CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046066	Vibrio sp. THAF191d plasmid pTHAF191d_b, complete sequence	0 crisprs	cas3,csa3,WYL,DEDDh	0	159
NZ_CP046068	Vibrio sp. THAF191d plasmid pTHAF191d_d, complete sequence	0 crisprs	NA	0	3
NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	1 crisprs	csa3,WYL	1	1
NZ_CP046065	Vibrio sp. THAF191d chromosome, complete genome	0 crisprs	DEDDh,csa3,DinG,csx1,cas3	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 8490

Bacillus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064487012.1\|1474_2827_-	alpha-amylase	NA	NA	NA	NA
WP_040121751.1\|3035_3692_+	DsbA family oxidoreductase	NA	NA	NA	NA
WP_152472599.1\|3695_4598_-	DUF808 family protein	NA	NA	NA	NA
WP_154351815.1\|4785_5706_+	succinylglutamate desuccinylase/aspartoacylase family protein	NA	NA	NA	NA
WP_039952136.1\|5700_6489_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_152472597.1\|6588_7488_+	EamA family transporter	NA	NA	NA	NA
WP_006961258.1\|7578_8490_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.1e-18	34.9

DBSCAN-SWA_2

26308 : 30010

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_173002621.1\|26308_27811_+	glucose-6-phosphate dehydrogenase	M4SIY3	Cyanophage	1.8e-88	38.5
WP_152472591.1\|27807_28524_+	6-phosphogluconolactonase	NA	NA	NA	NA
WP_021456736.1\|28561_30010_+	decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase	E3SJC4	Synechococcus_phage	4.0e-32	32.0

DBSCAN-SWA_3

41601 : 45967

Agrobacterium_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071881323.1\|41601_42153_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	1.1e-11	37.1
WP_152472586.1\|42156_44085_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	2.0e-127	37.4
WP_152472585.1\|44338_45967_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-26	53.5

DBSCAN-SWA_4

52688 : 53837

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472581.1\|52688_53837_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.0e-35	29.5

DBSCAN-SWA_5

61829 : 64830

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961309.1\|61829_63458_-	endonuclease	A0A2P0VMP9	Tetraselmis_virus	2.2e-10	27.4
WP_006961310.1\|63766_64381_-	LysE family translocator	NA	NA	NA	NA
WP_050778633.1\|64407_64830_-	hypothetical protein	A0A2I7R0J7	Vibrio_phage	6.8e-17	40.9

DBSCAN-SWA_6

74283 : 78937

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952243.1\|74283_75765_-	glycoside hydrolase family 32 protein	S6ATV4	Bacillus_phage	1.8e-56	32.0
WP_006961322.1\|75923_76934_-	hypothetical protein	NA	NA	NA	NA
WP_006961323.1\|77116_78250_-	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G3M9Y6	Bacillus_virus	6.7e-27	35.4
WP_006961324.1\|78304_78937_-	beta-phosphoglucomutase	M1H9H9	Acanthocystis_turfacea_Chlorella_virus	8.9e-13	27.8

DBSCAN-SWA_7

86387 : 95475

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172974081.1\|86387_87233_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-14	31.9
WP_006961331.1\|87229_88066_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_006961332.1\|88065_88992_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_006961333.1\|89039_90083_-	phosphate ABC transporter substrate-binding protein PstS	A0A1D7SRJ6	Cyanophage	2.1e-51	37.9
WP_006961334.1\|90442_91837_+	HAMP domain-containing histidine kinase	A0A1B0VMK3	Pseudomonas_phage	8.0e-06	21.1
WP_006961335.1\|91833_92466_+	response regulator	NA	NA	NA	NA
WP_152472576.1\|92838_94776_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_006961337.1\|94821_95475_-	ankyrin repeat domain-containing protein	A0A2H4X242	Flamingopox_virus	1.4e-08	35.7

DBSCAN-SWA_8

99727 : 100924

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961342.1\|99727_100924_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	7.8e-58	34.0

DBSCAN-SWA_9

109657 : 110536

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961352.1\|109657_110536_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.2e-25	29.4

DBSCAN-SWA_10

126913 : 132562

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472574.1\|126913_127837_+	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	4.5e-21	30.6
WP_006961369.1\|127833_128934_+	ABC transporter permease	NA	NA	NA	NA
WP_006961370.1\|128971_129340_-	hypothetical protein	NA	NA	NA	NA
WP_006961371.1\|129419_130352_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_039952155.1\|130621_132562_+	response regulator	A0A1V0SGX0	Hokovirus	1.1e-56	34.8

DBSCAN-SWA_11

136311 : 136962

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961377.1\|136311_136962_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.1e-24	35.5

DBSCAN-SWA_12

140162 : 157071

Leptospira_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961380.1\|140162_140891_-	alpha/beta hydrolase	A0A2I7SAF7	Vibrio_phage	1.4e-14	30.3
WP_006961381.1\|141379_142030_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006961383.1\|142034_143351_+	hypothetical protein	NA	NA	NA	NA
WP_006961385.1\|143347_146449_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	6.3e-67	23.6
WP_006961387.1\|146497_147658_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_006961388.1\|147777_150903_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.0e-52	21.8
WP_006961389.1\|150913_152053_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_006961390.1\|152402_152876_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_006961391.1\|152916_153528_-	YitT family protein	NA	NA	NA	NA
WP_006961392.1\|153716_155078_-	diguanylate cyclase	G3MA91	Bacillus_virus	5.6e-20	36.0
WP_006961393.1\|155081_156053_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006961394.1\|156363_157071_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.0e-28	35.0

DBSCAN-SWA_13

162550 : 164242

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472573.1\|162550_164242_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.8e-28	30.8

DBSCAN-SWA_14

170890 : 171940

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961408.1\|170890_171940_+	NAD(P)/FAD-dependent oxidoreductase	A0A2H4J2Q2	uncultured_Caudovirales_phage	7.5e-57	44.3

DBSCAN-SWA_15

175979 : 176861

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961413.1\|175979_176861_-	queuosine precursor transporter	A0A2H4J2N7	uncultured_Caudovirales_phage	2.0e-50	40.6

DBSCAN-SWA_16

188130 : 189594

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961423.1\|188130_189594_-	deoxyribodipyrimidine photo-lyase	F2Y1V1	Organic_Lake_phycodnavirus	2.0e-31	25.5

DBSCAN-SWA_17

197311 : 198904

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961431.1\|197311_198904_+	bacteriohemerythrin	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-17	25.8

DBSCAN-SWA_18

202544 : 206448

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952160.1\|202544_204455_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-19	35.1
WP_006961438.1\|204828_206448_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-27	31.6

DBSCAN-SWA_19

214571 : 219269

Aeromonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961444.1\|214571_215867_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	6.6e-103	52.3
WP_006961445.1\|215904_216285_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_040121887.1\|216404_219269_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.5e-272	51.6

DBSCAN-SWA_20

224815 : 226636

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961451.1\|224815_226636_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.5e-65	32.1

DBSCAN-SWA_21

240838 : 242587

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961476.1\|240838_242587_+	ABC-F family ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	1.4e-36	27.0

DBSCAN-SWA_22

245617 : 247327

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961481.1\|245617_247327_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.9e-20	37.2

DBSCAN-SWA_23

250421 : 254613

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961486.1\|250421_251675_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2L1IVP0	Streptomyces_phage	5.0e-15	43.1
WP_006961487.1\|251892_252192_-	isoamylase early set domain-containing protein	NA	NA	NA	NA
WP_006961488.1\|252292_252910_-	hypothetical protein	NA	NA	NA	NA
WP_039952169.1\|252979_253387_+	GFA family protein	NA	NA	NA	NA
WP_006961490.1\|253468_253771_+	hypothetical protein	NA	NA	NA	NA
WP_006961491.1\|253824_254613_+	carbon-nitrogen hydrolase family protein	A7IVZ1	Paramecium_bursaria_Chlorella_virus	2.0e-14	28.4

DBSCAN-SWA_24

259171 : 261361

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472568.1\|259171_261361_-	ammonium transporter	W8CYF6	Bacillus_phage	2.5e-09	25.5

DBSCAN-SWA_25

270493 : 272645

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961503.1\|270493_271369_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.3e-14	25.2
WP_006961504.1\|271526_272645_+	histidinol-phosphate transaminase	A0A1X7QHI1	Faustovirus	1.4e-13	25.0

DBSCAN-SWA_26

276090 : 278959

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961510.1\|276090_277635_-	cryptochrome/photolyase family protein	A0A1V0SE91	Indivirus	3.2e-48	32.1
WP_006961511.1\|277636_278959_-	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	7.1e-28	33.0

DBSCAN-SWA_27

293281 : 300038

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961524.1\|293281_294241_+	apolipoprotein N-acyltransferase	M1H5W0	Paramecium_bursaria_Chlorella_virus	2.6e-11	23.6
WP_006961525.1\|294310_295684_-	YjiH family protein	NA	NA	NA	NA
WP_039952175.1\|295977_296949_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006961527.1\|296948_300038_-	efflux RND transporter permease subunit	S5VL66	Leptospira_phage	9.4e-31	20.2

DBSCAN-SWA_28

303683 : 304361

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961534.1\|303683_304361_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.5e-29	35.5

DBSCAN-SWA_29

322216 : 323647

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961571.1\|322216_323647_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-06	79.5

DBSCAN-SWA_30

328726 : 330418

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961577.1\|328726_330418_+	energy-coupling factor ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.1e-20	34.6

DBSCAN-SWA_31

337295 : 345971

Pseudomonas_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961584.1\|337295_338426_+	GGDEF domain-containing protein	A0A2K8I9Y5	Pseudomonas_phage	1.6e-07	39.8
WP_006961585.1\|338527_339277_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.5e-14	29.4
WP_006961586.1\|339334_340198_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_006961587.1\|340219_341152_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_006961588.1\|341247_342069_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	2.1e-06	28.5
WP_039952180.1\|342443_344087_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	6.1e-13	31.9
WP_006961590.1\|344191_344911_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.7e-07	33.6
WP_152472563.1\|345065_345971_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.3e-08	33.8

DBSCAN-SWA_32

360118 : 361528

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961607.1\|360118_361528_-	type II and III secretion system protein family protein	R9TEZ5	Vibrio_phage	5.3e-13	27.1

DBSCAN-SWA_33

376904 : 380500

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961620.1\|376904_378128_+	glycine betaine/L-proline ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.0e-25	39.1
WP_006961621.1\|378362_379322_+	hypothetical protein	NA	NA	NA	NA
WP_006961622.1\|379546_380500_+	alpha/beta hydrolase	A0A167RJ59	Powai_lake_megavirus	6.9e-33	35.9

DBSCAN-SWA_34

387871 : 388351

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961631.1\|387871_388351_-	nucleoside deaminase	S4VYT2	Pandoravirus	8.0e-14	46.5

DBSCAN-SWA_35

391751 : 396626

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961648.1\|391751_392129_-	ectoine synthase	A0A068F3J9	Mycobacterium_phage	1.1e-13	38.2
WP_006961650.1\|392179_392434_-	acyl carrier protein	NA	NA	NA	NA
WP_006961652.1\|392443_393916_-	AMP-binding protein	NA	NA	NA	NA
WP_006961654.1\|394315_394741_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_006961656.1\|395033_396626_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	4.4e-24	26.1

DBSCAN-SWA_36

407947 : 408715

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961666.1\|407947_408715_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.8e-19	27.8

DBSCAN-SWA_37

423017 : 425626

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961693.1\|423017_423833_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.6e-06	34.5
WP_006961694.1\|424114_424813_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_006961697.1\|424936_425626_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.6e-15	32.1

DBSCAN-SWA_38

437475 : 438540

Edwardsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961712.1\|437475_438540_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B6VNZ7	Edwardsiella_phage	2.1e-75	44.4

DBSCAN-SWA_39

444514 : 462713

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961717.1\|444514_450664_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	2.6e-40	26.9
WP_154351822.1\|450719_462713_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	3.0e-64	23.1

DBSCAN-SWA_40

467676 : 475101

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952194.1\|467676_469365_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.1e-36	26.9
WP_006961753.1\|469357_471010_-	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_172974089.1\|471572_473099_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-29	38.5
WP_006961755.1\|473184_473865_-	DUF1826 domain-containing protein	NA	NA	NA	NA
WP_152472555.1\|474222_475101_-	6-carboxytetrahydropterin synthase	A0A0D4DAV2	Vibrio_phage	3.9e-14	28.4

DBSCAN-SWA_41

507391 : 509845

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961812.1\|507391_509845_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	6.8e-16	44.8

DBSCAN-SWA_42

518287 : 525765

Paramecium_bursaria_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961820.1\|518287_518926_-	CatB-related O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	4.2e-18	44.0
WP_006961821.1\|519147_519933_+	hypothetical protein	NA	NA	NA	NA
WP_006961822.1\|519971_520358_+	DUF393 domain-containing protein	NA	NA	NA	NA
WP_006961823.1\|520592_522254_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-20	38.1
WP_006961824.1\|522297_523215_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006961825.1\|523321_523840_+	cysteine hydrolase	NA	NA	NA	NA
WP_021455271.1\|524184_525765_+	S8 family peptidase	A0A2K9L5T6	Tupanvirus	7.4e-32	40.2

DBSCAN-SWA_43

534481 : 549353

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961838.1\|534481_534955_-	peroxiredoxin	M1I839	Pelagibacter_phage	5.5e-23	43.3
WP_006961840.1\|535343_536075_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_006961841.1\|536387_537833_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.4e-109	44.8
WP_006961842.1\|537825_540216_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	6.0e-211	48.7
WP_006961843.1\|540253_541105_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	2.4e-37	31.7
WP_006961844.1\|541135_542473_+	guanine deaminase	NA	NA	NA	NA
WP_006961845.1\|542669_543404_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_172974087.1\|543414_545481_-	response regulator	A0A1V0SGX0	Hokovirus	4.3e-40	27.0
WP_039952214.1\|545522_546023_-	hypothetical protein	NA	NA	NA	NA
WP_006961848.1\|546146_546599_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_006961849.1\|546721_547387_+	glutathione S-transferase	NA	NA	NA	NA
WP_006961850.1\|547430_549353_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.3e-18	35.4

DBSCAN-SWA_44

555018 : 556362

Moraxella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961859.1\|555018_556362_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	8.7e-66	36.9

DBSCAN-SWA_45

562504 : 564566

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961865.1\|562504_563185_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.7e-30	34.2
WP_006961866.1\|563162_564566_+	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	1.3e-11	29.0

DBSCAN-SWA_46

569643 : 570807

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472552.1\|569643_570807_-	AAA family ATPase	A0A077SLJ9	Escherichia_phage	2.0e-71	38.9

DBSCAN-SWA_47

574126 : 574726

Haemophilus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472610.1\|574126_574726_+	lytic enzyme	Q7Y5V0	Haemophilus_phage	1.8e-23	38.7

DBSCAN-SWA_48

594922 : 596458

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472541.1\|594922_596458_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-13	57.6

DBSCAN-SWA_49

605012 : 606561

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961914.1\|605012_605708_-	urea ABC transporter ATP-binding subunit UrtE	W6JKT0	Anomala_cuprea_entomopoxvirus	6.6e-17	31.2
WP_006961915.1\|605709_606561_-	urea ABC transporter ATP-binding protein UrtD	A0A2H4PQG7	Staphylococcus_phage	2.8e-17	27.5

DBSCAN-SWA_50

611745 : 613701

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039951919.1\|611745_613701_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	2.9e-163	46.3

DBSCAN-SWA_51

616757 : 620291

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031342638.1\|616757_617657_-	2-hydroxy-3-oxopropionate reductase	A0A077SLF7	Escherichia_phage	4.2e-24	29.3
WP_006959839.1\|617682_618459_-	hydroxypyruvate isomerase	NA	NA	NA	NA
WP_006959841.1\|618518_620291_-	glyoxylate carboligase	A9YVT5	Ostreococcus_tauri_virus	3.2e-23	23.0

DBSCAN-SWA_52

631364 : 633848

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959856.1\|631364_633848_-	EAL domain-containing protein	G3MA91	Bacillus_virus	4.9e-22	36.3

DBSCAN-SWA_53

640470 : 642704

Mollivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959866.1\|640470_641238_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	3.0e-10	28.0
WP_006959869.1\|641263_641920_+	cupin domain-containing protein	NA	NA	NA	NA
WP_006959871.1\|641972_642704_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.9e-24	30.0

DBSCAN-SWA_54

647176 : 648954

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959891.1\|647176_648025_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.4e-16	29.3
WP_152472535.1\|648021_648954_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.4e-14	33.0

DBSCAN-SWA_55

654242 : 662988

Enterobacteria_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959900.1\|654242_655460_+	AAA family ATPase	Q1MVJ3	Enterobacteria_phage	5.2e-33	27.7
WP_006959902.1\|655467_656439_+	ParB/RepB/Spo0J family partition protein	Q7Y3Y7	Yersinia_phage	1.1e-17	26.8
WP_006959904.1\|656547_658536_+\|tRNA	tRNA(Met) cytidine acetyltransferase	NA	NA	NA	NA
WP_152472532.1\|658648_661858_-	nitrate- and nitrite sensing domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.9e-08	28.3
WP_006959908.1\|662342_662636_+	STAS domain-containing protein	NA	NA	NA	NA
WP_006959910.1\|662628_662988_+	response regulator	W8CYM9	Bacillus_phage	3.8e-16	42.7

DBSCAN-SWA_56

666263 : 674789

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959913.1\|666263_668981_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.2e-09	54.5
WP_006959915.1\|668965_669820_+	protein-glutamate O-methyltransferase CheR	NA	NA	NA	NA
WP_006959917.1\|669828_670473_+	chemotaxis protein CheD	NA	NA	NA	NA
WP_006959919.1\|670472_671510_+	chemotaxis response regulator protein-glutamate methylesterase	NA	NA	NA	NA
WP_006959921.1\|671543_672713_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-11	43.1
WP_006959923.1\|672777_673077_+	STAS domain-containing protein	NA	NA	NA	NA
WP_021457794.1\|673094_674789_+	fused response regulator/phosphatase	W8CYM9	Bacillus_phage	8.3e-05	31.6

DBSCAN-SWA_57

683536 : 685379

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959941.1\|683536_684739_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.8e-25	28.8
WP_172974085.1\|684731_685379_-	recombinase family protein	A0A1B0VBM1	Salmonella_phage	3.2e-05	26.0

DBSCAN-SWA_58

697356 : 704551

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959965.1\|697356_698484_+	sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	3.0e-19	29.8
WP_006959966.1\|698546_698972_-	universal stress protein	NA	NA	NA	NA
WP_039952025.1\|699241_700633_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	1.3e-35	28.8
WP_006959968.1\|700910_702785_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_006959970.1\|702904_704551_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.2e-12	27.8

DBSCAN-SWA_59

709597 : 715942

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959980.1\|709597_710491_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.2e-07	41.2
WP_006959982.1\|710596_711427_-	HDOD domain-containing protein	NA	NA	NA	NA
WP_006959988.1\|711642_712146_+	lactoylglutathione lyase family protein	NA	NA	NA	NA
WP_039951847.1\|712204_713191_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_006959994.1\|713299_714103_+	2,5-didehydrogluconate reductase DkgB	A0A1V0SDE7	Indivirus	1.6e-38	33.8
WP_006959996.1\|714375_715206_+	bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase	NA	NA	NA	NA
WP_039951849.1\|715195_715942_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.0e-23	37.8

DBSCAN-SWA_60

729824 : 736255

Mycoplasma_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960026.1\|729824_730706_-	ABC transporter permease	Q6GZ01	Mycoplasma_phage	1.1e-05	23.1
WP_006960027.1\|730705_731572_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_006960028.1\|731568_732636_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-23	34.2
WP_006960029.1\|732891_734259_-	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	4.9e-32	27.5
WP_006960030.1\|734464_735139_+	DUF1868 domain-containing protein	NA	NA	NA	NA
WP_006960031.1\|735295_736255_+	sensor domain-containing diguanylate cyclase	A9J564	Pseudomonas_phage	5.3e-09	35.7

DBSCAN-SWA_61

740341 : 742960

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960037.1\|740341_741286_+	NADP-dependent oxidoreductase	A0A2K9L339	Tupanvirus	6.4e-07	24.7
WP_006960039.1\|741632_742496_+	hypothetical protein	NA	NA	NA	NA
WP_006960042.1\|742606_742960_+\|tRNA	tRNA-binding protein	A0A1V0SEZ7	Hokovirus	2.2e-05	36.1

DBSCAN-SWA_62

755765 : 757950

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960074.1\|755765_757265_-	HAMP domain-containing histidine kinase	Q8QNA2	Ectocarpus_siliculosus_virus	1.5e-05	28.1
WP_006960076.1\|757251_757950_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.1e-25	30.7

DBSCAN-SWA_63

761430 : 766106

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960085.1\|761430_764451_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.2e-49	22.5
WP_006960086.1\|764465_765260_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_039952028.1\|765422_766106_+	response regulator	W8CYM9	Bacillus_phage	1.3e-22	32.3

DBSCAN-SWA_64

770690 : 775080

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960091.1\|770690_772115_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	5.9e-20	24.9
WP_006960092.1\|772098_772770_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.6e-30	35.0
WP_006960093.1\|772879_773083_-	hypothetical protein	NA	NA	NA	NA
WP_039952035.1\|773236_774601_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_006960095.1\|774597_775080_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	2.0e-33	50.0

DBSCAN-SWA_65

780550 : 781483

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960101.1\|780550_781483_+	AraC family transcriptional regulator	D0R0F8	Streptococcus_phage	2.4e-06	22.4

DBSCAN-SWA_66

816671 : 817562

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960150.1\|816671_817562_-	N-acetylmuramidase family protein	K4I325	Salmonella_phage	2.1e-36	43.7

DBSCAN-SWA_67

823169 : 824644

Paramecium_bursaria_Chlorella_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960164.1\|823169_823874_+	glycerophosphoryl diester phosphodiesterase	M1HYZ1	Paramecium_bursaria_Chlorella_virus	5.5e-19	27.2
WP_006960166.1\|823882_824644_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	6.1e-16	27.9

DBSCAN-SWA_68

830975 : 831296

Rhodobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_019276990.1\|830975_831296_+	heavy metal-binding domain-containing protein	M4STD1	Rhodobacter_phage	3.0e-17	45.2

DBSCAN-SWA_69

839447 : 844163

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039951874.1\|839447_841976_+	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	1.1e-151	48.7
WP_006960198.1\|842048_844163_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.2e-32	26.5

DBSCAN-SWA_70

849146 : 854553

Vibrio_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960203.1\|849146_849860_-	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	4.5e-37	40.1
WP_006960204.1\|850202_852032_-	SUMF1/EgtB/PvdO family nonheme iron enzyme	A0A7H6	Microcystis_virus	4.3e-15	27.2
WP_006960205.1\|852180_853290_-	PEGA domain-containing protein	NA	NA	NA	NA
WP_006960206.1\|853737_854553_+	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	6.1e-06	31.8

DBSCAN-SWA_71

862009 : 869396

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960213.1\|862009_863863_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	7.4e-31	24.6
WP_006960214.1\|864167_865145_+	amidinotransferase	NA	NA	NA	NA
WP_006960215.1\|865262_866153_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	9.3e-16	39.5
WP_006960216.1\|866192_867167_-	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_006960217.1\|867222_868074_-	3-keto-5-aminohexanoate cleavage protein	NA	NA	NA	NA
WP_006960218.1\|868064_869396_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	5.9e-22	25.5

DBSCAN-SWA_72

874946 : 876527

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960224.1\|874946_876527_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-15	39.6

DBSCAN-SWA_73

881667 : 886786

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960229.1\|881667_882453_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	7.4e-17	36.4
WP_006960230.1\|882457_883873_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	5.4e-58	30.4
WP_039951882.1\|883874_884786_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_006960232.1\|884849_885098_-	membrane protein	NA	NA	NA	NA
WP_031343167.1\|885442_886786_+	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	3.4e-38	28.7

DBSCAN-SWA_74

890134 : 891460

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960235.1\|890134_891460_+	sphingomyelin phosphodiesterase	A0A1P8L6H7	Staphylococcus_phage	2.2e-29	33.5

DBSCAN-SWA_75

912691 : 916470

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960244.1\|912691_914479_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	8.2e-120	39.7
WP_006960245.1\|914475_915471_-	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-22	35.7
WP_006960246.1\|915480_916470_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.1e-12	25.0

DBSCAN-SWA_76

929183 : 930305

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960261.1\|929183_930305_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.2e-29	35.6

DBSCAN-SWA_77

961676 : 968241

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960319.1\|961676_962552_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.2e-11	25.2
WP_006960321.1\|962560_963121_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_006960323.1\|963212_963743_+	dihydrofolate reductase	NA	NA	NA	NA
WP_006960325.1\|963948_965103_+	histidine decarboxylase	A0A2P0VP20	Tetraselmis_virus	3.0e-59	36.2
WP_006960328.1\|965145_965469_-	hypothetical protein	NA	NA	NA	NA
WP_006960329.1\|965626_965878_+	hypothetical protein	NA	NA	NA	NA
WP_006960331.1\|965974_967444_+	winged helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_006960333.1\|967500_968241_-	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.2e-32	37.0

DBSCAN-SWA_78

976126 : 979208

Stx2-converting_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960350.1\|976126_977311_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.5e-74	40.7
WP_006960352.1\|977310_978528_+	MFS transporter	NA	NA	NA	NA
WP_006960353.1\|978572_979208_+	type B chloramphenicol O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	9.9e-28	40.3

DBSCAN-SWA_79

992799 : 995172

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960378.1\|992799_995172_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.3e-170	37.5

DBSCAN-SWA_80

998650 : 1003536

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960384.1\|998650_1000360_-	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	4.3e-86	35.8
WP_006960385.1\|1000717_1001872_+	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_006960386.1\|1001868_1003536_+	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.4e-11	35.5

DBSCAN-SWA_81

1011141 : 1016296

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960397.1\|1011141_1011861_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-29	36.5
WP_006960398.1\|1012168_1013221_+	3-deoxy-7-phosphoheptulonate synthase AroG	A0A0B6VT43	Edwardsiella_phage	4.7e-83	48.9
WP_039951910.1\|1013336_1013663_+	hypothetical protein	NA	NA	NA	NA
WP_006960400.1\|1013709_1015767_-	alpha-amylase	NA	NA	NA	NA
WP_172855162.1\|1015897_1016296_-	helix-turn-helix transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	2.4e-08	45.7

DBSCAN-SWA_82

1035008 : 1037386

Megavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960408.1\|1035008_1036127_+	UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)	L7Y4I8	Megavirus	6.6e-27	28.8
WP_006960409.1\|1036144_1037386_+	UDP-N-acetyl-D-mannosamine dehydrogenase	M1HYW7	Paramecium_bursaria_Chlorella_virus	2.0e-24	26.0

DBSCAN-SWA_83

1041238 : 1041739

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960413.1\|1041238_1041739_+	serine acetyltransferase	A0A1W6JNZ1	Staphylococcus_phage	4.2e-05	26.0

DBSCAN-SWA_84

1047287 : 1048502

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960419.1\|1047287_1048502_-	right-handed parallel beta-helix repeat-containing protein	A0A240EWW2	Vibrio_phage	4.5e-05	27.1

DBSCAN-SWA_85

1051858 : 1062065

Emiliania_huxleyi_virus(40.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960421.1\|1051858_1052854_+\|protease	trypsin-like serine protease	V5LS29	Emiliania_huxleyi_virus	4.8e-13	28.5
WP_006960422.1\|1052921_1053911_+\|protease	trypsin-like serine protease	V5LP39	Emiliania_huxleyi_virus	2.1e-08	26.5
WP_031342955.1\|1054088_1054757_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_006960425.1\|1054808_1055636_-	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	8.8e-61	49.1
WP_006960427.1\|1055746_1056259_+	nicotinate-nicotinamide nucleotide adenylyltransferase	NA	NA	NA	NA
WP_006960429.1\|1056289_1056778_+	hypothetical protein	NA	NA	NA	NA
WP_006960431.1\|1056812_1058672_-	phosphodiesterase	A0A127AWB9	Bacillus_phage	4.2e-10	29.9
WP_006960433.1\|1058783_1059677_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006960436.1\|1059790_1060969_+	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_152472519.1\|1061032_1061386_+	hypothetical protein	NA	NA	NA	NA
WP_006960438.1\|1061441_1062065_-	glutaredoxin	A0A1W5PTL2	Pseudoalteromonas_phage	1.6e-09	43.7

DBSCAN-SWA_86

1073587 : 1077812

Lactococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960450.1\|1073587_1073797_-	cold-shock protein	Q9AZD3	Lactococcus_phage	3.4e-17	70.0
WP_006960451.1\|1074176_1074389_+	ribosome alternative rescue factor ArfA	NA	NA	NA	NA
WP_152472518.1\|1074436_1075600_-	threonine/serine exporter family protein	NA	NA	NA	NA
WP_006960453.1\|1076070_1076433_+	hypothetical protein	NA	NA	NA	NA
WP_021457197.1\|1076645_1077812_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.5e-85	45.2

DBSCAN-SWA_87

1084411 : 1085095

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472513.1\|1084411_1085095_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.9e-37	41.7

DBSCAN-SWA_88

1088350 : 1090184

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960467.1\|1088350_1089409_+	histidine kinase	Q9EYF3	Enterobacteria_phage	1.0e-16	31.7
WP_006960468.1\|1089398_1090184_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	5.7e-09	20.8

DBSCAN-SWA_89

1102287 : 1103918

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960479.1\|1102287_1103136_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-16	32.7
WP_006960480.1\|1103156_1103918_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.7e-14	27.6

DBSCAN-SWA_90

1107078 : 1121825

Tupanvirus(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960482.1\|1107078_1110129_+	non-ribosomal peptide synthetase	A0A2K9L3I8	Tupanvirus	1.0e-66	24.9
WP_154351831.1\|1110196_1111684_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.9e-70	35.8
WP_019276642.1\|1111702_1111978_+	acyl carrier protein	NA	NA	NA	NA
WP_152472506.1\|1112117_1117646_+	acyltransferase domain-containing protein	D0R7J2	Paenibacillus_phage	3.2e-53	38.7
WP_152472505.1\|1117739_1121825_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	2.5e-79	24.0

DBSCAN-SWA_91

1127237 : 1133941

Bacillus_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960491.1\|1127237_1127894_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-28	33.6
WP_152472501.1\|1127895_1129335_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	9.4e-26	32.9
WP_006960494.1\|1129542_1129734_+	hypothetical protein	NA	NA	NA	NA
WP_152472500.1\|1129776_1131588_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.7e-20	40.2
WP_006960498.1\|1131580_1132750_-	substrate-binding protein	NA	NA	NA	NA
WP_006960499.1\|1132869_1133598_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	9.7e-11	30.8
WP_019276654.1\|1133632_1133941_-	helix-turn-helix transcriptional regulator	Q0H244	Geobacillus_phage	3.0e-06	38.3

DBSCAN-SWA_92

1151108 : 1153313

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040121359.1\|1151108_1153313_-	polysaccharide biosynthesis tyrosine autokinase	A0A1X9I5D6	Streptococcus_phage	1.7e-18	31.7

DBSCAN-SWA_93

1162076 : 1169983

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472489.1\|1162076_1163387_-	AarF/ABC1/UbiB kinase family protein	E5EQ95	Micromonas_sp._RCC1109_virus	1.1e-15	28.1
WP_064486068.1\|1163557_1163839_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_039951941.1\|1164188_1164476_+	hypothetical protein	NA	NA	NA	NA
WP_006960560.1\|1164462_1165629_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-10	28.0
WP_152472488.1\|1165925_1166813_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_152472487.1\|1166903_1167815_+	EamA family transporter	NA	NA	NA	NA
WP_152472486.1\|1167819_1168419_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A1V0SJA2	Klosneuvirus	1.4e-20	33.0
WP_039952048.1\|1168609_1169983_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	8.4e-16	30.9

DBSCAN-SWA_94

1174305 : 1175799

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472485.1\|1174305_1175799_+	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.6e-28	25.8

DBSCAN-SWA_95

1183720 : 1184548

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_172974078.1\|1183720_1184548_-	ABC transporter ATP-binding protein	A0A1V0SGN0	Hokovirus	6.9e-13	30.7

DBSCAN-SWA_96

1188100 : 1192789

Infectious_spleen_and_kidney_necrosis_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_040121373.1\|1188100_1188628_-	O-acetyl-ADP-ribose deacetylase	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	1.5e-26	48.2
WP_152472478.1\|1188627_1189605_-	D-2-hydroxyacid dehydrogenase family protein	A7ITA6	Paramecium_bursaria_Chlorella_virus	1.1e-17	27.0
WP_152472477.1\|1189673_1190081_-	VOC family protein	NA	NA	NA	NA
WP_152472476.1\|1190099_1190696_-	LysE family transporter	NA	NA	NA	NA
WP_019276195.1\|1190704_1191253_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.2e-21	35.2
WP_152472475.1\|1191340_1192789_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	8.3e-22	28.2

DBSCAN-SWA_97

1195848 : 1199610

Ostreococcus_tauri_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960596.1\|1195848_1198137_+	ammonium transporter	H8ZJB2	Ostreococcus_tauri_virus	2.4e-47	32.0
WP_039952055.1\|1198260_1199610_+	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	1.2e-75	36.2

DBSCAN-SWA_98

1204124 : 1209631

Enterobacteria_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960602.1\|1204124_1205630_+	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	2.4e-16	26.3
WP_006960603.1\|1205626_1206610_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_006960604.1\|1206668_1207547_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	1.5e-05	23.0
WP_006960605.1\|1207683_1208604_+	ribokinase	NA	NA	NA	NA
WP_006960606.1\|1208626_1209631_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	1.8e-36	30.4

DBSCAN-SWA_99

1214438 : 1227186

Diachasmimorpha_longicaudata_entomopoxvirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960610.1\|1214438_1216364_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.5e-52	32.5
WP_152472606.1\|1216706_1217831_+	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_152472472.1\|1218071_1220075_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	5.9e-26	23.9
WP_021455390.1\|1220147_1220501_-	DUF3024 domain-containing protein	NA	NA	NA	NA
WP_152472471.1\|1220639_1221458_+	phosphate ABC transporter substrate-binding protein PstS family protein	A0A222YW41	Synechococcus_phage	4.3e-07	23.2
WP_006960615.1\|1221508_1222201_-	MaoC family dehydratase	NA	NA	NA	NA
WP_152472470.1\|1222715_1223969_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	1.2e-16	46.5
WP_152472469.1\|1224090_1224978_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152472468.1\|1225167_1226364_+	MFS transporter	NA	NA	NA	NA
WP_152472467.1\|1226403_1227186_-	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	3.1e-15	26.2

DBSCAN-SWA_100

1234304 : 1235426

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960640.1\|1234304_1235426_-	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	2.1e-25	33.3

DBSCAN-SWA_101

1249284 : 1254086

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960655.1\|1249284_1251933_+	response regulator	A0A1V0SGX0	Hokovirus	1.8e-46	29.7
WP_006960656.1\|1251915_1252368_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	3.6e-24	41.0
WP_006960657.1\|1253321_1254086_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	5.9e-35	39.7

DBSCAN-SWA_102

1272538 : 1273099

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472460.1\|1272538_1273099_+	sugar O-acetyltransferase	M1HKK6	Paramecium_bursaria_Chlorella_virus	7.7e-08	33.9

DBSCAN-SWA_103

1282062 : 1283979

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472457.1\|1282062_1283979_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.6e-26	35.7

DBSCAN-SWA_104

1289772 : 1290456

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_099608527.1\|1289772_1290456_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.7e-21	31.2

DBSCAN-SWA_105

1302525 : 1304753

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960704.1\|1302525_1303722_+	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	1.0e-41	30.1
WP_006960706.1\|1303721_1304753_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	7.0e-23	98.1

DBSCAN-SWA_106

1309979 : 1311188

Musca_hytrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960713.1\|1309979_1311188_+	NupC/NupG family nucleoside CNT transporter	B2YG43	Musca_hytrovirus	5.5e-27	28.1

DBSCAN-SWA_107

1316570 : 1329248

Tupanvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472446.1\|1316570_1319321_+	insulinase family protein	A0A2K9LA15	Tupanvirus	2.7e-13	26.0
WP_006960722.1\|1319351_1320053_-	response regulator	NA	NA	NA	NA
WP_006960723.1\|1320284_1320992_-	response regulator	NA	NA	NA	NA
WP_006960724.1\|1320984_1324296_-	response regulator	A0A1V0SGX0	Hokovirus	3.6e-44	27.8
WP_006960725.1\|1324463_1325357_-	cation diffusion facilitator family transporter	NA	NA	NA	NA
WP_006960726.1\|1325586_1326465_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006960727.1\|1326615_1327194_+	methyltransferase	NA	NA	NA	NA
WP_006960728.1\|1327247_1329248_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.7e-18	24.2

DBSCAN-SWA_108

1338512 : 1339415

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960740.1\|1338512_1339415_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	9.7e-37	36.3

DBSCAN-SWA_109

1350489 : 1354679

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960753.1\|1350489_1351176_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	3.3e-13	30.2
WP_006960754.1\|1351241_1351562_-	hypothetical protein	NA	NA	NA	NA
WP_152472444.1\|1351798_1352401_+	DUF1294 domain-containing protein	NA	NA	NA	NA
WP_006960756.1\|1352458_1353280_-	phosphonoacetaldehyde hydrolase	NA	NA	NA	NA
WP_006960757.1\|1353296_1354679_-	aspartate aminotransferase family protein	A0A249XSK4	Mycobacterium_phage	1.3e-08	26.9

DBSCAN-SWA_110

1357766 : 1358879

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960761.1\|1357766_1358879_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.9e-32	37.3

DBSCAN-SWA_111

1367568 : 1368462

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952067.1\|1367568_1368462_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.8e-14	24.1

DBSCAN-SWA_112

1373125 : 1379631

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960776.1\|1373125_1374142_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.0e-14	33.5
WP_006960778.1\|1374307_1375243_-	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.1e-22	26.5
WP_004745652.1\|1375437_1375716_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_006960780.1\|1376112_1376655_-	porin family protein	NA	NA	NA	NA
WP_006960781.1\|1377075_1379631_-	chitinase	A0A0H4BEQ6	Agrotis_segetum_granulosis_virus	2.8e-137	44.4

DBSCAN-SWA_113

1382998 : 1384663

Aphanizomenon_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960785.1\|1382998_1384663_+	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	1.3e-31	28.6

DBSCAN-SWA_114

1391851 : 1394218

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960794.1\|1391851_1393429_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	6.1e-26	27.2
WP_006960795.1\|1393498_1394218_-	3'-5' exonuclease	A0A0A8WJ41	Clostridium_phage	8.1e-10	27.6

DBSCAN-SWA_115

1398293 : 1399901

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960799.1\|1398293_1399901_-	EAL domain-containing protein	G3MA91	Bacillus_virus	1.4e-17	33.0

DBSCAN-SWA_116

1413434 : 1417665

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039951983.1\|1413434_1415111_+	LruC domain-containing protein	A0A1V0SGG5	Hokovirus	2.8e-13	26.9
WP_021455112.1\|1415120_1415594_+	hypothetical protein	NA	NA	NA	NA
WP_006960817.1\|1415620_1415878_-	hypothetical protein	NA	NA	NA	NA
WP_006960818.1\|1416007_1416646_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_006960819.1\|1416774_1417665_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.1e-11	24.6

DBSCAN-SWA_117

1425150 : 1428479

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960828.1\|1425150_1426056_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.9e-49	37.9
WP_006960829.1\|1426052_1426865_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_006960830.1\|1426874_1428479_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.5e-19	63.9

DBSCAN-SWA_118

1436227 : 1437130

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960838.1\|1436227_1437130_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.0e-22	28.6

DBSCAN-SWA_119

1442208 : 1443366

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960844.1\|1442208_1443366_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	5.1e-22	41.1

DBSCAN-SWA_120

1447364 : 1450683

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960848.1\|1447364_1449677_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.7e-19	27.7
WP_006960849.1\|1449714_1450683_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	6.8e-12	31.1

DBSCAN-SWA_121

1461905 : 1462862

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039951997.1\|1461905_1462862_+	glycosyl transferase family protein	A0A2H4JBY5	uncultured_Caudovirales_phage	3.9e-44	38.1

DBSCAN-SWA_122

1466215 : 1467058

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960864.1\|1466215_1467058_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-29	38.2

DBSCAN-SWA_123

1472691 : 1475604

Streptomyces_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065741878.1\|1472691_1473126_-	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	1.0e-12	40.4
WP_006960878.1\|1473301_1474390_+	ketoacyl-ACP synthase III	NA	NA	NA	NA
WP_006960880.1\|1474473_1475604_+	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	1.3e-09	26.2

DBSCAN-SWA_124

1478786 : 1480832

Feldmannia_irregularis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472602.1\|1478786_1480832_+	response regulator	Q6XM27	Feldmannia_irregularis_virus	6.9e-06	25.5

DBSCAN-SWA_125

1487596 : 1496287

Helicoverpa_armigera_granulovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960889.1\|1487596_1489081_-	lytic polysaccharide monooxygenase	A9YMV1	Helicoverpa_armigera_granulovirus	3.8e-22	32.6
WP_039952017.1\|1489617_1490085_+	GrpB family protein	NA	NA	NA	NA
WP_006960891.1\|1490252_1490705_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_006960892.1\|1490960_1491932_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.1e-13	36.2
WP_006960893.1\|1492123_1492822_-	hypothetical protein	NA	NA	NA	NA
WP_006960894.1\|1492948_1494478_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	5.7e-13	35.1
WP_006960895.1\|1494724_1496287_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	4.0e-30	45.5

DBSCAN-SWA_126

1508737 : 1509688

Cyanophage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960908.1\|1508737_1509688_-	transaldolase	A0A127KNC6	Cyanophage	4.3e-11	31.7

DBSCAN-SWA_127

1514487 : 1518890

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960920.1\|1514487_1515237_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	1.3e-05	30.8
WP_006960921.1\|1515248_1516484_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_006960922.1\|1516747_1517401_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	3.1e-53	52.4
WP_006960923.1\|1517513_1518890_+	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.9e-53	32.1

DBSCAN-SWA_128

1523518 : 1524781

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472435.1\|1523518_1524781_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.0e-56	34.4

DBSCAN-SWA_129

1527848 : 1528976

Diadromus_pulchellus_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960935.1\|1527848_1528976_-	fatty acid desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	7.4e-34	33.9

DBSCAN-SWA_130

1537371 : 1541803

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031342383.1\|1537371_1539135_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.9e-26	29.2
WP_152472433.1\|1539274_1539880_+	beta-phosphoglucomutase family hydrolase	M1I5S4	Acanthocystis_turfacea_Chlorella_virus	3.8e-13	25.4
WP_152472432.1\|1539916_1541221_-	inosine/guanosine kinase	NA	NA	NA	NA
WP_039952093.1\|1541332_1541803_-	CreA family protein	A0A2I7SAK3	Vibrio_phage	2.3e-21	39.1

DBSCAN-SWA_131

1547199 : 1553675

Oenococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472430.1\|1547199_1548399_+	starvation-sensing protein RspA	Q6A202	Oenococcus_phage	1.9e-40	28.5
WP_006960954.1\|1548412_1549126_-	GntR family transcriptional regulator	NA	NA	NA	NA
WP_006960955.1\|1549238_1549694_-	methylglyoxal synthase	NA	NA	NA	NA
WP_006960963.1\|1549716_1550718_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_006960964.1\|1550798_1553675_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	1.1e-54	34.7

DBSCAN-SWA_132

1557318 : 1560593

Enterobacteria_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960969.1\|1557318_1558536_-	glucose-1-phosphate adenylyltransferase	I7I009	Enterobacteria_phage	3.0e-09	24.4
WP_152472429.1\|1558691_1560593_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.4e-16	32.1

DBSCAN-SWA_133

1570031 : 1574026

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960985.1\|1570031_1571138_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	1.2e-23	35.4
WP_006960986.1\|1571177_1571615_-	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_006960988.1\|1571790_1572723_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.9e-15	34.6
WP_006960990.1\|1572790_1574026_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-10	28.2

DBSCAN-SWA_134

1579709 : 1580369

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006960996.1\|1579709_1580369_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-27	31.8

DBSCAN-SWA_135

1602580 : 1607320

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961019.1\|1602580_1604455_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.7e-23	30.6
WP_006961020.1\|1604723_1606619_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	3.2e-29	27.0
WP_006961021.1\|1606615_1607320_-	response regulator transcription factor	W8CYM9	Bacillus_phage	9.3e-19	30.2

DBSCAN-SWA_136

1610356 : 1616053

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472426.1\|1610356_1612834_-	cache domain-containing protein	G3MA91	Bacillus_virus	7.3e-18	33.2
WP_152472425.1\|1612909_1613701_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_064486338.1\|1613794_1614493_-	DUF1223 domain-containing protein	NA	NA	NA	NA
WP_006961027.1\|1614618_1614807_-	hypothetical protein	NA	NA	NA	NA
WP_152472424.1\|1615093_1616053_-	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	6.7e-36	31.8

DBSCAN-SWA_137

1625865 : 1626654

Feldmannia_irregularis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031342936.1\|1625865_1626654_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	9.8e-09	29.9

DBSCAN-SWA_138

1635761 : 1636778

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472419.1\|1635761_1636778_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	9.5e-81	43.4

DBSCAN-SWA_139

1643621 : 1644296

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961061.1\|1643621_1644296_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-25	35.9

DBSCAN-SWA_140

1650814 : 1654872

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961067.1\|1650814_1651654_-	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	8.0e-09	38.5
WP_006961069.1\|1651885_1652506_+	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_006961070.1\|1652469_1652790_-	divalent-cation tolerance protein CutA	NA	NA	NA	NA
WP_006961071.1\|1652805_1654872_-	DNA helicase IV	A7KV33	Bacillus_phage	3.7e-23	27.5

DBSCAN-SWA_141

1661794 : 1667134

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961078.1\|1661794_1664365_-	response regulator	A0A1V0SGX0	Hokovirus	7.3e-53	35.3
WP_006961079.1\|1664364_1665462_-	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_039952225.1\|1665610_1666750_-	conjugal transfer protein TraF	NA	NA	NA	NA
WP_019275432.1\|1666816_1667134_-	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	5.5e-11	50.7

DBSCAN-SWA_142

1670693 : 1671545

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961086.1\|1670693_1671545_-	aquaporin family protein	M1H9L8	Acanthocystis_turfacea_Chlorella_virus	4.1e-13	29.7

DBSCAN-SWA_143

1681834 : 1684530

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961097.1\|1681834_1682302_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	1.0e-50	62.9
WP_006961098.1\|1682409_1684530_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	4.2e-264	63.5

DBSCAN-SWA_144

1688930 : 1690700

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472411.1\|1688930_1690700_+	alkaline phosphatase	E3SII1	Synechococcus_phage	4.6e-06	31.2

DBSCAN-SWA_145

1703397 : 1707838

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961113.1\|1703397_1704138_-	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	5.0e-07	24.6
WP_099608294.1\|1704775_1707838_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.8e-50	22.4

DBSCAN-SWA_146

1710900 : 1711908

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152472405.1\|1710900_1711908_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	2.2e-21	26.7

DBSCAN-SWA_147

1716009 : 1719057

Herpes_simplex_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952109.1\|1716009_1719057_-	beta-galactosidase	L0N6M2	Herpes_simplex_virus	2.2e-306	50.6

DBSCAN-SWA_148

1736766 : 1738761

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961146.1\|1736766_1738761_-	protein kinase	A0A2I2L4T9	Orpheovirus	5.5e-08	27.1

DBSCAN-SWA_149

1742709 : 1748513

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961151.1\|1742709_1744788_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	2.3e-33	27.0
WP_006961152.1\|1744859_1745378_-	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_039952115.1\|1745840_1748513_+	type VI secretion system ATPase TssH	A0A1S6UBG5	Serratia_phage	1.8e-91	32.3

DBSCAN-SWA_150

1760170 : 1764943

Microcystis_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952230.1\|1760170_1761091_+	peptidoglycan DD-metalloendopeptidase family protein	A0A075BS18	Microcystis_phage	4.8e-15	45.5
WP_080555940.1\|1761369_1762731_-	diguanylate cyclase	G3MA91	Bacillus_virus	7.1e-15	31.4
WP_006961161.1\|1762942_1764943_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.0e-14	23.5

DBSCAN-SWA_151

1769079 : 1771163

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961165.1\|1769079_1769832_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-25	32.9
WP_006961166.1\|1769828_1771163_+	sensor histidine kinase	A0A2K9L5I4	Tupanvirus	8.5e-05	30.5

DBSCAN-SWA_152

1774208 : 1776116

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961169.1\|1774208_1776116_-	ammonium transporter	A0A127AWB9	Bacillus_phage	4.5e-15	34.7

DBSCAN-SWA_153

1780823 : 1783465

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961173.1\|1780823_1781579_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.1e-16	27.5
WP_039952118.1\|1781586_1782537_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_006961175.1\|1782526_1783465_-	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	2.9e-68	43.9

DBSCAN-SWA_154

1791783 : 1796121

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154351835.1\|1791783_1792929_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.5e-21	34.8
WP_006961186.1\|1793193_1794486_+	insulinase family protein	NA	NA	NA	NA
WP_006961187.1\|1794528_1796121_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	9.8e-24	34.9

DBSCAN-SWA_155

1801268 : 1804792

uncultured_Caudovirales_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961192.1\|1801268_1801787_-	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	3.3e-29	46.2
WP_006961193.1\|1801846_1803484_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.0e-31	31.6
WP_006961194.1\|1803793_1804792_+	2-hydroxyacid dehydrogenase	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	1.5e-70	44.5

DBSCAN-SWA_156

1807912 : 1809535

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039952126.1\|1807912_1809535_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-21	33.8

DBSCAN-SWA_157

1815748 : 1821263

Vibrio_phage(33.33%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961206.1\|1815748_1816366_+	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase	A0A2I7SAF7	Vibrio_phage	2.5e-15	31.4
WP_099607803.1\|1816514_1817702_-\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-24	32.7
WP_006961210.1\|1817704_1818547_-\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_006961211.1\|1818595_1819534_-\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_152472601.1\|1819562_1821263_-\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	2.7e-64	33.0

DBSCAN-SWA_158

1829702 : 1830749

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961226.1\|1829702_1830749_-	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	4.8e-96	53.0

DBSCAN-SWA_159

1834285 : 1842675

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006961235.1\|1834285_1835416_-	two-component system response regulator	W8CYM9	Bacillus_phage	1.7e-14	37.5
WP_152472600.1\|1835408_1838582_-	response regulator	A0A1V0SGX0	Hokovirus	1.1e-77	31.8
WP_006961239.1\|1838574_1839159_-	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_006961240.1\|1839160_1839583_-	ATP-binding protein	NA	NA	NA	NA
WP_006961241.1\|1839586_1839940_-	hypothetical protein	NA	NA	NA	NA
WP_006961242.1\|1839955_1840876_-	STAS domain-containing protein	NA	NA	NA	NA
WP_039952130.1\|1841118_1842675_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	1.2e-45	47.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046065

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

646822 : 656140

Faustovirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006959830.1\|646822_648037_+	IscS subfamily cysteine desulfurase	A0A1X7C038	Faustovirus	6.3e-31	29.9
WP_004412993.1\|648088_648472_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	1.2e-52	78.2
WP_006959829.1\|648539_648863_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.2e-24	50.5
WP_043006939.1\|648918_649434_+	co-chaperone HscB	NA	NA	NA	NA
WP_006959827.1\|649453_651307_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.0e-109	40.3
WP_006959826.1\|651320_651659_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_006959825.1\|651682_651877_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_154351787.1\|652039_653338_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	6.9e-36	34.4
WP_006959823.1\|653396_653825_+	nucleoside-diphosphate kinase	L7Y4C4	Megavirus	5.5e-22	42.9
WP_006959822.1\|654052_656140_+	elongation factor G	E4ZFJ7	Streptococcus_phage	2.0e-61	27.6

DBSCAN-SWA_2

1258200 : 1326837

Vibrio_phage(29.63%)

plate,tail,head,transposase,portal,integrase,capsid,terminase

attL 1248255:1248270|attR 1299610:1299625

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1248255:1248270	attL	NA	NA	NA	NA
WP_039951144.1\|1258200_1258647_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	1.3e-21	35.6
WP_006959068.1\|1258740_1259058_-	hypothetical protein	NA	NA	NA	NA
WP_006959067.1\|1259184_1259733_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_006959066.1\|1259792_1260566_-	peptidoglycan binding protein CsiV	NA	NA	NA	NA
WP_006959065.1\|1260620_1264082_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_006959064.1\|1264089_1264659_-	hypothetical protein	NA	NA	NA	NA
WP_006959063.1\|1264824_1266030_+	lipoprotein-releasing ABC transporter permease subunit LolC	NA	NA	NA	NA
WP_152472092.1\|1266022_1266709_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.7e-38	40.0
WP_006959061.1\|1266710_1267955_+	lipoprotein-releasing ABC transporter permease subunit LolE	NA	NA	NA	NA
WP_006959060.1\|1268063_1268594_-	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_006959059.1\|1268602_1270840_+	DNA internalization-related competence protein ComEC/Rec2	Q0H255	Geobacillus_phage	2.1e-11	27.1
WP_006959058.1\|1270871_1272620_+	lipid A ABC transporter ATP-binding protein/permease MsbA	W8CYL7	Bacillus_phage	1.4e-60	30.9
WP_006959057.1\|1272623_1273631_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_006075338.1\|1273611_1273791_+	Trm112 family protein	NA	NA	NA	NA
WP_006959056.1\|1273790_1274543_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_006959055.1\|1274573_1276112_-	SpoVR family protein	NA	NA	NA	NA
WP_006959054.1\|1276122_1277394_-	YeaH/YhbH family protein	A0A140HLI1	Bacillus_phage	9.9e-11	38.1
WP_006959053.1\|1277530_1279465_-	PrkA family serine protein kinase	NA	NA	NA	NA
WP_006959052.1\|1279803_1280571_+	MipA/OmpV family protein	NA	NA	NA	NA
WP_006959051.1\|1280635_1281136_-	YfbU family protein	NA	NA	NA	NA
WP_039951644.1\|1281261_1281927_-	energy-coupling factor ABC transporter permease	NA	NA	NA	NA
WP_029236135.1\|1281996_1282737_-	pyruvate formate lyase 1-activating protein	A0A2P0VNQ0	Tetraselmis_virus	8.8e-28	32.4
WP_154351796.1\|1282963_1284844_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_039951642.1\|1284840_1285842_-	lipid A deacylase LpxR family protein	NA	NA	NA	NA
WP_006959046.1\|1286012_1288289_-	formate C-acetyltransferase	A0A2P0VNR5	Tetraselmis_virus	3.5e-160	42.1
WP_006959045.1\|1288588_1290136_-	DUF3360 family protein	NA	NA	NA	NA
WP_006959044.1\|1290811_1291582_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.0e-14	27.1
WP_006959043.1\|1291651_1292422_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006959042.1\|1292546_1293287_+	ABC transporter permease	NA	NA	NA	NA
WP_006959041.1\|1293290_1293968_+	ABC transporter permease	NA	NA	NA	NA
WP_006959040.1\|1294027_1295710_-	aspartate:alanine antiporter	NA	NA	NA	NA
WP_006959039.1\|1295899_1296166_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	4.3e-25	70.5
WP_152472093.1\|1296696_1297725_-\|integrase	tyrosine-type recombinase/integrase	A0A160DJR8	Vibrio_phage	8.9e-95	51.1
WP_152472094.1\|1297924_1298167_-	DUF4177 domain-containing protein	A0A0A7NPW2	Enterobacteria_phage	2.7e-18	57.5
WP_152472095.1\|1298457_1299453_-	hypothetical protein	NA	NA	NA	NA
WP_152472096.1\|1299452_1300883_-	ATP-binding protein	NA	NA	NA	NA
1299610:1299625	attR	NA	NA	NA	NA
WP_152472097.1\|1300941_1302096_-	DNA (cytosine-5-)-methyltransferase	M1PSQ0	Streptococcus_phage	4.0e-35	29.4
WP_152472098.1\|1302318_1302945_-	helix-turn-helix domain-containing protein	A0A1D9C9M6	Salinivibrio_phage	2.2e-32	37.1
WP_019275486.1\|1303036_1303249_+	hypothetical protein	U3PFJ1	Vibrio_phage	8.7e-13	51.4
WP_021455699.1\|1303360_1303900_+	phage regulatory CII family protein	A0A2I7RNI1	Vibrio_phage	5.8e-53	59.2
WP_152472099.1\|1303928_1304141_+	hypothetical protein	A0A2I7RNH0	Vibrio_phage	1.2e-14	60.3
WP_152472100.1\|1304128_1304356_+	hypothetical protein	U3PIK2	Vibrio_phage	1.8e-16	52.8
WP_019275356.1\|1304352_1304586_+	hypothetical protein	NA	NA	NA	NA
WP_152472101.1\|1304910_1307022_+	hypothetical protein	A0A2I7RNF8	Vibrio_phage	2.9e-164	45.7
WP_152472102.1\|1307118_1307313_-	hypothetical protein	NA	NA	NA	NA
WP_031342464.1\|1307561_1307780_+	hypothetical protein	Q8HA64	Vibrio_phage	1.7e-16	63.9
WP_045985106.1\|1307805_1308048_+	ogr/Delta-like zinc finger family protein	F1BUT0	Erwinia_phage	4.5e-05	41.5
WP_095560569.1\|1308082_1308526_-	hypothetical protein	NA	NA	NA	NA
WP_152472103.1\|1309235_1310426_+	DNA circularization N-terminal domain-containing protein	NA	NA	NA	NA
WP_152472104.1\|1310422_1311361_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472105.1\|1311353_1311959_+\|plate	phage baseplate assembly protein	NA	NA	NA	NA
WP_152472106.1\|1311955_1312357_+	phage GP46 family protein	NA	NA	NA	NA
WP_152472107.1\|1312353_1313397_+\|plate	baseplate J/gp47 family protein	A0A192Y6E4	Salmonella_phage	8.6e-21	28.1
WP_152472108.1\|1313378_1313909_+	hypothetical protein	NA	NA	NA	NA
WP_152472109.1\|1314997_1315558_+	hypothetical protein	NA	NA	NA	NA
WP_152472110.1\|1315708_1315951_+	hypothetical protein	NA	NA	NA	NA
WP_152472111.1\|1315947_1316493_+	glycoside hydrolase family protein	E5G6N1	Salmonella_phage	6.5e-28	42.5
WP_152472112.1\|1316495_1317002_+	hypothetical protein	NA	NA	NA	NA
WP_152472113.1\|1317097_1317643_+	hypothetical protein	NA	NA	NA	NA
WP_152472114.1\|1317752_1318721_-\|portal	phage portal protein	A0A0M3LS06	Mannheimia_phage	8.2e-58	40.4
WP_152472115.1\|1318742_1320503_-\|terminase	terminase	E5E3X0	Burkholderia_phage	1.5e-110	41.5
WP_021455676.1\|1320637_1321453_+\|capsid	GPO family capsid scaffolding protein	Q94MZ5	Haemophilus_virus	1.0e-21	42.2
WP_043010143.1\|1321485_1322523_+\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	6.3e-64	40.5
WP_152472116.1\|1322631_1323081_+\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_152472117.1\|1323080_1323545_+\|tail	phage tail protein	NA	NA	NA	NA
WP_152472118.1\|1323541_1324051_+	phage virion morphogenesis protein	NA	NA	NA	NA
WP_152472119.1\|1324050_1324233_+	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_152472120.1\|1324229_1325363_+\|tail	phage tail sheath subtilisin-like domain-containing protein	A0A0C4UQS0	Shigella_phage	5.6e-50	40.1
WP_019274354.1\|1325366_1325732_+\|tail	phage tail tube protein	NA	NA	NA	NA
WP_152472121.1\|1325742_1326423_+	hypothetical protein	NA	NA	NA	NA
WP_152472122.1\|1326406_1326694_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_100207327.1\|1326732_1326837_+\|tail	GpE family phage tail protein	NA	NA	NA	NA

DBSCAN-SWA_3

2768186 : 2774871

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006957919.1\|2768186_2768657_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	4.9e-32	48.0
WP_006957920.1\|2768834_2769944_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.1e-65	39.6
WP_006957921.1\|2770024_2770675_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	7.7e-36	37.7
WP_006957922.1\|2770677_2771784_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	7.2e-42	32.6
WP_006957923.1\|2771791_2772241_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_006957924.1\|2772472_2773723_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.6e-99	47.9
WP_006957925.1\|2773737_2774871_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	9.9e-63	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046067_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046067_1

83063-83141

Orphan

Consensus_repeat	Method
TTTTTTAGTCCATTTGGTCTATA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046067_1

>merge|NZ_CP046067|1|83063-83141|CRISPRCasFinder
TTTTTTAGTCCATTTGGTCTATATAAGGTTAACCGCTCAAATTTTGTCTTGTCAATTTTTTTAGTCCATGTGGTCTATA

>NZ_CP046067|1|1|83063-83141|CRISPRCasFinder
TTTTTTAGTCCATTTGGTCTATA	TAAGGTTAACCGCTCAAATTTTGTCTTGTCAAT
TTTTTTAGTCCATGTGGTCTATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046067.1\|WP_006958523.1\|76891_77827_-\|bile-acid:sodium-symporter-family-protein	unknown	unknown	gnl\|CDD\|223462
NZ_CP046067.1\|WP_019274892.1\|86954_87707_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235816
NZ_CP046067.1\|WP_043011670.1\|74210_74888_-\|dienelactone-hydrolase-family-protein	unknown	unknown	gnl\|CDD\|223477
NZ_CP046067.1\|WP_040122417.1\|85935_86847_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP046067.1\|WP_040122413.1\|83221_83770_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP046067.1\|WP_052126668.1\|76164_76653_-\|MepB-family-protein	unknown	unknown	gnl\|CDD\|378077
NZ_CP046067.1\|WP_152472933.1\|71914_72859_-\|porphobilinogen-synthase	unknown	unknown	gnl\|CDD\|172020
NZ_CP046067.1\|WP_152472773.1\|87743_88643_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223656
NZ_CP046067.1\|WP_052126644.1\|74913_75777_-\|3-keto-5-aminohexanoate-cleavage-protein	unknown	unknown	gnl\|CDD\|377562
NZ_CP046067.1\|WP_040122415.1\|84342_84681_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	unknown	unknown	gnl\|CDD\|227028
NZ_CP046067.1\|WP_152472779.1\|78082_79057_-\|zinc-binding-dehydrogenase	unknown	unknown	gnl\|CDD\|223677
NZ_CP046067.1\|WP_080568975.1\|89926_90334_-\|GFA-family-protein	unknown	unknown	gnl\|CDD\|226314
NZ_CP046067.1\|WP_152472772.1\|88737_89460_+\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|379199
NZ_CP046067.1\|WP_039951375.1\|85418_85652_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP046067.1\|WP_152472931.1\|81500_82373_-\|NAD(P)H-binding-protein	unknown	unknown	gnl\|CDD\|187554
NZ_CP046067.1\|WP_152472777.1\|79521_80868_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|367293
NZ_CP046067.1\|WP_154741313.1\|89474_89789_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046067.1\|WP_040122414.1\|84026_84341_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP046067.1\|WP_152472780.1\|73015_74218_-\|3-oxoadipyl-CoA-thiolase	unknown	unknown	gnl\|CDD\|181624
NZ_CP046067.1\|WP_152472775.1\|82399_83017_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP046067.1\|WP_006958523.1\|76891_77827_-\|bile-acid:sodium-symporter-family-protein	gnl\|CDD\|223462	COG0385, COG0385, Predicted Na+-dependent transporter [General function prediction only].	5.34342e-78
NZ_CP046067.1\|WP_019274892.1\|86954_87707_+\|SDR-family-oxidoreductase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	5.08754e-60
NZ_CP046067.1\|WP_043011670.1\|74210_74888_-\|dienelactone-hydrolase-family-protein	gnl\|CDD\|223477	COG0400, COG0400, Predicted esterase [General function prediction only].	1.39909e-15
NZ_CP046067.1\|WP_040122417.1\|85935_86847_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.48204e-59
NZ_CP046067.1\|WP_040122413.1\|83221_83770_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	4.38666e-15
NZ_CP046067.1\|WP_152472931.1\|81500_82373_-\|NAD(P)H-binding-protein	gnl\|CDD\|187554	cd05243, SDR_a5, atypical (a) SDRs, subgroup 5. This subgroup contains atypical SDRs, some of which are identified as putative NAD(P)-dependent epimerases, one as a putative NAD-dependent epimerase/dehydratase. Atypical SDRs are distinct from classical SDRs. Members of this subgroup have a glycine-rich NAD(P)-binding motif that is very similar to the extended SDRs, GXXGXXG, and binds NADP. Generally, this subgroup has poor conservation of the active site tetrad; however, individual sequences do contain matches to the YXXXK active site motif, the upstream Ser, and there is a highly conserved Asp in place of the usual active site Asn throughout the subgroup. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Atypical SDRs include biliverdin IX beta reductase (BVR-B,aka flavin reductase), NMRa (a negative transcriptional regulator of various fungi), progesterone 5-beta-reductase like proteins, phenylcoumaran benzylic ether and pinoresinol-lariciresinol reductases, phenylpropene synthases, eugenol synthase, triphenylmethane reductase, isoflavone reductases, and others. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. In addition to the Rossmann fold core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.94364e-49
NZ_CP046067.1\|WP_152472933.1\|71914_72859_-\|porphobilinogen-synthase	gnl\|CDD\|172020	PRK13384, PRK13384, porphobilinogen synthase.	0
NZ_CP046067.1\|WP_152472773.1\|87743_88643_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|223656	COG0583, LysR, Transcriptional regulator [Transcription].	2.18613e-40
NZ_CP046067.1\|WP_052126668.1\|76164_76653_-\|MepB-family-protein	gnl\|CDD\|378077	pfam08877, MepB, MepB protein. MepB is a functionally uncharacterized protein in the mepRAB gene cluster of Staphylococcus aureus.	8.84089e-38
NZ_CP046067.1\|WP_039951375.1\|85418_85652_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	5.86062e-13
NZ_CP046067.1\|WP_152472779.1\|78082_79057_-\|zinc-binding-dehydrogenase	gnl\|CDD\|223677	COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only].	4.27395e-75
NZ_CP046067.1\|WP_052126644.1\|74913_75777_-\|3-keto-5-aminohexanoate-cleavage-protein	gnl\|CDD\|377562	pfam05853, BKACE, beta-keto acid cleavage enzyme. BKACE, beta-keto acid cleavage enzyme plays, a role in lysine degradation. In certain instances it catalyzes the conversion of 3-keto-5-aminohexanoate and acetyl-CoA into acetoacetate and 3-aminobutyryl-CoA. The family is found to have at least 14 slightly different potential new enzymatic activities, all of which can therefore be designated as beta-keto acid cleavage enzymes.	1.47357e-118
NZ_CP046067.1\|WP_152472772.1\|88737_89460_+\|NAD(P)H-binding-protein	gnl\|CDD\|379199	pfam13460, NAD_binding_10, NAD(P)H-binding.	2.63106e-21
NZ_CP046067.1\|WP_040122415.1\|84342_84681_-\|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin	gnl\|CDD\|227028	COG4683, COG4683, Uncharacterized protein conserved in bacteria [Function unknown].	2.18624e-39
NZ_CP046067.1\|WP_080568975.1\|89926_90334_-\|GFA-family-protein	gnl\|CDD\|226314	COG3791, COG3791, Uncharacterized conserved protein [Function unknown].	4.58294e-27
NZ_CP046067.1\|WP_152472777.1\|79521_80868_-\|AAA-family-ATPase	gnl\|CDD\|367293	pfam03008, DUF234, Archaea bacterial proteins of unknown function.	5.93382e-15
NZ_CP046067.1\|WP_040122414.1\|84026_84341_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.56514e-10
NZ_CP046067.1\|WP_152472780.1\|73015_74218_-\|3-oxoadipyl-CoA-thiolase	gnl\|CDD\|181624	PRK09050, PRK09050, beta-ketoadipyl CoA thiolase; Validated.	0

>NZ_CP046067.1|WP_152472775.1|82399_83017_-|hypothetical-protein
MTNDQITLKEAPINWQCKGKFRFSTGYGATKAESAIANYAAFIAPVLLYVLVWKELDWSGSQIVVAAILTLDMIGGVLTNSLGSMKRYLHANQNLDVNWLGRLVGSKFLFPAIHFQLFLVPLCFDIVWSYAFFWYGMMMVSIVIVHFTPLYLQRPVALLIVMLSIIVAQIIPSPVGLEWLAPIFMIKLVLSHGVREEPYRPTLTE
>NZ_CP046067.1|WP_152472931.1|81500_82373_-|NAD(P)H-binding-protein
MTTSNKVLVVGATGYLGLYIVKQLQERGQDFVALARNKQKLLANGVHDSQIFEAQVTDPQQLEGICDGVDVVISCLGITRQQDGLKYMDIDYQANLNILLEAEKSGVEKFIYISAFNAPTYSNVRLLRAKERFASRLLDSEQLQPCVIRPNGFFSDLEAIYHMATKGRVYQFGASAMKLNPIHGEDLATFCLEAIPSNQKELDVGGPEILTTTEIAQLAFEAQCKNVRIVRLPDCLRRAILRLMNHLPEKWGGPAEFFLTVMGKDSIAPVYGEHKIRDHYVALFTAVNKP
>NZ_CP046067.1|WP_152472777.1|79521_80868_-|AAA-family-ATPase
MKKLYNRQRELNALQTVSEQIVDTKGQLSVMVGRRRVGKTRLLNEAFHQDNTPFLYLFISRKSESALVAEFAEIIHSELGVKFFQPQTLRDIIEFLLDYTKQKPMTIILDEFQDIDIVNPALFSDIQNLWDANKRDSMMHLVCCGSLYSMMTKIFKGKDEPLFNRDDRFFNIQPLQPSYLAEVMKDHDQFDAENMLRWWCLSGGIPKYLEWLTRFSAESDDRFEAVISEFSPLIKEGTHRLVEDFGSEHRIYFDILGAISKGNTSRARIENFLDMSVGVHLEKLDEVFDVITKLRPISSKENSRDIRYAISDPFLNFWFRFIHANKSAVEMENYEYIRRYIERDFTVYSGLELASLFKAILVESKQFGKIGGYWDAKGHNEIDIVAINDLDKTILIAEVKRQQKRYSEAKLIEKSHHLLKKLNLKGYDIEYRGFSLDNLVETMNEYQA
>NZ_CP046067.1|WP_152472779.1|78082_79057_-|zinc-binding-dehydrogenase
MKTLQVTKFGNPDVLAVNHIEKPRISNNQLLIKVIYSGVNLADTYIRKGAFPALPTPPFTLGMEGSGIIEEIGSNVSGYEQGQLVAFSASQSYAEYVVVDTTSSLEWEIAVPVALPPLTASSIGMSARTAMLLTQRLSNTSCRVLVHAAAGSVGSVLVQLLSAQNHDVIALVGSARKEEYVRSLGAAQVINYKQDDVQEVIKNAYPDGLDAIFNATGGHSIARDINLLAKNGHLIWYGFAESDHAPDIETALQNAFMKSIKLELFNGGIHSQAENISAIKSVERLIIDGKVDIPIHKVYSLEEGIKAHQDLESGDTIGKLILKL
>NZ_CP046067.1|WP_006958523.1|76891_77827_-|bile-acid:sodium-symporter-family-protein
MLRVIINAFPLWVVLGSVVAYLQPAIFTPLKPQIVPLLMLIMLSMGLTLTLDDFKRVTSSVKAVTAGLILQFSVMPLSALFVAHVFDMDMALTIGMVLVGSVAGGTASNVICYLAKGNVALSITMTAFSTLIGVVMTPFLVDALLGVNVDVPVGPMVLNLVKIVIIPITIGIALNHFFRRPVTAIAPVLPLVSMLSIVMAIAIIVALNHDKIAIVGLGVALAVILHNAMGLVLGYWVCRALKFDYVTCKTIAIEVGLQNSGLATALALKFFSPISALPAALFSIWHNLSGSILAHYWSRDKRKRSRDLSVS
>NZ_CP046067.1|WP_052126668.1|76164_76653_-|MepB-family-protein
MALDPYPQNSQYEALAFSIDGQQILYRKGHVTPDRPGHFLTIWKRSAGEGPDSKKTRPFEKPDLDYLFVEVHDHQTSKQGMFIFPLTVLLKKGVVRSEKAKGKMALRVFPPWTSSRGEVKSQVFSESAKRTQRWQCEYFVWMENNVITDVEKFAHLFGAPLN
>NZ_CP046067.1|WP_052126644.1|74913_75777_-|3-keto-5-aminohexanoate-cleavage-protein
MDKLIITAAVNGGITPRSKQPAIPHTPKEIADAVIQCSQAGASVAHIHARDDAGRPSYDQAVWREIIERIRERSDILLNLSTSGLNLPKNSPEEEAWNHLEYRPEIASFNCGSVNHGDKPFINSPALAKKLAQALKANQVMPEIEIYHSGVIHEAVTLQQQGYLGERLVFAFAMGIHGGVRPTCKDLLHLVDSLPTNSLWSAIGIGQAQLPLNTYSILLGGHVRTGLEDNIYYRKGELATSNAQLVDRVVRLSHELGRDVATVNEARALLGLSRSQPQTNPIAAATI
>NZ_CP046067.1|WP_043011670.1|74210_74888_-|dienelactone-hydrolase-family-protein
MLPLQTDIHPYTMCIEGAPLSDDNPVVILLHGRRQTADDMASLIDKLAIPEATYCLPRAPEATWYPRGFTRELDDNQPQLDQGLKVIDQILQALLSQGVNRQRIWLMGFSQGGCMAAEFVRRALQPLGGVIVFTGGLFGPQCPVAPVQKPVFEGMPLWLSGSHTDTWVPAKRITQTAAYFDQLGAHVHLEIAAERAHHVSQSEIEQARALITACYAPTHEEAAHV
>NZ_CP046067.1|WP_152472780.1|73015_74218_-|3-oxoadipyl-CoA-thiolase
MSNAYLCDFVRTPIGRYAGALSSIRADDLAAIPLKALTERHTTVDWRRVDDVILGCANQAGEDNRNVARMSLLLAGLDTDVPGSTVNRLCASGMEAVSIAARTIKTGEANLIIAGGVESMSRAPYVMGKPDAPFARNTELYDTTMGWRFINASLESQYGACSMPETAENLAVKFGISRHDQDVFARWSQTKYVAAQERGFFRHEIVPVEVARRRQDPLVVDTDEHPRLSSLETLAKLKPVVQPQGTVTAGNASGINDGAAALLLASESALGDHQLVPKARIVATACAGVEPSLMGFGPTPAIKKVLELTRLSLDQMDVIELNEAFASQVLSVVNHLGIVPDDPRLNPNGGAIALGHPLGMSGARVIGTAMNQLTLQQGRYALCSLCVGVGQGMAMIIERV
>NZ_CP046067.1|WP_152472933.1|71914_72859_-|porphobilinogen-synthase
MRTMVREHDVQLHDLIYPLFVEEALASPVPIAGLPGLTRIPESQLTDEIRALDALGIRAVMPFGVSHHKDDIGSDTWHQDGLLSRMIRTIKSTCPHMLVIPDICFCEYTTHGHCGALSKHDVDNDQTVANLVKQCINAAEAGADMLAPSSMMDGQVGAIRRGLDAAGFTKVAILAHSAKFASAFYGPFRQAVECELEGDRRTYQLDYANGRQALSEALLDEQEGADILMVKPGTPYLDVLTQLRTQTRLPLAAYQVSGEYAAIKCSAEMGIVNEQEAVLETLTGFKRAGADLIVTYFAKQFAIWQQADTMPIVE
>NZ_CP046067.1|WP_040122413.1|83221_83770_+|TetR/AcrR-family-transcriptional-regulator
MPKIVDREAYRNELIAKAVDIFSEHGLNGLGMRGIAGALGVSKTALYHYFSSKEELFTACTEFVLEPHSLYGIDSTSPLPEDKEQAIVQLIKTLDSRFKGEMTVVLDYVKNRDSRDIANDELLKMADNQFLVELSKIVGREHANQAYALLLGGLMTRLLNGNQTKVEEIASWILQLSTRESS
>NZ_CP046067.1|WP_040122414.1|84026_84341_-|helix-turn-helix-transcriptional-regulator
MTSKTGTLAELDALMSPEALTKAKHRAKDILLGMQLAQLRESLGLTQSDVAKIMGVTQPTISSMESNGLNLKVETVERYIAACGGHHTTIQATLPGGERIEMVL
>NZ_CP046067.1|WP_040122415.1|84342_84681_-|type-II-toxin-antitoxin-system-RelE/ParE-family-toxin
MYEIKPREIFKEWFSGLDETDQIEVRACIDVLREYGPTLRRPRVGKINGSAHPNMKELVVQSQGNPIRIFFVFDPNRTGILLCGGDKSNQKRFYKEQIKIADKEYSDHLKGE
>NZ_CP046067.1|WP_039951375.1|85418_85652_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFRNGKNQTIRLPKDFEFDGVNELEIHKEGDVITLRPVRPDWLSFGNQEEANDDFMANREDGITDEGRFNFD
>NZ_CP046067.1|WP_040122417.1|85935_86847_-|LysR-family-transcriptional-regulator
MAFHKQLENLYLFHLVALSGSFQGAADKVGLPRSSVSKRIAKLEQTLNLRLLERSTRKLSLTQSGHELLKSTEPLQQVLHHTETLSEQVHARPQGKVRIGCSTLMAHRLLIPHIHALSDTYPDICFDFNLTDEVVDLIDNHVDIAIRIGHLPDSSLLARQIGEKTFGWYASPAYLAQNGAPESPESLLHHRCLVFKNKAVTLDNWVFVHPSGGVNAINVTPAMISDDARGLVQLATLGQGIIMVDPAFIDQELRSNELVPVLTDYTHPDKQPIHLVCLGKKGRSRAVTCVWEALSEHLLIAPK
>NZ_CP046067.1|WP_019274892.1|86954_87707_+|SDR-family-oxidoreductase
MSFQTILITGATSGIGFEAAKQYVKQGWRVVFTGRDQERIASATARLRDDAHSPDQILGLLCDNANAQHYPALVSDIRHNVGTLDAVILNAGVFHPRHFSETTQSELMTTMSVNFTGPAMLLQALLPVLNDPCSVVYVSSIVVERAFPTASSYSASKAAFEAYANVLNLELAPQGVRINYLRPGVTATEIQSKAGMSEHQIDELNASLANLPLGRMLEPTEMLSSLEFLTSSSSLALRGAHITVDGGYCL
>NZ_CP046067.1|WP_152472773.1|87743_88643_-|LysR-family-transcriptional-regulator
MNWTAISFDWNRTRAFLATAELGSLSAAAHSLNVTQPTLSRQVSALEHELGVALFERSAQKLTLTRSGIELLHIAREMGDVAHKFSMVASGQSEDLNGVVVLSVCQLDAMYRLPSILAKLRRVEPKLSIDLVVTNQVSDLKRRDADIALRSAQPTQPSLIAKKLGDERVSLYGTRAYLTPFIEAQSIEDVPELQIIGFGNNGPIMTQFSHHGWSLNEDNFKLSTDFQPAQLALCKQHLGVMYLPEDIAAQEPQLMRAPDGLFPTMQLPLWLVCHEELKTNRRVRRVFDLLAAELTILDE
>NZ_CP046067.1|WP_152472772.1|88737_89460_+|NAD(P)H-binding-protein
MAVLVLGATGATGRLVVRELLSRGDRVKVVVRALERVDRDLIACESLDIVVSNVLDLSEAQLMGHLRECEAVICCLGHNLTLNGIYGQPRKLVSDTIKRICQAAAQLKPSQPIKLVLMSTTGFQNRRRGEVVSWRHRMVIQLIRQLLPPHVDNEEAARYLQDQVGDTSPYLEWVAVRPDSLVDHPFKTEFSVHASPTCDPLFAPRKSSRINVAHFMVELVGSPQTWSRWKQDMPVLYNNP
>NZ_CP046067.1|WP_154741313.1|89474_89789_-|hypothetical-protein
MHGVMNTTKWNELWTAMCTLHPRPRWRTREVDSGYVSDWDRDWFYHFRASSFRTIEWVEITTDTPSQHQSVKTVLRKIHVPADELDSGFKIYGYIPDAKYVDYL
>NZ_CP046067.1|WP_080568975.1|89926_90334_-|GFA-family-protein
MYKGSCLCGSIQFELHGGITDPIYCHCSRCRKASGSAFATNGYVNTSELQLTDEKGTLTYYESSVGKRKYFCSTCGAPIYSSNSATPDKVRIRLGAIDSDITERPISHNFITSKGNWEELDTTLPRYEGHEPSRK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP046164	Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence	334587-334619	0	1.0
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP046067	Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence	83086-83118	0	1.0
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP009266	Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence	8877-8909	0	1.0
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP009620	Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence	73169-73201	0	1.0
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP045357	Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence	245568-245600	0	1.0
NZ_CP046067_1	1.1\|83086\|33\|NZ_CP046067\|CRISPRCasFinder	83086-83118	33	NZ_CP020455	Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence	139183-139215	1	0.97

1. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP046164 (Vibrio sp. THAF191c plasmid pTHAF191c_c, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

2. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP046067 (Vibrio sp. THAF191d plasmid pTHAF191d_c, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

3. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP009266 (Vibrio coralliilyticus strain OCN014 plasmid pOCN014, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

4. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP009620 (Vibrio coralliilyticus strain RE98 plasmid p319, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

5. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP045357 (Vibrio sp. THAF64 plasmid pTHAF64_b, complete sequence) position: , mismatch: 0, identity: 1.0

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taaggttaaccgctcaaattttgtcttgtcaat	Protospacer
*********************************

6. spacer 1.1|83086|33|NZ_CP046067|CRISPRCasFinder matches to NZ_CP020455 (Vibrio coralliilyticus strain SNUTY-1 plasmid pSNUTY1, complete sequence) position: , mismatch: 1, identity: 0.97

taaggttaaccgctcaaattttgtcttgtcaat	CRISPR spacer
taagattaaccgctcaaattttgtcttgtcaat	Protospacer
****.****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

278070 : 288292

Vibrio_phage(80.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_052131813.1\|278070_279420_-	replicative DNA helicase	A0A1B0VG30	Salmonella_phage	1.0e-135	56.5
WP_052131814.1\|279909_281034_-	cyclopropane fatty acyl phospholipid synthase	A0A2I2L5L3	Orpheovirus	3.1e-64	38.4
WP_040122553.1\|281274_281634_+	hypothetical protein	NA	NA	NA	NA
WP_152472654.1\|281808_282177_-	hypothetical protein	Q858Q3	Vibrio_phage	1.8e-45	76.3
WP_152472653.1\|282304_282529_+	hypothetical protein	NA	NA	NA	NA
WP_152472652.1\|282590_283781_+	replication initiation factor domain-containing protein	G8IRU5	Vibrio_phage	4.0e-155	66.6
WP_152472651.1\|283771_284086_+	hypothetical protein	NA	NA	NA	NA
WP_095562278.1\|284089_284314_+	hypothetical protein	R9TMT7	Vibrio_phage	6.4e-14	53.4
WP_152472650.1\|284349_284562_+	hypothetical protein	G8IRU8	Vibrio_phage	1.3e-05	45.7
WP_152472649.1\|284701_285997_+	hypothetical protein	G8IRU9	Vibrio_phage	6.1e-16	31.0
WP_095562275.1\|285998_286343_+	DUF2523 domain-containing protein	R9TRT6	Vibrio_phage	2.6e-30	55.8
WP_152472648.1\|286347_287709_+	toxin	Q64EV0	Vibrio_phage	2.4e-148	57.1
WP_152472647.1\|287718_287901_+	hypothetical protein	NA	NA	NA	NA
WP_172974092.1\|287934_288099_+	hypothetical protein	NA	NA	NA	NA
WP_019277002.1\|288100_288292_+	hypothetical protein	A0A2I7RE17	Vibrio_phage	1.3e-07	42.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP046068

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 72833

Escherichia_phage(56.76%)

tail,portal,plate,head

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152473052.1\|428_749_+\|plate	baseplate wedge protein 53	Q1MVH3	Enterobacteria_phage	6.1e-18	45.4
WP_152473053.1\|751_1903_+\|tail	phage tail protein	A0A222YXT1	Escherichia_phage	2.8e-73	49.1
WP_152473054.1\|1899_2517_+	hypothetical protein	A0A222YXU3	Escherichia_phage	5.3e-34	45.5
WP_152473055.1\|2513_2843_+	DUF4406 domain-containing protein	A0A222YYT7	Escherichia_phage	2.4e-25	62.9
WP_152473056.1\|2891_3437_+	hypothetical protein	A0A1C9LW11	Vibrio_phage	4.0e-09	32.3
WP_152473057.1\|3439_4207_+	hypothetical protein	NA	NA	NA	NA
WP_152473058.1\|4199_5171_+	hypothetical protein	A0A222YXZ0	Escherichia_phage	8.6e-31	26.3
WP_152473059.1\|5137_5950_+	hypothetical protein	R9TNN7	Vibrio_phage	2.3e-13	44.1
WP_152473060.1\|5949_6147_+	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	1.2e-11	62.5
WP_152473061.1\|6209_6563_+	hypothetical protein	NA	NA	NA	NA
WP_172974107.1\|6775_7315_+	N-acetylmuramoyl-L-alanine amidase	A0A2I7RXW8	Vibrio_phage	3.9e-25	38.2
WP_152473063.1\|7317_7641_+	hypothetical protein	NA	NA	NA	NA
WP_152473064.1\|7924_9607_+	hypothetical protein	A0A222YWC7	Escherichia_phage	4.7e-61	29.0
WP_152473065.1\|9657_10086_+	hypothetical protein	NA	NA	NA	NA
WP_152473066.1\|10072_11653_+	hypothetical protein	Q71TB2	Escherichia_phage	8.9e-110	42.1
WP_152473067.1\|11673_12354_+	hypothetical protein	A0A222YXT7	Escherichia_phage	4.6e-07	30.3
WP_152473068.1\|12363_12984_+	hypothetical protein	A0A222YY02	Escherichia_phage	5.9e-25	36.5
WP_152473069.1\|13000_13501_+\|plate	baseplate protein	NA	NA	NA	NA
WP_152473070.1\|13568_13904_-	HigA family addiction module antidote protein	A0A222YWD7	Escherichia_phage	2.7e-16	44.0
WP_152473071.1\|13976_14261_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A222YWE2	Escherichia_phage	6.0e-25	55.4
WP_152473095.1\|14773_15016_+	hypothetical protein	NA	NA	NA	NA
WP_152473072.1\|15016_15532_+	hypothetical protein	A0A222YY05	Escherichia_phage	7.0e-32	42.4
WP_152473073.1\|15531_16344_+	hypothetical protein	A0A222YZ63	Escherichia_phage	2.3e-45	34.8
WP_152473074.1\|16472_19334_+	hypothetical protein	A0A222YXR4	Escherichia_phage	2.2e-05	25.0
WP_152473075.1\|19338_19686_+	hypothetical protein	NA	NA	NA	NA
WP_152473076.1\|19682_21080_+	hypothetical protein	A0A1B0VAD6	Salmonella_phage	2.1e-70	34.7
WP_172974109.1\|24104_24563_+\|tail	tail fiber domain-containing protein	M4QML2	Micromonas_pusilla_virus	3.2e-12	45.2
WP_152473078.1\|24559_25855_+	hypothetical protein	A0A077SLH5	Escherichia_phage	2.5e-33	36.5
WP_152473079.1\|25903_26395_+	hypothetical protein	NA	NA	NA	NA
WP_152473080.1\|26396_28175_+\|tail	tail fiber protein	R9TIZ5	Vibrio_phage	3.6e-19	47.7
WP_152473081.1\|28174_28744_+	hypothetical protein	NA	NA	NA	NA
WP_152473082.1\|28746_29886_+	hypothetical protein	I6X2L6	Vibriophage	1.2e-15	60.6
WP_154351844.1\|29903_30059_+	hypothetical protein	NA	NA	NA	NA
WP_152473083.1\|30144_30471_+	hypothetical protein	NA	NA	NA	NA
WP_152473084.1\|30473_31337_+	hypothetical protein	NA	NA	NA	NA
WP_152473085.1\|31308_31965_+	hypothetical protein	NA	NA	NA	NA
WP_152473086.1\|31936_32689_+	hypothetical protein	NA	NA	NA	NA
WP_152473087.1\|32692_33727_+	radical SAM protein	NA	NA	NA	NA
WP_152473088.1\|33882_34206_+	hypothetical protein	Q37876	Escherichia_phage	4.1e-06	36.0
WP_152473089.1\|34202_34616_+	hypothetical protein	A0A077SK09	Escherichia_phage	1.3e-07	32.8
WP_152473090.1\|34682_35306_+	hypothetical protein	NA	NA	NA	NA
WP_152473091.1\|35302_40720_+	hypothetical protein	Q1MVM7	Enterobacteria_phage	2.8e-22	35.8
WP_152473092.1\|40768_41638_+	hypothetical protein	NA	NA	NA	NA
WP_152473093.1\|41894_43037_+	hypothetical protein	NA	NA	NA	NA
WP_152472942.1\|43033_43264_+	hypothetical protein	NA	NA	NA	NA
WP_172974102.1\|43263_45144_+	hypothetical protein	A0A222YY44	Escherichia_phage	8.9e-133	55.9
WP_152472944.1\|45206_45539_+	hypothetical protein	NA	NA	NA	NA
WP_152472946.1\|45845_46856_-	hypothetical protein	NA	NA	NA	NA
WP_152472948.1\|46858_48112_-	AAA family ATPase	NA	NA	NA	NA
WP_152472950.1\|48279_48507_-	hypothetical protein	NA	NA	NA	NA
WP_152472952.1\|48622_49057_-	hypothetical protein	NA	NA	NA	NA
WP_152472954.1\|49117_55852_-	Eco57I restriction-modification methylase domain-containing protein	A0A222YYH3	Escherichia_phage	1.3e-290	36.2
WP_152472955.1\|56260_57940_+\|portal	phage portal protein	Q71TR7	Escherichia_phage	1.1e-105	38.9
WP_152472957.1\|57942_58911_+\|head	head processing protein	A0A077SK31	Escherichia_phage	3.9e-52	39.3
WP_152472960.1\|58985_59336_-	hypothetical protein	NA	NA	NA	NA
WP_152472962.1\|59877_61023_+	hypothetical protein	NA	NA	NA	NA
WP_152472964.1\|61022_61316_+	hypothetical protein	NA	NA	NA	NA
WP_154351845.1\|61383_61536_+	hypothetical protein	A0A2I7QU96	Vibrio_phage	5.1e-07	54.2
WP_152472966.1\|61532_61778_+	hypothetical protein	NA	NA	NA	NA
WP_152472967.1\|61898_62135_-	hypothetical protein	NA	NA	NA	NA
WP_152472969.1\|62278_62707_+	hypothetical protein	NA	NA	NA	NA
WP_152472971.1\|62672_62978_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_152472973.1\|62967_63594_+	3'-5' exoribonuclease	R9TPV7	Vibrio_phage	1.1e-39	46.4
WP_152472974.1\|63593_64115_+	single-stranded DNA-binding protein	R9TR60	Vibrio_phage	1.7e-57	66.9
WP_152472976.1\|64118_64424_+	hypothetical protein	NA	NA	NA	NA
WP_152472978.1\|64463_65834_+	hypothetical protein	NA	NA	NA	NA
WP_152472980.1\|65845_66430_+	hypothetical protein	NA	NA	NA	NA
WP_172974103.1\|66467_67154_+	VRR-NUC domain-containing protein	Q71T85	Escherichia_phage	1.8e-19	42.9
WP_152472984.1\|67198_67885_+	hypothetical protein	NA	NA	NA	NA
WP_152472986.1\|67986_68268_+	hypothetical protein	NA	NA	NA	NA
WP_152472988.1\|68234_68582_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_172974104.1\|68571_68865_+	HU family DNA-binding protein	NA	NA	NA	NA
WP_152472992.1\|68854_69112_+	hypothetical protein	NA	NA	NA	NA
WP_172974105.1\|69089_69731_+	hypothetical protein	A0A2I7RNS2	Vibrio_phage	2.7e-49	48.5
WP_152472996.1\|70014_70644_+	hypothetical protein	NA	NA	NA	NA
WP_152472998.1\|70654_71101_+	hypothetical protein	NA	NA	NA	NA
WP_152473000.1\|71100_71445_+	hypothetical protein	A0A2I7R675	Vibrio_phage	9.5e-17	56.8
WP_152473002.1\|71641_71962_+	hypothetical protein	NA	NA	NA	NA
WP_152473004.1\|71972_72194_+	hypothetical protein	NA	NA	NA	NA
WP_152473006.1\|72374_72833_+	hypothetical protein	A0A1Q2U315	Vibrio_phage	1.0e-13	35.0

DBSCAN-SWA_2

75900 : 80832

Escherichia_phage(50.0%)

integrase,terminase

attL 69818:69832|attR 81585:81599

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
69818:69832	attL	NA	NA	NA	NA
WP_152473013.1\|75900_77397_+\|terminase	terminase	Q71T61	Escherichia_phage	3.4e-151	54.2
WP_152473015.1\|77678_78557_-	hypothetical protein	NA	NA	NA	NA
WP_152473017.1\|78806_78995_-	hypothetical protein	NA	NA	NA	NA
WP_152473019.1\|79723_80176_+	hypothetical protein	NA	NA	NA	NA
WP_152473021.1\|80175_80832_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	7.1e-05	38.6
81585:81599	attR	NA	NA	NA	NA

DBSCAN-SWA_3

88238 : 95379

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152473039.1\|88238_88964_-	hypothetical protein	A0A1B0V7N5	Roseobacter_phage	9.6e-11	44.2
WP_152473040.1\|89023_89494_-	hypothetical protein	A0A088FAL7	Vibrio_phage	8.6e-29	45.1
WP_152473041.1\|89701_89986_-	hypothetical protein	NA	NA	NA	NA
WP_152473042.1\|89986_90631_-	hypothetical protein	NA	NA	NA	NA
WP_152473043.1\|90633_91359_-	hypothetical protein	A0A076G7C3	Sinorhizobium_phage	7.3e-27	36.6
WP_152473044.1\|91355_91787_-	hypothetical protein	NA	NA	NA	NA
WP_152473045.1\|91802_92288_-	DUF4262 domain-containing protein	NA	NA	NA	NA
WP_152473046.1\|92300_92498_-	hypothetical protein	NA	NA	NA	NA
WP_152473047.1\|92501_92927_-	hypothetical protein	NA	NA	NA	NA
WP_152473048.1\|93380_93842_+	hypothetical protein	M4M9K3	Vibrio_phage	9.9e-54	68.6
WP_152473049.1\|93858_94356_+	helix-turn-helix transcriptional regulator	A0A2I7RSZ7	Vibrio_phage	2.6e-07	39.1
WP_152473050.1\|94343_94571_+	hypothetical protein	NA	NA	NA	NA
WP_152473094.1\|94890_95379_+	hypothetical protein	A0A222YXV2	Escherichia_phage	8.7e-32	53.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046066

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046065

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046067

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP046068

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection