lyase	gnl\|CDD\|319900	cd07233, GlxI_Zn, Glyoxalase I that uses Zn(++) as cofactor. This family includes eukaryotic glyoxalase I that prefers the divalent cation zinc as cofactor. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic glyoxalase I uses nickel. However, eukaryotic Trypanosomatid parasites also use nickel as a cofactor, which could possibly be explained by acquiring their GLOI gene by horizontal gene transfer. Human glyoxalase I is a two-domain enzyme and it has the structure of a domain-swapped dimer with two active sites located at the dimer interface. In yeast, in various plants, insects and Plasmodia, glyoxalase I is four-domain, possibly the result of a further gene duplication and an additional gene fusing event.	2.62278e-86
NZ_CP040435.1\|WP_049443939.1\|4185575_4186379_+\|SDR-family-oxidoreductase	gnl\|CDD\|187662	cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs. This subgroup includes a putative carbohydrate or polyalcohol metabolizing SDR (A3DFK9) from Clostridium thermocellum. Its members have a TGXXXGXG classical-SDR glycine-rich NAD-binding motif, and some have a canonical SDR active site tetrad (A3DFK9 lacks the upstream Asn). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	1.25719e-80
NZ_CP040435.1\|WP_049443925.1\|4192494_4194333_-\|glutamine--fructose-6-phosphate-transaminase-(isomerizing)	gnl\|CDD\|234729	PRK00331, PRK00331, isomerizing glutamine--fructose-6-phosphate transaminase.	0
NZ_CP040435.1\|WP_154349653.1\|4189278_4190391_-\|pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|223110	COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism].	7.51535e-101
NZ_CP040435.1\|WP_049443951.1\|4176752_4177355_+\|membrane-protein	gnl\|CDD\|336958	pfam08212, Lipocalin_2, Lipocalin-like domain. Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The structure is an eight-stranded beta barrel.	6.26672e-43
NZ_CP040435.1\|WP_154349651.1\|4183352_4184819_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143470	cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like. NAD-dependent, benzaldehyde dehydrogenase II (XylC, BenzADH, EC=1.2.1.28) is involved in the oxidation of benzyl alcohol to benzoate. In Acinetobacter calcoaceticus, this process is carried out by the chromosomally encoded, benzyl alcohol dehydrogenase (xylB) and benzaldehyde dehydrogenase II (xylC) enzymes; whereas in Pseudomonas putida they are encoded by TOL plasmids.	0
NZ_CP040435.1\|WP_049443924.1\|4194536_4195814_+\|efflux-RND-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273776	TIGR01730, COG0845:_Membrane-fusion_protein, RND family efflux transporter, MFP subunit. This model represents the MFP (membrane fusion protein) component of the RND family of transporters. RND refers to Resistance, Nodulation, and cell Division. It is, in part, a subfamily of pfam00529 (Pfam release 7.5) but hits substantial numbers of proteins missed by that model. The related HlyD secretion protein, for which pfam00529 is named, is outside the scope of this model. Attributed functions imply outward transport. These functions include nodulation, acriflavin resistance, heavy metal efflux, and multidrug resistance proteins. Most members of this family are found in Gram-negative bacteria. The proposed function of MFP proteins is to bring the inner and outer membranes together and enable transport to the outside of the outer membrane. Note, however, that a few members of this family are found in Gram-positive bacteria, where there is no outer membrane. [Transport and binding proteins, Unknown substrate].	1.59142e-33
NZ_CP040435.1\|WP_049443945.1\|4179317_4180214_-\|DMT-family-transporter	gnl\|CDD\|223769	COG0697, RhaT, Permeases of the drug/metabolite transporter (DMT) superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / General function prediction only].	2.66468e-15
NZ_CP040435.1\|WP_032129038.1\|4195849_4196575_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|224059	COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms].	6.3144e-108
NZ_CP040435.1\|WP_006471121.1\|4180432_4180915_+\|YajQ-family-cyclic-di-GMP-binding-protein	gnl\|CDD\|213038	cd11740, YajQ_like, Proteins similar to Escherichia coli YajQ. In Pseudomonas syringae, YajQ functions as a host protein involved in the temporal control of bacteriophage Phi6 gene transcription. It has been shown to bind to the phage's major structural core protein P1, most likely activating transcription by acting indirectly on the RNA polymerase. YajQ may remain bound to the phage particles throughout the infection period. Earlier, YajQ was characterized as a putative nucleic acid-binding protein based on the similarity of its (ferredoxin-like) three-dimensional topology with that of RNP-like RNA-binding domains.	3.60843e-81
NZ_CP040435.1\|WP_154349652.1\|4186534_4188565_-\|oligopeptidase-A	gnl\|CDD\|341051	cd06456, M3A_DCP, Peptidase family M3, dipeptidyl carboxypeptidase (DCP). Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3.4.15.5). This metal-binding M3A family also includes oligopeptidase A (OpdA; EC 3.4.24.70). DCP cleaves dipeptides off the C-termini of various peptides and proteins, the smallest substrate being N-blocked tripeptides and unblocked tetrapeptides. DCP from Escherichia coli is inhibited by the anti-hypertensive drug captopril, an inhibitor of the mammalian angiotensin converting enzyme (ACE, also called peptidyl dipeptidase A). OpdA may play a specific role in the degradation of signal peptides after they are released from precursor forms of secreted proteins. It can also cleave N-acetyl-L-Ala. This family also includes Arabidopsis thaliana organellar oligopeptidase OOP (At5g65620), which plays a role in targeting peptide degradation in mitochondria and chloroplasts; it degrades peptide substrates that are between 8 to 23 amino acid residues, and shows a weak preference for hydrophobic residues (F/L) at the P1 position.	0
NZ_CP040435.1\|WP_154349655.1\|4196585_4197884_+\|FtsX-like-permease-family-protein	gnl\|CDD\|274576	TIGR03434, ADOP, Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown.	1.26568e-42
NZ_CP040435.1\|WP_154349649.1\|4178109_4179117_-\|ATP-binding-cassette-domain-containing-protein	gnl\|CDD\|236863	PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional.	0

>NZ_CP040435.1|WP_049443939.1|4185575_4186379_+|SDR-family-oxidoreductase
MSRVPPIAAWPAAPLSGKVVLVTGGANGIGRGIAQAVLGAGGRVLIGDLDTEAGHACLAEWQRDDDAAFQPLDITDEASVRAFIATAVQRFGGIDGLVNNAGIAGAHGTPLQDMAWDEWQRRLSSLHGAFLCSKHALPVLSASATGTIINIASTRAWQSEAHSEAYAAAKGGLVAFTHALAISSGPAVRVNSISPGWIGTTAWQAPSRRHEPDYSATDHAQHPVGRVGRPEDIGALAVYLLSSLSGFTTGQDFIVDGGMTRKMIYAE
>NZ_CP040435.1|WP_049443995.1|4185012_4185579_+|DUF1415-domain-containing-protein
MTDSHLPTDDPIAATRLWLERIVIGLNLCPFAKAVYVKDQVRIVLSDATTPEALVEQLAEELVLLRDTPAEQIDTTLIVHPQVLTDFLDYNDFLDNADAAIEALDLQGILQVASFHPDYQFDGVAADDASNYTNRAPFPTLHLLREDSVARAVDVYPDPDVIVERNIQTLDRIGVDGWHRRLRGDDLS
>NZ_CP040435.1|WP_154349651.1|4183352_4184819_-|aldehyde-dehydrogenase-family-protein
MTASFPWLPDALWAGAFFDGHWQAAPQRHPVIEPATGQQLGEIGLADPAQVARSAAAAAQAQQAWAAAPYEQRAEVLRKAARLAEENIETLVEWLVRESGSTRLKAGFEAKVTIKALHEAAALPSRSTGEILPSEPGRLNLARRRPLGVVGVISPFNFPLYLAMRAVAPAIALGNAVVLKPDPRTAVCGGAVIARVFEQAGLPAGVLHMLPGDGAAGAALTSDPHVAMIQFTGSTAAGRKVGEAAGRHLKKVSLELGGKNSLIILDDADLDLAVANTAWGVYLHQGQICMATGRVLVHRKIHDTFLQKLVAKANALKVGDPAREDVAIGPLINAGQRDHAARVVEQAVQAGATLEAGGTHRDLFFAPTVLGNVAADNPAFNEEIFAPVAVVVPFDDDDEAVRLANDSEYGLSMAIVSSNVGRALKIGERLRTGLLHINDQTVNDEVINPFGGVGASGNGTSIGGPANGEEFTQWQWLTVKGEAPAYPI
>NZ_CP040435.1|WP_049443943.1|4182207_4183335_-|NAD(P)-dependent-alcohol-dehydrogenase
MNDNNATREITAAVVRGKEQPFVIEQATLRGPQDDEVRVKVVATGLCHTDLIVRDQYYPVPLPAVLGHEGAGIVEAVGPNVRDLKVGDHVVLTYGACGHCNPCRGGHGAYCRDFFALNFGGDDGHGHTAITDAQGQPLHDHFFAQSSFATFALAREINAIKVPDDAPLELLGPLGCGIQTGAGAVLNSLQVRSGSSFASYGAGAVGLSAVMAAKVAGATTIIAIDVVPSRLELALELGATHVVNSRETDVVEAVRAITGGGADFALESTGRPDVLSAGIEALGGLGMMGVVGAPKLGTTASFDVNNLLLGGRSIRGIVEGDSVPQVFIPQLVTLFQQGRFPFDKLVKFYPLEQINQAAEDSTRGITLKPVLRIAA
>NZ_CP040435.1|WP_154349650.1|4180949_4182047_-|Fis-family-transcriptional-regulator
MMATTVGQQQLVAARAAFAEGDARSLGVLPLPLQQSWLRSRAAGLQPGQEPDYRPLLGRGKRLPHPDDRRLARCVQPELEQLWAAFGGRGWTMFCANRDGMVIAQQAHGLEDAPLLRPIQVGRQLGETEIGTTAPAVSLADDVPALVRGNEHYLQRFAPVFCLSEPLHDLDGRVCGVIDITGLGERDPALLQGYFRQAALASENRLFHSLTDVHLLAVQHDPRWLASPLQGLLAVQEDGQLRAANRVARRLLGLPRRGPLPLLDLEALFAGASAAQRRRLLQPGAAHRVRLGEGSAVYLQRLQGPRGGAHRSAQRSTPADPVAPLLRDQQREAARRAAQAADGNLSLAARQLGISRTTLYKLLRD
>NZ_CP040435.1|WP_006471121.1|4180432_4180915_+|YajQ-family-cyclic-di-GMP-binding-protein
MPSFDVVSEVDTHELTNAIDQANRELATRFDFKGVDAKFERDGDVINQTAPTEFQLKQMNDILRARLAARGIDVLSLEFGDIETNLAQARQKITVKQGIEQKIAKKIAAALKDAKLKVESQINGDKLRVQGKKRDDLQDAIAVLKAGKFELPLQFNNFRD
>NZ_CP040435.1|WP_049443945.1|4179317_4180214_-|DMT-family-transporter
MNLQRSPSRAVAWMVAAVACFSLMDAGMKQLSASYPTLEVTFLRGAASLPFVLVWVLVSAGPRSLVPRRWGLHLLRGGLGMAMIGCFVFALRDLPLSTAYTIYFVAPLLIAALSVPLLGERVGPRRWVAIGIGLVGVLVVLRPGVDGFISVPGLMVLAAATAYAVAAITVSLLTRTDTSQSMVVWFLVIMAIGAGLLAIPGWVPLQLAHAPLIAGMGLAGALGQIALTKAFQLGEASMIAPLEYSGLVWVIGWDLAFWGQLPDSYTWVGAAIIVASGLYLLHRERVNRQEPPKPLDHP
>NZ_CP040435.1|WP_154349649.1|4178109_4179117_-|ATP-binding-cassette-domain-containing-protein
MIEFQRLHKSYAVAGRAVSALQPLDLTIEAGEVFGIIGHSGAGKSTLIRMINRLEEPSGGRLLIGGEDVTALDADGLRALRRRIGMIFQHFNLLSSRTVAGNVAFPLELAGMPKAEIDARVAELLQTVGLEAHAKKYPAQLSGGQKQRVGIARALATRPQILLCDEATSALDPQTTASVLSLLSKINRELGLTIVLITHEMDVIRRVCDRVAVLDAGQMVETGPVTRVFLHPQHPTTRRFVSESEQVDEGALHRDFDAVGGRIVRLTFLGGDTYDPLLGSVARQTGVDYNILSGRIDRIKDTPYGQLVVALVGGDQSAAQAAFVAAGVHVEELRR
>NZ_CP040435.1|WP_088479131.1|4177423_4178113_-|ABC-transporter-permease
MIIATAGGFFRHLDAGKWADIGQATIDTLLMLLGSLPLTLAIGLPLGVLLYLFGAPQMKRRPFAYGVLALVVNLLRSVPFIILMIVLIPVTLFLMGTSLGVRGAIVPLVIGAAPFYARLVETALREVDRGVIEATQSMGATTWQLVTRVLLPEARPGLIAGATVTTVALIGFTAMGGAIGSGGLGDLAFRDGYQRSHTDVALVTVVLLLILVQLLQMLGDRLVAHYSRR
>NZ_CP040435.1|WP_049443951.1|4176752_4177355_+|membrane-protein
MTSIRPLCAVLLALSLAAPAVAASEPPSPRASALRAADPDAPIDLKRFMGTWYVIGRVPNFIERGHVASVNEYELRDEHKVGITYRYRDGFGEPLQEVRARASVDPDSGNHGWRTWFYRVVPTHSRVLEVAPDYSWALIGYPGREMAWIFSRTPDMDKALYKELAERLRDEYGVNTDKLKRVPQHPEQVGKLGYEVPNVR
>NZ_CP040435.1|WP_154349652.1|4186534_4188565_-|oligopeptidase-A
MTVANPLLDFSGLPRFEAIRPEHVAPALDVLLADAEAAVSTAEQVQPVRWQTFVAPLDDATERLWRAWGLVGHLQGVVNTPELREAYNSNLPRVTRFASALGQNLALYRQYQALAASAEAATFDDAQRKVLDNTLRDFRLGGAELAPEAQQRFAAIKEELSALSAKFSQNVLDATDAWSLIIEDEARLKGVPEDVKAAAHAAAQKDGKAGWKLTLQMPCYLPVQTWGEDRDLREILYRASAQRASEFGDDALDNSGNIDRILALRAELAALLGFGSYGDYSVATKMAQDPAEVLGFLRDLASRAKPFAAKDRAELEQFAREQLGIDSLQAWDLAFAADRLKQARYSYSEQEVKQYFTEPKVLGGLFSVIEQLYGLRVQEDSAPVWHEDVRFFRLVDAQGALVGQFYLDLYAREGKRGGAWMDDCRNRRERADGSIQTPLVYLVCNFGRGANGKPATFSHNEVTTLFHEMGHGLHQLLTRIGELGVAGINGVEWDAVELPSQFMENFCWEWDHLQGMTAHVDSGEPLPRGLYERMLAARNFHSGMATVRQLEFGLFDMLLHSQFEPAQDSVLALLDRVRAEVAVNHPPVWNRFPHQFSHIFAGGYAAGYYSYKWAEVLSADAYAAFEEAPQALAETGARFRDEILSRGGSRPAAENFKAFRGRAPQIDALLRHSGMA
>NZ_CP040435.1|WP_057500519.1|4188735_4189140_+|hypothetical-protein
MEGLAAVASASPARSLALSASPAELTWIAALCDAGDDAPRHLHQLQAVLQQGGTFNDAQEWYPFEVVERGASQLRLGHEREFVICVLLWLQALAQGRTSILDPSLHLDDRAMDIEALPDALRDAVLDAFTAAGY
>NZ_CP040435.1|WP_154349653.1|4189278_4190391_-|pyridoxal-phosphate-dependent-enzyme
MSQREWVAAAIRKIEADFNRSADTHLIPLALPGFEGVDVYLKDESSHPTGSLKHRLARSLFLYALTNGWLREGRPVIEASSGSTAVSEAYFARLLGLPFIAVIPATTSPEKIAAIEFHGGRCHLVERACELNGESEKLARETGGHFMDQFTYAERATDWRANNNIAESIFKQMAEEPSPVPEWIVCSPGTGGTAATLGRYVSYRRHDTRILCADPEVSVFFDGYQAAVAGEQDWRGLTCSGGSRVEGIGRPRVEPSFIPTSVDAMVKVPDALSLAAMRHVSRQLGRRVGGSTGTNFIGVLQAAQWMREAGHQGSIVSILCDSGERYAQSYYDPAWYARQGIDVDGADAQLAAAVAGQGLPELPWCSLEAL
>NZ_CP040435.1|WP_154349654.1|4190513_4191029_+|lactoylglutathione-lyase
MTIPALRDVPGVAAQAPAETTGFVFNHTMLRVKDITASLDFYTRVLGYQLIDKRDFPEAQFSLYFLAYVPAGAVVPEDDAQRRVWMAGLPGVLELTHNHGTETQDGAVYHDGNSDPRGFGHICVSVPDIEAACQRFEDLGVTFQKRLTDGRMKNLAFIKDPDGYWVEIIAN
>NZ_CP040435.1|WP_049443926.1|4191119_4191548_+|VOC-family-protein
METMELHRGRLIDHIQLVVRDLAASRRFYQAVFDTIGIPIAGEGDDYFWADELFISSANSEAAAGQLTGRHHLAFQARDSATVDAFHTEAIAAGGTDNGAPGERPYHPGYYGAFVLDPDGNNIEVVYHGPANYSADSVKVTF
>NZ_CP040435.1|WP_010481344.1|4191615_4192047_-|CBS-domain-containing-protein
MNVRELLQSKKEAVITIDAEDTIGAAAHKMSANKIAALVVMKDDAPVGIISEKDIVRTLADDGPQAGRRVISSLPSTGLEGIAPEATLKQAMSLMTYSRRRHLMVTEGTRLVGILSLGDIVKNLLGELELEKAVLQDIYMAAH
>NZ_CP040435.1|WP_049443925.1|4192494_4194333_-|glutamine--fructose-6-phosphate-transaminase-(isomerizing)
MCGIVGAIADRDVVPVLIEGLKRLEYRGYDSSGIAVIDHAARPEVRRVRRTGRVSEMATAAEAEGFNAVLGIGHTRWATHGGVTEANAHPHISHGVALVHNGIIENHEEQREKLRALGYTFESQTDTEVIAHLIHHHLKDGDDLLVALQHTVKELTGAYALAVVSRAEPERFVCARMGCPLLVGLGEGENFVASDVSAVISATRKVIFLEEGDTAEIRRDGVRIFDEHDQPVERDVHLSDVSLASLELGPYRHFMQKEIHEQPRALGDTIEAAIDAGGFPAELFGKNAEAVLSGIEGVQIIACGTSYYAGLTARYWIEAIAGLPCSVEIASEYRYRAAYANPKHLVVTISQSGETLDTMEALKYAKSLGHKHTLSICNVPESAIPRASELVCYTRAGAEIGVASTKAFTTQLAALFQLTVVLGKLQGRIGAAQEADYLEQLRFLPGSVQHALNLEPQIAAWAERFARKSNALFLGRGLHYPIALEGSLKLKEISYIHAEAYPAGELKHGPLALVDEDMPVVVIAPNDSLLEKVKSNMQEVRARGGELFVFADQDSNFNESEGVHVIRTPRHAGVLSPIVHTIPVQLLAYHTALARGTDVDKPRNLAKSVTVE
>NZ_CP040435.1|WP_049443924.1|4194536_4195814_+|efflux-RND-transporter-periplasmic-adaptor-subunit
MIRDTSAQDQIVSSAPAGTTRANWQRYRWPALGAIVLLAGIGWAVHAWSNASRSFDSSRVRIAEVKRGDLVRDIAADGRVIAANSPILYAISAGTVDLKVVAGDVVKKGQELAIIDSPELRSKLAQEQATLAGLEAEASRAALDATLARAKSRKETDQATIERQAADRDLQRYQRGYDGGAVPQIDLAKAKDSLKKADITLANATTDARLQSQGADLDARNKRLLADRQKAVVAEVQRQVDALTLRAPFDGQVGQVQAVQSTNLAANAPVLGVVDLSKFEVEIKVPESFARDLAIGMPAQLTGGNGKPFPGEISAVSPEVVNGEVNARVRFASAQPEGLRQSQRMSVRVLLDTRKDVLKVERGPFVEQGNGVAYVMDGRTAVRRPVELGVSSLGEVEIKSGVQPGDRIVVSGSDLFKDAERVSVN
>NZ_CP040435.1|WP_032129038.1|4195849_4196575_+|ABC-transporter-ATP-binding-protein
MYMLEMRSVAKVFRTEQVETHALRSLELQVKEGEFVAVTGPSGSGKTTFLNIAGLLETFTSGTYMLDGQDVSTLGDDARSRLRNQKIGFIFQGFNLIPDLNLFDNVDVPLRYRKMSANERRERIEKALSQVGLGSRMKHYPNELSGGQQQRAAIARALAGSPRLLLADEPTGNLDTQMARGVMELLEEINAAGTTIVMVTHDPELAARAQRNVHIVDGQVTDLVREPVLATPPRHIVAVNE
>NZ_CP040435.1|WP_154349655.1|4196585_4197884_+|FtsX-like-permease-family-protein
MFAYYARLAVRSFRRNKVLTALMVVAIALGIGASMTTLTVFHVLSGDPIPGKSDRLFYVQLDAATGAYVAGEEPETQLTRFDGEALLREAKGERQALMSGGGGTIEPDNSTLKPFSIDTRWTSADFFPMFEVPMQYGRPWTREDDEGRARVVVISKALNDKLYQGANSVGRDLRMEGQSYRIVGVMKEWSPEPHFYDLTTGSYGKNEDLLLPISTSFDLKLGNNGNMNCFGENPDGNSYSLNAPCAWLQYWVEMDPAKAHDYRRYLENYSTQQREAGRFKHPPNVRLRTVMEWLDFNGAVPSDVRLQLWLALGFLGVCLVNTVGLLLAKFLRRSGEIGVRRALGASRGQIFLQCLVEAGAVGVVGGVLGIGLALLGLFAVRQQPVEYAKLAHLDGNMLLLALGLTLLASLAAGFLPAWRAMQVTPAIQLKSQ

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

174038 : 181324

uncultured_Caudovirales_phage(85.71%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102947287.1\|174038_175517_+	SulP family inorganic anion transporter	A0A2H4J153	uncultured_Caudovirales_phage	3.3e-167	67.1
WP_102947286.1\|175624_176158_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.3e-30	44.3
WP_102947285.1\|176118_177204_-	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	1.3e-88	56.1
WP_154348313.1\|177228_178215_-	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	5.1e-63	43.8
WP_102944316.1\|178218_179277_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_102944315.1\|179297_179789_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	4.6e-25	40.3
WP_099472789.1\|179812_180127_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_099472787.1\|180167_180908_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	9.6e-83	67.6
WP_099472786.1\|180904_181324_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.2e-39	61.4

DBSCAN-SWA_2

630380 : 640820

Enterobacteria_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019660969.1\|630380_631436_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	1.9e-79	46.2
WP_057500378.1\|631452_632340_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	2.8e-97	58.5
WP_004141806.1\|632336_632894_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	1.2e-45	51.1
WP_154348473.1\|632890_633796_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	1.7e-28	37.8
WP_154348474.1\|633991_635284_+	hypothetical protein	NA	NA	NA	NA
WP_154348475.1\|635336_636740_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	6.5e-48	29.2
WP_088480375.1\|636752_638099_-	phosphomannomutase	A0A127AWJ1	Bacillus_phage	1.0e-29	26.7
WP_154348476.1\|638195_640820_-	helicase	A8C6A2	Antheraea_pernyi_nuclear_polyhedrosis_virus	2.7e-47	29.9

DBSCAN-SWA_3

998313 : 1072234

Escherichia_phage(20.0%)

protease,plate,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032129320.1\|998313_999603_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	2.2e-135	58.0
WP_049448003.1\|999745_1002196_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	3.9e-221	52.1
WP_004146343.1\|1002413_1002686_+	HU family DNA-binding protein	A7KV42	Bacillus_phage	7.7e-22	61.8
WP_057499974.1\|1003563_1005519_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_154348585.1\|1005730_1006930_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_057499976.1\|1006926_1007691_-	hydroxyacylglutathione hydrolase	NA	NA	NA	NA
WP_099589981.1\|1007702_1008347_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_032129326.1\|1008360_1008813_+	ribonuclease HI	J9Q745	Salmonella_phage	7.7e-43	53.4
WP_049444039.1\|1008817_1009549_+	DNA polymerase III subunit epsilon	A2I2Z6	Vibrio_virus	1.3e-07	28.9
WP_154348586.1\|1009618_1010323_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_049444041.1\|1011084_1011489_+	hypothetical protein	A0A1C9C5K8	Heterosigma_akashiwo_virus	2.2e-17	34.6
WP_049444043.1\|1011537_1012584_-	glycosyltransferase family 9 protein	NA	NA	NA	NA
WP_049444045.1\|1012604_1013354_+	3-deoxy-D-manno-octulosonic acid kinase	NA	NA	NA	NA
WP_154348587.1\|1013353_1014121_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_049444049.1\|1014117_1014507_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_049444051.1\|1014983_1015301_+	quaternary ammonium compound efflux SMR transporter SugE	NA	NA	NA	NA
WP_154348588.1\|1015660_1026550_+	transporter	NA	NA	NA	NA
WP_088481068.1\|1026604_1027048_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_154349920.1\|1027421_1027796_+	DUF3592 domain-containing protein	NA	NA	NA	NA
WP_154348589.1\|1028160_1030233_+	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	2.2e-47	41.4
WP_010483846.1\|1030239_1030560_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_032127775.1\|1030671_1031271_+	recombination protein RecR	NA	NA	NA	NA
WP_099589453.1\|1031337_1031697_+	histidine triad nucleotide-binding protein	NA	NA	NA	NA
WP_005408301.1\|1031777_1032305_-	membrane protein	NA	NA	NA	NA
WP_088481012.1\|1032301_1034251_-	DUF3488 domain-containing transglutaminase family protein	NA	NA	NA	NA
WP_088481013.1\|1034243_1035188_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_154348590.1\|1035190_1036144_-	AAA domain-containing protein	NA	NA	NA	NA
WP_057501947.1\|1036186_1038022_+	hypothetical protein	NA	NA	NA	NA
WP_049444065.1\|1038123_1038693_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_049444067.1\|1038806_1039316_+	characterized ACR protein	NA	NA	NA	NA
WP_004154640.1\|1039423_1039618_+	50S ribosomal protein L32	NA	NA	NA	NA
WP_014646186.1\|1039709_1040687_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_154348591.1\|1040764_1041547_+	serine/threonine protein phosphatase	NA	NA	NA	NA
WP_049444071.1\|1041787_1042732_+	ACP S-malonyltransferase	NA	NA	NA	NA
WP_005408312.1\|1042814_1043558_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	4.7e-13	32.3
WP_005408313.1\|1043710_1043950_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	4.6e-10	44.6
WP_057497211.1\|1044093_1045356_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_154348592.1\|1045570_1046935_+	aminodeoxychorismate synthase component I	NA	NA	NA	NA
WP_154348593.1\|1047074_1048136_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_049444079.1\|1048132_1048798_+	dTMP kinase	W8D0J5	Erwinia_phage	2.5e-21	35.2
WP_154348594.1\|1048794_1049751_+	DNA polymerase III subunit delta'	NA	NA	NA	NA
WP_049444084.1\|1049747_1050101_+	pilus assembly protein PilZ	NA	NA	NA	NA
WP_021202623.1\|1050468_1050726_-	hypothetical protein	NA	NA	NA	NA
WP_154348595.1\|1051886_1052450_-	hypothetical protein	NA	NA	NA	NA
WP_154348596.1\|1053039_1053420_+	tautomerase family protein	NA	NA	NA	NA
WP_154348597.1\|1053467_1053890_+	hypothetical protein	NA	NA	NA	NA
WP_154348598.1\|1053957_1055031_-\|tail	phage tail protein	D5LGY1	Escherichia_phage	3.9e-93	51.3
WP_049444089.1\|1055021_1055237_-\|tail	tail protein	A0A193GYC8	Enterobacter_phage	2.3e-13	54.3
WP_049444091.1\|1055220_1055688_-\|tail	phage tail protein	A4PE53	Ralstonia_virus	3.4e-09	30.4
WP_154348599.1\|1055690_1058162_-\|tail	phage tail tape measure protein	A0A1W6JT50	Escherichia_phage	3.5e-28	24.1
WP_005412456.1\|1058282_1058573_-\|tail	phage tail assembly protein	A0A193GYZ8	Enterobacter_phage	1.5e-18	58.5
WP_049444095.1\|1058653_1059157_-\|tail	phage major tail tube protein	A0A193GYM4	Enterobacter_phage	2.8e-41	51.8
WP_154348600.1\|1059159_1060359_-\|tail	phage tail protein	D5LGY7	Escherichia_phage	4.8e-124	53.4
WP_154348601.1\|1060466_1061051_-	hypothetical protein	NA	NA	NA	NA
WP_049444100.1\|1061055_1062555_-	hypothetical protein	V9IQX0	Stenotrophomonas_phage	2.0e-71	57.3
WP_049444102.1\|1062562_1063342_-\|tail	phage tail protein I	V9IQK7	Stenotrophomonas_phage	1.9e-44	50.0
WP_049444103.1\|1063334_1064231_-\|plate	baseplate assembly protein	V5YTH6	Pseudomonas_phage	1.1e-80	56.1
WP_049444104.1\|1064233_1064572_-\|plate	phage baseplate protein	A0A193GYY8	Enterobacter_phage	1.0e-31	61.3
WP_154348602.1\|1064624_1065215_-\|plate	phage baseplate assembly protein V	A0A193GYL5	Enterobacter_phage	7.3e-25	38.2
WP_154348603.1\|1065211_1065766_-	hypothetical protein	NA	NA	NA	NA
WP_154348604.1\|1065884_1066214_-	hypothetical protein	NA	NA	NA	NA
WP_154348605.1\|1066119_1066497_-	hypothetical protein	NA	NA	NA	NA
WP_049444110.1\|1066493_1066979_-	glycoside hydrolase family 104 protein	D5LH07	Escherichia_phage	1.4e-42	56.2
WP_043033662.1\|1066975_1067326_-	hypothetical protein	NA	NA	NA	NA
WP_099589433.1\|1067322_1067772_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_099589432.1\|1068106_1068490_-	hypothetical protein	NA	NA	NA	NA
WP_154349921.1\|1068643_1069282_-	hypothetical protein	A0A2H4J8A1	uncultured_Caudovirales_phage	4.5e-20	37.6
WP_024956102.1\|1069323_1069551_-	hypothetical protein	NA	NA	NA	NA
WP_154348606.1\|1069615_1069897_-	hypothetical protein	NA	NA	NA	NA
WP_154348607.1\|1069897_1072234_-	toprim domain-containing protein	D5LH15	Escherichia_phage	1.5e-134	42.8

DBSCAN-SWA_4

1707180 : 1741719

Stenotrophomonas_phage(90.62%)

terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154348787.1\|1707180_1707573_-	hypothetical protein	B7SYG6	Stenotrophomonas_phage	3.0e-59	87.7
WP_154348788.1\|1707580_1708069_-	hypothetical protein	B7SYG7	Stenotrophomonas_phage	1.9e-79	92.0
WP_043402302.1\|1708065_1708305_-	hypothetical protein	B7SYG8	Stenotrophomonas_phage	1.6e-26	69.6
WP_043402299.1\|1708301_1708628_-	hypothetical protein	NA	NA	NA	NA
WP_043402296.1\|1708624_1708897_-	hypothetical protein	NA	NA	NA	NA
WP_154348789.1\|1708912_1709239_-	hypothetical protein	NA	NA	NA	NA
WP_049400533.1\|1709632_1709857_-	hypothetical protein	NA	NA	NA	NA
WP_154348790.1\|1710019_1710487_-	hypothetical protein	A0A2H4J0E0	uncultured_Caudovirales_phage	1.3e-08	57.7
WP_154348791.1\|1710483_1710657_-	hypothetical protein	NA	NA	NA	NA
WP_154348792.1\|1710733_1711240_-	helix-turn-helix domain-containing protein	A0A0R6PJ00	Moraxella_phage	3.4e-07	36.5
WP_154348793.1\|1711325_1711604_+	transcriptional regulator	NA	NA	NA	NA
WP_154348794.1\|1711655_1711847_+	hypothetical protein	NA	NA	NA	NA
WP_154348795.1\|1711843_1712374_+	hypothetical protein	B7SYH6	Stenotrophomonas_phage	2.9e-89	92.0
WP_143994135.1\|1712375_1712606_+	hypothetical protein	B7SYH7	Stenotrophomonas_phage	5.5e-29	89.5
WP_154348796.1\|1712781_1715196_+	toprim domain-containing protein	B7SYD0	Stenotrophomonas_phage	0.0e+00	97.3
WP_154348797.1\|1715538_1716183_+	hypothetical protein	B7SYD2	Stenotrophomonas_phage	3.1e-93	96.7
WP_154348798.1\|1716179_1718105_+\|terminase	phage terminase large subunit family protein	B7SYD3	Stenotrophomonas_phage	0.0e+00	97.2
WP_053451655.1\|1718098_1718419_+	hypothetical protein	B7SYD4	Stenotrophomonas_phage	8.7e-49	96.2
WP_015994693.1\|1718498_1718714_+	hypothetical protein	B7SYD5	Stenotrophomonas_phage	7.2e-31	100.0
WP_154348799.1\|1718715_1720206_+\|portal	phage portal protein	B7SYD6	Stenotrophomonas_phage	4.6e-286	99.6
WP_154348800.1\|1720202_1722185_+	peptidase S14	B7SYD7	Stenotrophomonas_phage	0.0e+00	99.2
WP_154348801.1\|1722207_1722573_+	DUF2190 family protein	B7SYD8	Stenotrophomonas_phage	2.1e-51	88.4
WP_154348802.1\|1722653_1723085_+	structural protein P5	B7SYD9	Stenotrophomonas_phage	7.1e-70	91.5
WP_049423649.1\|1723084_1723426_+	hypothetical protein	B7SYE0	Stenotrophomonas_phage	7.2e-25	53.6
WP_154348803.1\|1723422_1723914_+	endopeptidase	B7SYE1	Stenotrophomonas_phage	1.8e-37	57.1
WP_154348804.1\|1723910_1724246_+	hypothetical protein	B7SYE3	Stenotrophomonas_phage	1.8e-33	67.0
WP_154349932.1\|1724247_1724721_+	hypothetical protein	B7SYE4	Stenotrophomonas_phage	6.2e-51	71.9
WP_154348805.1\|1724734_1725535_+	hypothetical protein	B7SYE5	Stenotrophomonas_phage	5.4e-132	88.3
WP_043402245.1\|1725606_1726257_+	hypothetical protein	B7SYE6	Stenotrophomonas_phage	2.7e-113	94.0
WP_154348806.1\|1726249_1729999_+	Laminin subunit alpha-2	B7SYE7	Stenotrophomonas_phage	0.0e+00	79.5
WP_043402241.1\|1729998_1730415_+	hypothetical protein	B7SYE8	Stenotrophomonas_phage	2.5e-64	87.7
WP_154348807.1\|1730418_1734021_+	hypothetical protein	B7SYE9	Stenotrophomonas_phage	0.0e+00	80.2
WP_154348808.1\|1734037_1735018_+	hypothetical protein	B7SYF0	Stenotrophomonas_phage	2.6e-35	34.3
WP_154349933.1\|1735497_1737162_+	hypothetical protein	B7SYF1	Stenotrophomonas_phage	3.0e-185	76.2
WP_154348809.1\|1737151_1737385_+	hypothetical protein	B7SYF2	Stenotrophomonas_phage	9.8e-34	89.6
WP_154348810.1\|1737532_1738324_+	DNA adenine methylase	B7SYF3	Stenotrophomonas_phage	1.3e-154	98.5
WP_154348811.1\|1738327_1738993_-	SOS response-associated peptidase	B7SYF4	Stenotrophomonas_phage	1.2e-121	95.5
WP_154348812.1\|1739352_1739880_+	hypothetical protein	B7SYF7	Stenotrophomonas_phage	2.5e-61	75.2
WP_154348813.1\|1740016_1740628_+	hypothetical protein	NA	NA	NA	NA
WP_154348814.1\|1740627_1741719_+	ImmA/IrrE family metallo-endopeptidase	A0A0U4JD08	Gordonia_phage	1.4e-37	32.7

DBSCAN-SWA_5

2432911 : 2451495

Stenotrophomonas_phage(70.59%)

transposase,coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154349049.1\|2432911_2435905_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	3.5e-75	26.5
WP_154349050.1\|2436751_2437282_-	hypothetical protein	S0F2J2	Stenotrophomonas_phage	3.6e-31	53.8
WP_154349051.1\|2437420_2437699_+	hypothetical protein	S0F3S0	Stenotrophomonas_phage	8.2e-11	55.2
WP_154349052.1\|2437691_2437832_+	hypothetical protein	NA	NA	NA	NA
WP_154349053.1\|2437821_2438886_+	phage replication protein	Q4LAU7	Stenotrophomonas_phage	2.4e-183	88.4
WP_154349054.1\|2438867_2439146_+	hypothetical protein	Q4LAU1	Stenotrophomonas_phage	6.6e-37	82.6
WP_154349055.1\|2439383_2439623_+	hypothetical protein	NA	NA	NA	NA
WP_154349056.1\|2439840_2441214_+	hypothetical protein	NA	NA	NA	NA
WP_154349057.1\|2441215_2441545_+	DUF2523 domain-containing protein	NA	NA	NA	NA
WP_154349058.1\|2441541_2442747_+	zonular occludens toxin family protein	B1NI81	Stenotrophomonas_phage	8.4e-52	34.1
WP_154349059.1\|2442743_2443370_+	conjugal transfer protein	S0F2N7	Stenotrophomonas_phage	1.1e-95	91.1
WP_154349060.1\|2443518_2443950_+	hypothetical protein	NA	NA	NA	NA
WP_154349061.1\|2444003_2444366_-	hypothetical protein	B1NI82	Stenotrophomonas_phage	7.6e-41	73.0
WP_154349062.1\|2444571_2444952_+	hypothetical protein	Q4LAU5	Stenotrophomonas_phage	6.3e-62	92.1
WP_154349063.1\|2445488_2446700_-	zonular occludens toxin	A0A077JGB2	Xanthomonas_phage	3.2e-83	44.5
WP_154349064.1\|2446696_2446987_-	DUF2523 domain-containing protein	A0A077JCZ2	Xanthomonas_phage	2.0e-15	41.8
WP_154349065.1\|2446983_2448414_-\|coat	A coat protein	A0A077JDC5	Xanthomonas_phage	3.1e-53	47.6
WP_154349066.1\|2448537_2448792_-	hypothetical protein	NA	NA	NA	NA
WP_134729319.1\|2448788_2448995_-	hypothetical protein	A0A077JGA5	Xanthomonas_phage	2.5e-09	47.0
WP_154349067.1\|2449132_2449435_-	single-stranded DNA-binding protein	B1NI78	Stenotrophomonas_phage	9.4e-45	94.8
WP_154349068.1\|2449441_2450548_-	replication protein	S0F3I3	Stenotrophomonas_phage	1.8e-205	93.8
WP_154349069.1\|2450537_2450708_-	hypothetical protein	NA	NA	NA	NA
WP_154349070.1\|2450704_2450980_-	hypothetical protein	S0F3S0	Stenotrophomonas_phage	3.6e-11	56.7
WP_154349071.1\|2451123_2451495_+	hypothetical protein	Q4LAU6	Stenotrophomonas_phage	7.2e-63	96.7

DBSCAN-SWA_6

4259583 : 4300979

Xanthomonas_virus(14.29%)

terminase,capsid,tail,integrase,head,portal

attL 4257553:4257569|attR 4283060:4283076

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4257553:4257569	attL	NA	NA	NA	NA
WP_154349969.1\|4259583_4260585_-\|portal	phage portal protein	V9IQW4	Stenotrophomonas_phage	4.4e-139	76.5
WP_154349670.1\|4261431_4263300_-	DUF927 domain-containing protein	A0A1B0VP75	Pseudomonas_phage	1.3e-62	33.4
WP_154349671.1\|4263358_4264201_-	toprim domain-containing protein	A0A1B0VML8	Pseudomonas_phage	7.9e-41	47.2
WP_099491676.1\|4264187_4264826_-	hypothetical protein	NA	NA	NA	NA
WP_099491673.1\|4264822_4265038_-	hypothetical protein	NA	NA	NA	NA
WP_154349672.1\|4265034_4265244_-	hypothetical protein	NA	NA	NA	NA
WP_080353451.1\|4265537_4265822_-	ogr/Delta-like zinc finger family protein	E5E3P1	Burkholderia_phage	3.6e-06	40.3
WP_049453498.1\|4265831_4266035_-	hypothetical protein	NA	NA	NA	NA
WP_099491692.1\|4266031_4266217_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_154349673.1\|4266925_4268116_-	DUF4102 domain-containing protein	B7SYF8	Stenotrophomonas_phage	1.7e-118	55.7
WP_154349674.1\|4268480_4269836_+\|integrase	integrase	NA	NA	NA	NA
WP_100442846.1\|4270220_4270703_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A218MND2	uncultured_virus	6.0e-17	41.8
WP_154349675.1\|4270686_4271937_+	DUF4113 domain-containing protein	F1C5A5	Cronobacter_phage	1.7e-87	45.5
WP_154349676.1\|4272025_4273549_+	hypothetical protein	R9TRQ8	Vibrio_phage	8.5e-25	23.9
WP_154349677.1\|4273826_4274441_-	hypothetical protein	NA	NA	NA	NA
WP_154349678.1\|4274503_4274794_+	hypothetical protein	NA	NA	NA	NA
WP_154349679.1\|4274775_4275225_-	blue light sensor protein	NA	NA	NA	NA
WP_154349970.1\|4275666_4276599_-	hypothetical protein	NA	NA	NA	NA
WP_154349680.1\|4276647_4277394_-	hypothetical protein	NA	NA	NA	NA
WP_154349681.1\|4277686_4284694_-\|tail	phage tail protein	I7HDJ4	Xanthomonas_virus	0.0e+00	48.7
4283060:4283076	attR	NA	NA	NA	NA
WP_088026406.1\|4284684_4285080_-	hypothetical protein	Q52PK9	Xanthomonas_phage	4.9e-25	47.2
WP_154349682.1\|4285079_4285541_-	DUF1833 domain-containing protein	Q52PL0	Xanthomonas_phage	9.4e-36	47.1
WP_154349683.1\|4285537_4285894_-	hypothetical protein	A5H1M2	Xanthomonas_virus	9.8e-17	41.3
WP_154349684.1\|4285893_4288674_-\|tail	phage tail tape measure protein	A5H1M1	Xanthomonas_virus	4.4e-80	28.4
WP_154349685.1\|4288666_4288861_-	hypothetical protein	NA	NA	NA	NA
WP_154349686.1\|4288902_4289313_-	hypothetical protein	NA	NA	NA	NA
WP_154349687.1\|4289316_4290072_-	hypothetical protein	NA	NA	NA	NA
WP_080356759.1\|4290108_4290519_-	hypothetical protein	NA	NA	NA	NA
WP_154349971.1\|4290556_4290871_-	hypothetical protein	NA	NA	NA	NA
WP_154349688.1\|4290885_4291644_-	hypothetical protein	NA	NA	NA	NA
WP_154349689.1\|4291689_4292691_-\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	1.1e-54	38.9
WP_154349690.1\|4292778_4293468_-\|head	head decoration protein	NA	NA	NA	NA
WP_154349972.1\|4293470_4294775_-	S49 family peptidase	Q75QM8	Wolbachia_phage	9.7e-38	38.4
WP_154349691.1\|4294821_4296303_-\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	2.6e-103	46.4
WP_154349692.1\|4296295_4296511_-	hypothetical protein	A0A2H4JA19	uncultured_Caudovirales_phage	4.0e-05	43.5
WP_154349973.1\|4296512_4298573_-\|terminase	terminase	A5LH27	Enterobacteria_phage	4.1e-147	41.8
WP_154349693.1\|4298574_4299078_-	DUF1441 family protein	A0A219Y9N2	Aeromonas_phage	1.5e-23	38.7
WP_154349694.1\|4299270_4299558_-	hypothetical protein	NA	NA	NA	NA
WP_154349695.1\|4299559_4300042_-	hypothetical protein	NA	NA	NA	NA
WP_154349696.1\|4300038_4300494_-	hypothetical protein	K7ZPX3	Xanthomonas_citri_phage	1.7e-13	38.3
WP_154349697.1\|4300490_4300979_-	glycoside hydrolase family protein	D5LH07	Escherichia_phage	3.0e-69	80.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040435

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection