CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046126	Enterococcus casseliflavus strain EC291 plasmid unnamed3, complete sequence	0 crisprs	csa3	0	0
NZ_CP046124	Enterococcus casseliflavus strain EC291 plasmid unnamed1, complete sequence	0 crisprs	NA	0	0
NZ_CP046125	Enterococcus casseliflavus strain EC291 plasmid unnamed2, complete sequence	0 crisprs	RT	0	1
NZ_CP046123	Enterococcus casseliflavus strain EC291 chromosome, complete genome	2 crisprs	csa3,WYL,RT,cas3,DinG,DEDDh,cas14j	1	12

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

7561 : 57088

Bacillus_phage(25.0%)

protease,transposase,holin

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081117370.1\|7561_7759_-\|holin	putative holin-like toxin	NA	NA	NA	NA
WP_142960364.1\|7934_8414_-	transcriptional regulator	NA	NA	NA	NA
WP_154694661.1\|8519_8984_-	single-stranded DNA-binding protein	Q9AYU6	Lactococcus_phage	9.4e-44	61.3
WP_154694662.1\|8980_10849_-	DNA topoisomerase III	A0A1X9I6W8	Streptococcus_phage	1.9e-204	74.0
WP_002295588.1\|10945_12832_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	7.0e-29	29.1
WP_154694650.1\|13568_13931_-	topoisomerase	NA	NA	NA	NA
WP_010748120.1\|14026_14218_-	hypothetical protein	NA	NA	NA	NA
WP_010748119.1\|14327_14618_-	hypothetical protein	NA	NA	NA	NA
WP_010748118.1\|14610_14886_-	DUF2089 family protein	NA	NA	NA	NA
WP_114148903.1\|15016_15493_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_114148902.1\|15471_15684_-	hypothetical protein	NA	NA	NA	NA
WP_034695771.1\|16016_16376_+	hypothetical protein	NA	NA	NA	NA
WP_154694437.1\|16388_16847_+	hypothetical protein	NA	NA	NA	NA
WP_154694663.1\|17189_17528_-	hypothetical protein	NA	NA	NA	NA
WP_005237737.1\|18243_18477_-	hypothetical protein	NA	NA	NA	NA
WP_115224856.1\|18598_18685_+	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_081132265.1\|19257_19611_-	hypothetical protein	NA	NA	NA	NA
WP_154694664.1\|19957_20392_-	hypothetical protein	NA	NA	NA	NA
WP_142429341.1\|21498_22639_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.5e-77	57.3
WP_082225284.1\|23372_23747_-	hypothetical protein	NA	NA	NA	NA
WP_113846323.1\|23929_25092_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	1.0e-78	50.9
WP_002360857.1\|25266_25449_-	hypothetical protein	NA	NA	NA	NA
WP_085406003.1\|25501_25747_-	hypothetical protein	NA	NA	NA	NA
WP_085406002.1\|25828_26158_-	PcfU	C9E2N6	Enterococcus_phage	1.2e-40	74.5
WP_002336226.1\|26842_27733_-	ROK family protein	NA	NA	NA	NA
WP_154694665.1\|27889_28999_-	gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_142667574.1\|29020_31102_-	sialidase	NA	NA	NA	NA
WP_002336228.1\|31112_31562_-	YhcH/YjgK/YiaL family protein	NA	NA	NA	NA
WP_154694666.1\|31583_33125_-	sodium/solute symporter	A0A240F3J2	Aeromonas_phage	1.0e-30	26.0
WP_002336230.1\|33169_34087_-	N-acetylneuraminate lyase	NA	NA	NA	NA
WP_002336231.1\|34083_34806_-	N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_002336232.1\|34810_35611_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_154694687.1\|36850_36958_+	DUF4158 domain-containing protein	NA	NA	NA	NA
WP_002336236.1\|37319_37631_-	hypothetical protein	NA	NA	NA	NA
WP_067627135.1\|37948_39133_+\|transposase	IS110 family transposase	A0A0U3ULR1	Bacillus_phage	1.2e-21	23.9
WP_016249871.1\|39225_39831_-	recombinase family protein	A0A219YA40	Aeromonas_phage	2.3e-18	33.2
WP_016249870.1\|39954_42948_+\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	1.2e-203	37.5
WP_142976587.1\|43742_44912_+\|transposase	IS256 family transposase	NA	NA	NA	NA
WP_141427078.1\|45167_45470_-	hypothetical protein	K4HZD4	Acidithiobacillus_phage	1.8e-11	36.7
WP_141427077.1\|45622_46018_-	AsnC family transcriptional regulator	NA	NA	NA	NA
WP_154694667.1\|46507_46795_-	type III secretion system protein PrgN	NA	NA	NA	NA
WP_154694668.1\|46930_48430_-	replication protein RepR	NA	NA	NA	NA
WP_104884698.1\|49112_49934_+	ParA family protein	F0PIG8	Enterococcus_phage	3.4e-36	38.8
WP_010782319.1\|49936_50341_+	hypothetical protein	NA	NA	NA	NA
WP_154694669.1\|50480_51167_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.1e-124	98.2
WP_154694670.1\|51356_51968_+	helix-turn-helix domain-containing protein	M9Q1K0	Clostridium_phage	9.9e-17	32.4
WP_154694658.1\|52167_52554_-	hypothetical protein	NA	NA	NA	NA
WP_154694671.1\|52596_53001_-	hypothetical protein	NA	NA	NA	NA
WP_104870835.1\|52909_53155_-	hypothetical protein	NA	NA	NA	NA
WP_154694672.1\|53182_53845_-	DUF2786 domain-containing protein	A0A172JHR5	Bacillus_phage	9.1e-16	32.9
WP_010748127.1\|53943_54123_-	hypothetical protein	NA	NA	NA	NA
WP_154694673.1\|54216_54546_-	hypothetical protein	NA	NA	NA	NA
WP_034871981.1\|54590_54794_-	hypothetical protein	NA	NA	NA	NA
WP_154694660.1\|55044_56535_-	DNA (cytosine-5-)-methyltransferase	A0A141E1L1	Streptococcus_phage	2.3e-128	53.6
WP_081117370.1\|56890_57088_-\|holin	putative holin-like toxin	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046123

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046123_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046123_1

989218-989302

Orphan

Consensus_repeat	Method
TAAGGGTCCGGCGGGTGGCGAGCACCAAAA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046123_1

>merge|NZ_CP046123|1|989218-989302|CRISPRCasFinder
TAAGGGTCCGGCGGGTGGCGAGCACCAAAACTAAACTCGATACAAATCCGGAACGTAAGGGTCCGGCGGGTGGCAAGCACCAAAA

>NZ_CP046123|1|1|989218-989302|CRISPRCasFinder
TAAGGGTCCGGCGGGTGGCGAGCACCAAAA	CTAAACTCGATACAAATCCGGAACG
TAAGGGTCCGGCGGGTGGCAAGCACCAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046123.1\|WP_154694254.1\|996914_997109_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046123.1\|WP_086293440.1\|997976_998240_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046123.1\|WP_154694253.1\|995887_996514_-\|CadD-family-cadmium-resistance-transporter	unknown	unknown	gnl\|CDD\|281580
NZ_CP046123.1\|WP_005225225.1\|991848_992541_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP046123.1\|WP_081132265.1\|998570_998924_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|224583
NZ_CP046123.1\|WP_005237711.1\|989371_989551_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046123.1\|WP_154694249.1\|982183_982756_+\|DNA-starvation/stationary-phase-protection-protein	unknown	unknown	gnl\|CDD\|153102
NZ_CP046123.1\|WP_154694642.1\|986398_986662_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|183527
NZ_CP046123.1\|WP_003103602.1\|986808_987042_+\|heavy-metal-associated-domain-containing-protein	unknown	unknown	gnl\|CDD\|225328
NZ_CP046123.1\|WP_114148892.1\|994384_995796_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP046123.1\|WP_154694252.1\|993037_994228_-\|plasmid-recombination-protein	unknown	unknown	gnl\|CDD\|366451
NZ_CP046123.1\|WP_086293250.1\|992651_993083_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|366772
NZ_CP046123.1\|WP_124007094.1\|982940_983648_+\|Crp/Fnr-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|223736
NZ_CP046123.1\|WP_014125708.1\|984199_984613_+\|prolipoprotein-diacylglyceryl-transferase	unknown	unknown	gnl\|CDD\|376615
NZ_CP046123.1\|WP_028790832.1\|983876_984215_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046123.1\|WP_154694251.1\|987239_989102_+\|heavy-metal-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319774
NZ_CP046123.1\|WP_142429341.1\|990123_991265_+\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP046123.1\|WP_154694226.1\|984935_986321_+\|ISNCY-family-transposase	unknown	unknown	gnl\|CDD\|366234
NZ_CP046123.1\|WP_154694175.1\|980810_981973_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP046123.1\|WP_154694250.1\|984622_984871_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|183527

Protein	Function_ID	Function_description	E-value
NZ_CP046123.1\|WP_005225225.1\|991848_992541_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	4.65781e-45
NZ_CP046123.1\|WP_081132265.1\|998570_998924_+\|hypothetical-protein	gnl\|CDD\|224583	COG1669, COG1669, Predicted nucleotidyltransferases [General function prediction only].	1.86507e-14
NZ_CP046123.1\|WP_154694253.1\|995887_996514_-\|CadD-family-cadmium-resistance-transporter	gnl\|CDD\|281580	pfam03596, Cad, Cadmium resistance transporter.	8.75513e-87
NZ_CP046123.1\|WP_154694249.1\|982183_982756_+\|DNA-starvation/stationary-phase-protection-protein	gnl\|CDD\|153102	cd01043, DPS, DPS protein, ferritin-like diiron-binding domain. DPS (DNA Protecting protein under Starved conditions) domain is a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. Some DPS proteins nonspecifically bind DNA, protecting it from cleavage caused by reactive oxygen species such as the hydroxyl radicals produced during oxidation of Fe(II) by hydrogen peroxide. These proteins assemble into dodecameric structures, some form DPS-DNA co-crystalline complexes, and possess iron and H2O2 detoxification capabilities. Expression of DPS is induced by oxidative or nutritional stress, including metal ion starvation. Members of the DPS family are homopolymers formed by 12 four-helix bundle subunits that assemble with 23 symmetry into a hollow shell. The DPS ferroxidase site is unusual in that it is not located in a four-helix bundle as in ferritin, but is shared by 2-fold symmetry-related subunits providing the iron ligands. Many DPS sequences (e.g., E. coli) display an N-terminal extension of variable length that contains two or three positively charged lysine residues that extends into the solvent and is thought to play an important role in the stabilization of the complex with DNA. DPS Listeria Flp, Bacillus anthracis Dlp-1 and Dlp-2, and Helicobacter pylori HP-NAP which lack the N-terminal extension, do not bind DNA. DPS proteins from Helicobacter pylori, Treponema pallidum, and Borrelia burgdorferi are highly immunogenic.	4.99014e-43
NZ_CP046123.1\|WP_154694642.1\|986398_986662_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	7.25743e-18
NZ_CP046123.1\|WP_003103602.1\|986808_987042_+\|heavy-metal-associated-domain-containing-protein	gnl\|CDD\|225328	COG2608, CopZ, Copper chaperone [Inorganic ion transport and metabolism].	1.437e-09
NZ_CP046123.1\|WP_114148892.1\|994384_995796_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.28595e-34
NZ_CP046123.1\|WP_154694252.1\|993037_994228_-\|plasmid-recombination-protein	gnl\|CDD\|366451	pfam01076, Mob_Pre, Plasmid recombination enzyme. With some plasmids, recombination can occur in a site specific manner that is independent of RecA. In such cases, the recombination event requires another protein called Pre. Pre is a plasmid recombination enzyme. This protein is also known as Mob (conjugative mobilisation).	1.24453e-76
NZ_CP046123.1\|WP_086293250.1\|992651_993083_-\|hypothetical-protein	gnl\|CDD\|366772	pfam01719, Rep_2, Plasmid replication protein. This family consists of various bacterial plasmid replication (Rep) proteins. These proteins are essential for replication of plasmids, the Rep proteins are topoisomerases that nick the positive stand at the plus origin of replication and also at the single-strand conversion sequence.	6.00388e-51
NZ_CP046123.1\|WP_124007094.1\|982940_983648_+\|Crp/Fnr-family-transcriptional-regulator	gnl\|CDD\|223736	COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms].	4.47808e-42
NZ_CP046123.1\|WP_014125708.1\|984199_984613_+\|prolipoprotein-diacylglyceryl-transferase	gnl\|CDD\|376615	pfam01790, LGT, Prolipoprotein diacylglyceryl transferase.	1.79494e-46
NZ_CP046123.1\|WP_154694251.1\|987239_989102_+\|heavy-metal-translocating-P-type-ATPase	gnl\|CDD\|319774	cd02079, P-type_ATPase_HM, P-type heavy metal-transporting ATPase. Heavy metal-transporting ATPases (Type IB ATPases) transport heavy metal ions (Cu(+), Cu(2+), Zn(2+), Cd(2+), Co(2+), etc.) across biological membranes. These ATPases include mammalian copper-transporting ATPases, ATP7A and ATP7B, Bacillus subtilis CadA which transports cadmium, zinc and cobalt out of the cell, Bacillus subtilis ZosA/PfeT which transports copper, and perhaps also zinc and ferrous iron, Archaeoglobus fulgidus CopA and CopB, Staphylococcus aureus plasmid pI258 CadA, a cadmium-efflux ATPase, and Escherichia coli ZntA which is selective for Pb(2+), Zn(2+), and Cd(2+). The characteristic N-terminal heavy metal associated (HMA) domain of this group is essential for the binding of metal ions. This family belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP046123.1\|WP_142429341.1\|990123_991265_+\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	3.7388e-81
NZ_CP046123.1\|WP_154694226.1\|984935_986321_+\|ISNCY-family-transposase	gnl\|CDD\|366234	pfam00665, rve, Integrase core domain. Integrase mediates integration of a DNA copy of the viral genome into the host chromosome. Integrase is composed of three domains. The amino-terminal domain is a zinc binding domain pfam02022. This domain is the central catalytic domain. The carboxyl terminal domain that is a non-specific DNA binding domain pfam00552. The catalytic domain acts as an endonuclease when two nucleotides are removed from the 3' ends of the blunt-ended viral DNA made by reverse transcription. This domain also catalyzes the DNA strand transfer reaction of the 3' ends of the viral DNA to the 5' ends of the integration site.	1.1359e-12
NZ_CP046123.1\|WP_154694175.1\|980810_981973_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	7.99997e-49
NZ_CP046123.1\|WP_154694250.1\|984622_984871_+\|hypothetical-protein	gnl\|CDD\|183527	PRK12437, PRK12437, prolipoprotein diacylglyceryl transferase; Reviewed.	9.55215e-30

>NZ_CP046123.1|WP_154694251.1|987239_989102_+|heavy-metal-translocating-P-type-ATPase
MQQYILSKKNVITVISGLLIVLGFFSHFVLENVGLSEWSLIIASVFGITPIAIQAFQAMKVKVISIDVLVSIAAIGALFIQNYEESAIVTFLFLFGHYLEQRTLNQTRSAIKELTEMAPESALKQMDNGEFEEVEVDDIDEGDILLVKTGAKVPVDGIVLTGEGHINEASITGEAVPVNKLADAEVFAGTILENGTIQIRADRVGEDTTFGKIIELVEEAQDSKSEAERFIDRFSKYYTPAVLVLAIVVWAFSQNIELAITILVLGCPGALVIGVPVSNVAGIGNGARNGVLLKGSEVIQDFSNVDTIVFDKTGTLTVGNPTVAATELYEKDPAETLGYLASVERESDHPLAKAVLNQIGETNFYPVEGTEVVKGGGIVSSVAGHRVAVGNVALMEKENVTLSKKVQKDVKRFEQQGNSLVLTAVDGELKVLMGIRDQVRPGVKANLQELKDLGVKNLVVLSGDNQGTVDVVAGELGLTEAHGHMLPEDKSAYIGKLQQRGQIVAFVGDGVNDSPSLALADIGIAMGSGTDVAIETSDVVLMNSNFSNLPHALGLVKATANNMKQNIVISIGVVLVLLTSVFFSEWMNMSIGMLVHEGSILVVIFNGMRLMKYKLKGRKE
>NZ_CP046123.1|WP_003103602.1|986808_987042_+|heavy-metal-associated-domain-containing-protein
MEKAILQLETLSCPSCMQKIEGAVKSVNGIDKDSIKVLFNSSKVKTNFDSAVTSIEEIQKAIENVGYPVLKAKVKAA
>NZ_CP046123.1|WP_154694642.1|986398_986662_+|prolipoprotein-diacylglyceryl-transferase
MGHFYFRLTGEVALSYVLWYSVGRFFIEGMRTDSLWIGEWIRVSQALSLALFIGAIVVWFIRRQDYPPISYYSDGNKGQKKTIKMVN
>NZ_CP046123.1|WP_154694226.1|984935_986321_+|ISNCY-family-transposase
MNEDKKYKVIKAVAEKRKEKKRACVELGLSTRQVNRLIKDYQKGGKAIFSHGNRGKTAKHAVPKETKKQVVELYQSFKIQPNVKHFTEILKEDYDICYTDTTIRRILYQANILSPKTQRKTRKKIKARIKAKSMKGEKKAENPLVPRAEDQMELPEKSHPSRPRKKYQGELIQMDASSYNWFGKEVTHLHLAIDDASGNIVGAYFDTQETLKGYYHVLNQILTKQGIPLAFLTDKRTVFEYTSKAMRAVEEDTFTQFGFACHQLGIEIRTSSIPQAKGRVERLNGTVQSRLPVDLELAGIQSIEEANHFLTKWVRTFNKKFGHKTKESIYEKAPTKSEINLLLARVANRKLDSGHHIRYQNNYYLPTEGSEDKYFTRKSKVLIIEAFNGDIYVNIAEKIYTTRSLKEHDYYSKEFDPIPEQKKERRQYIPPQSHPWKLESFKRYLRSVGKTLEEYEAEQTA
>NZ_CP046123.1|WP_154694250.1|984622_984871_+|hypothetical-protein
MNQEAHGGPVTRQFLENLYLPEFIIEQMNINGTYYHPTFLYESLWSLLGFVLIVTIRNRKQLLRQGEVALSYVLYHSNVIMS
>NZ_CP046123.1|WP_014125708.1|984199_984613_+|prolipoprotein-diacylglyceryl-transferase
MGFVLGVLNPHVVEIGSVVIHWYGVIIAAGILAALQLSTKEAKKKGLEEDTIIDMALWAIPIGLLGARLYYVLFELGYYLQNPGQILAIWNGGIAIYGGLIAGGGTLYWYAKKKGTSLALVLDILAPNVLLAQSIGR
>NZ_CP046123.1|WP_028790832.1|983876_984215_+|hypothetical-protein
MHYFWVIVAITLSAAGAFFVVPFTKNTIGGEAKTSNVVEADRLAMEKEEEVVKGAGVIGHGKVAYYEASDQGAKSEFTVWFPWSLAGILFSITMTRMTRKIEEMEQIEWDSY
>NZ_CP046123.1|WP_124007094.1|982940_983648_+|Crp/Fnr-family-transcriptional-regulator
MTQYTQPHAAGDHSACIRLVPIFNHLEESSMDRIAGKAHTKHYQKGEFLFRSQEKDDALYIVNRGKVRIYRLSNSGKEQLVRILNPGDFTGEWTLFNPDAVHEEYAEATRDTSVCMIQQHDVQEFLKEYHAISLKLLGEMSQRLESSGRQTAQVAVESVITRLVLFLAENVEPEMGNSPTITLPMAKKDIASYLGTTPETISRKFGELEDEGLIQQLSGKRIKIQDLDDLLLYSE
>NZ_CP046123.1|WP_154694249.1|982183_982756_+|DNA-starvation/stationary-phase-protection-protein
MTENKASQERTPQERFQEEQEHKEHVHHTKINAAAISDHLLGNMHTLHVKLHQYHWYVNGANFFTLHEKFEVLYNQNEEWFDKLAERLIISGHKPASTTAEFEKYSMLSEDAINKYAKAEDMVENIIEDFRSTRELTIRAIRLVQDEGDDALEDTLIAFKNDLDKNIWMLQAFIGKEALEDDDAFDEDED
>NZ_CP046123.1|WP_154694175.1|980810_981973_-|IS3-family-transposase
MSKRTRRTFSQEFKQQIVNLYLAGKPRVEIIREYELTASAFDKWVKQSKTSGSFKGKDNLTPEQKELLELRKRNQQLEMENDILKQAALIFGPKRQVIDANKHLYPISAMCRILGLSRQSYYYQSKPKKDESELEEVVAEEFIRSRKAYGSRKIKKALSKRGIRISRRKISRIMKNRGLKSSYTVAYFKVHHSTCNEAKTTNVLNRKFLRDNPLEAIVTDLTYVRVGKKWNYICFILDLFNREILGYSCGEHKDAVLVKKAFSRIKQPLTEVEIFHTDRGKEFDNQAIDELLTTFDINRSLSHKGCPFDNAVAESTYKSLKVEFVYQYTFETLQQLDLELFDYVNWWNHLRLHGTLGYETPVGYRNQRLAQRILDNELGCANASEAV
>NZ_CP046123.1|WP_005237711.1|989371_989551_+|hypothetical-protein
MAKKEYKRMSIKETTQITRQLNAIYKAAHLLQEHFVDKKVSFVGEVSTVAIIFSTTNFI
>NZ_CP046123.1|WP_142429341.1|990123_991265_+|IS3-family-transposase
MAKANKKFDEDFKKTILDLNQSGQSVEELAEQYGIATQTIYRWKKLHTKNEATGMTEAEILAMKKEMARMQEENTIPKKGFNHIRSKVKMSDVFEFIQSNVHDHDVKQMCTVLEAPKSSYYDWKKKKPSKRQSENKRLNRLISGIYFENKGIYGAPKIHKILVGRGESLSLKKVQILMRKLGLRSVTLKKYKPGKQVKVKSEGRKNLLNQDFTTTSINQKWVTDITYIHTLKDGWTYLSTIQDLHTKKVIGWKFGKQMTKELVIETLDHALLHQTPSENLIIHSDLGSQYTSEAYEAKLNELNIRHSFSRKGCPYDNAGIESFHASLKKEEVYPSKAYENFEAAHLALFQYIEGFYNRKRIHSSINYLTPNQMEELALQA
>NZ_CP046123.1|WP_005225225.1|991848_992541_+|Crp/Fnr-family-transcriptional-regulator
MAHHHHHSHIDCIRLVPIFNHLNEEQMSLIAQSAQEVHYAKNALLFGNGDKDDTLYIINNGRVRVYNLNESGREQTVRILNPGDFMGEVAIFQTESYHSNYAEAISEVSICRIHKKDMDDYLGAYPEIMRRILSDVTKRLQVSEKQTMQVGMEQVESRIIDFLSEYVEDEENHTYVTLPMSKKDLASYLGTTPETISRKFSSLEERGLIKQHTQKYVEIFDLDKLLFASS
>NZ_CP046123.1|WP_086293250.1|992651_993083_-|hypothetical-protein
MVYPESAPKNWREILDETHMRWIESPLHDKDFNPDGTIKKPHWHVMLSADGPITLKAVEKIIEPLNVPAPQKVGSGRGMIRYFIHLDNPEKYQYSRDEIVGHGGADVESYFELTKTNKISVMKDIATYIYENEIDNYADFLGF
>NZ_CP046123.1|WP_154694252.1|993037_994228_-|plasmid-recombination-protein
MSYLVARMQKMKAGNLVGMGNHNQRLTDNHSNKDIDTERSYLNYDLVNRTDNYKTDIQQFINDNKSSSHAVRKDAILINEWIITSDNQFFKDKDDKEIKDFFEQAKDYFAEKFGDNNIRYAQVHLDETTPHMHLGIVPFNAEHKLSAKTVFNRQAFQAVQDELPTYLQERGFNLERGEKGSERKNLTVSEYKKAKDELKEMTTTLEQRKSEVLALSNDKTPTIKKESLDLKDEMKTVKVPSGETIDIGKLRHEFMKNEERKTGNVIIPKDKLNALIQGYEDLYSSNERLKKYVETDLPKEITKVKGKYSELVKEYNDLVRKSNRNIETIEDLEKENKSLKNEIKGIYRGFTAFFEKSKSVTAEQIKTLVEGVVSEVKEFGHLLCIQRVRQKIGERF
>NZ_CP046123.1|WP_114148892.1|994384_995796_+|IS3-family-transposase
MAKYPFELKLKIVKEYLSGVGGYRYLANKYGISSKSQVSNWVNAYREYGEEGLLRKHQNQKYSVQFKLNALELYQTSEMSYREVASTLEMNNPALIANWMRNFREAGIEGLSKEKGRPLTLTRKKENKKENTTTEERERIKALEKQVRSLQIENAFLKELRKLRKQEAQQRRKNQSHESSPASEDPFKLVELLETLKFPKATYMYWQKRFDRPNPDQEIEEKMLEIRKEHKDYGCLRLKKELENQGIHVNKKKIQRLIKKLGIEVKSYTRKSRRYNSYRGKVGTVAKNRIHRRFYTNICHQKITTDTTEFKYYEVDTTGVVRQKKLYLDPFMDFYNSEILSYRISEKPNALAIMEGLEEAIQMTNDCPFRRTFHSDQGWAYQMNAYKNKLKQHKIFKSMSRKGNCLDNSPMENFFGLLKQEIFHGEVYRSLDELKTKIDQYIYYYNHKRIKKKLNWRSPVQFREAVKTAV
>NZ_CP046123.1|WP_154694253.1|995887_996514_-|CadD-family-cadmium-resistance-transporter
MGQTIISAIGVYISTSIDYLIILIILFAQLSQNKQKWHIYAGQYLGTGLLVGASLVAAYVVNFVPEAWMVGLLGLIPIYLGIRFAIVGEGEEEEEEEEEIIERLEQSKANQLFWTVTLLTIASGGDNLGIYIPYFASLDWSQTLVALLVFAIGIIIFCELSRVLSSIPLISETIEKYERIIVPLVFIPLGLYIMYESGTIETFLNFIL
>NZ_CP046123.1|WP_154694254.1|996914_997109_-|hypothetical-protein
MTGKFKDELLTVVADNDLKNIIQLRRYFENHSDEFTFKNITRFHQTINNNVDVFGLYFGGNLQN
>NZ_CP046123.1|WP_086293440.1|997976_998240_+|hypothetical-protein
MDSLSLLEIMTNAKLEQDHTKIQELFSSDVYQEAVTMSKKVVRNKNYRFKNRKDESKKEEKKKVKSVQEDVKKERDFNDIVSQYLPK
>NZ_CP046123.1|WP_081132265.1|998570_998924_+|hypothetical-protein
MIYTISDIQKLCTPIFLEWEIKKAFLFGSYARNEATETSDLDILIDGEGSLLHNIFDVIRLKSKLSSALKKEIDLITLRAINSETNKKRNPLLKENIEADCVMIYDFKTSDSFKVKG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046123_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046123_2

3154636-3154776

Orphan

Consensus_repeat	Method
CAGTCGCAGTGATTCCGCTGCTTGGTCACTACCCTCGCTGCTCTCGCCTAGTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046123_2

>merge|NZ_CP046123|2|3154636-3154776|CRISPRCasFinder
CAGTCGCAGTGATTCCGCTGCTTGGTCACTACCCTCGCTGCTCTCGCCTAGTAGGTTTCATCATCTGCTCTGTGCGGCTTGCGCCGCTCAGTCGCAGTGATTCCGCTGCTTGGTCACTACGCTCGCTGCTCTCGCCTAGTA

>NZ_CP046123|2|2|3154636-3154776|CRISPRCasFinder
CAGTCGCAGTGATTCCGCTGCTTGGTCACTACCCTCGCTGCTCTCGCCTAGTA	GGTTTCATCATCTGCTCTGTGCGGCTTGCGCCGCT
CAGTCGCAGTGATTCCGCTGCTTGGTCACTACGCTCGCTGCTCTCGCCTAGTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046123.1\|WP_005228088.1\|3143880_3144879_+\|diphosphomevalonate-decarboxylase	unknown	unknown	gnl\|CDD\|130307
NZ_CP046123.1\|WP_010749122.1\|3156448_3157759_-\|family-20-glycosylhydrolase	unknown	unknown	gnl\|CDD\|119334
NZ_CP046123.1\|WP_034696319.1\|3162909_3164460_+\|IS1182-family-transposase	unknown	unknown	gnl\|CDD\|372705
NZ_CP046123.1\|WP_010749119.1\|3159505_3160687_-\|AI-2E-family-transporter	unknown	unknown	gnl\|CDD\|223701
NZ_CP046123.1\|WP_010749127.1\|3145994_3147035_+\|type-2-isopentenyl-diphosphate-Delta-isomerase	unknown	unknown	gnl\|CDD\|235465
NZ_CP046123.1\|WP_005228025.1\|3160702_3161056_-\|PTS-glucitol/sorbitol-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|367683
NZ_CP046123.1\|WP_010749126.1\|3147329_3149252_+\|cadmium-translocating-P-type-ATPase	unknown	unknown	gnl\|CDD\|319849
NZ_CP046123.1\|WP_010749123.1\|3152286_3154404_-\|polyribonucleotide-nucleotidyltransferase	unknown	unknown	gnl\|CDD\|236995
NZ_CP046123.1\|WP_005233740.1\|3162216_3162567_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046123.1\|WP_010749118.1\|3161174_3162197_+\|lactonase-family-protein	unknown	unknown	gnl\|CDD\|378416
NZ_CP046123.1\|WP_010749128.1\|3144915_3145998_+\|phosphomevalonate-kinase	unknown	unknown	gnl\|CDD\|130287
NZ_CP046123.1\|WP_010749124.1\|3150675_3152076_-\|glycoside-hydrolase-family-1-protein	unknown	unknown	gnl\|CDD\|225343
NZ_CP046123.1\|WP_010749121.1\|3158081_3158621_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|372273
NZ_CP046123.1\|WP_010749120.1\|3158654_3159224_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP046123.1\|WP_154694622.1\|3149332_3150673_-\|PTS-cellobiose-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|181976
NZ_CP046123.1\|WP_010749131.1\|3141010_3141916_-\|magnesium-transporter-CorA-family-protein	unknown	unknown	gnl\|CDD\|213361
NZ_CP046123.1\|WP_034696309.1\|3142005_3142668_-\|deoxynucleoside-kinase	unknown	unknown	gnl\|CDD\|224345
NZ_CP046123.1\|WP_005228070.1\|3155360_3156221_+\|MurR/RpiR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224651
NZ_CP046123.1\|WP_080647016.1\|3142919_3143888_+\|mevalonate-kinase	unknown	unknown	gnl\|CDD\|273130
NZ_CP046123.1\|WP_005228072.1\|3154874_3155144_-\|30S-ribosomal-protein-S15	unknown	unknown	gnl\|CDD\|180170

Protein	Function_ID	Function_description	E-value
NZ_CP046123.1\|WP_005228088.1\|3143880_3144879_+\|diphosphomevalonate-decarboxylase	gnl\|CDD\|130307	TIGR01240, Diphosphomevalonate_decarboxylase, diphosphomevalonate decarboxylase. This enzyme catalyzes the last step in the synthesis of isopentenyl diphosphate (IPP) in the mevalonate pathway. Alternate names: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase [Central intermediary metabolism, Other].	4.32098e-134
NZ_CP046123.1\|WP_010749122.1\|3156448_3157759_-\|family-20-glycosylhydrolase	gnl\|CDD\|119334	cd06564, GH20_DspB_LnbB-like, Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins. Dispersin B is a soluble beta-N-acetylglucosamidase found in bacteria that hydrolyzes the beta-1,6-linkages of PGA (poly-beta-(1,6)-N-acetylglucosamine), a major component of the extracellular polysaccharide matrix. Lacto-N-biosidase hydrolyzes lacto-N-biose (LNB) type I oligosaccharides at the nonreducing terminus to produce lacto-N-biose as part of the GNB/LNB (galacto-N-biose/lacto-N-biose I) degradation pathway. The lacto-N-biosidase from Bifidobacterium bifidum has this GH20 domain, a carbohydrate binding module 32, and a bacterial immunoglobulin-like domain 2, as well as a YSIRK signal peptide and a G5 membrane anchor at the N and C termini, respectively. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.	7.56116e-65
NZ_CP046123.1\|WP_034696319.1\|3162909_3164460_+\|IS1182-family-transposase	gnl\|CDD\|372705	pfam13751, DDE_Tnp_1_6, Transposase DDE domain. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis.	2.22015e-16
NZ_CP046123.1\|WP_010749119.1\|3159505_3160687_-\|AI-2E-family-transporter	gnl\|CDD\|223701	COG0628, yhhT, Predicted permease, member of the PurR regulon [General function prediction only].	1.2538e-63
NZ_CP046123.1\|WP_010749127.1\|3145994_3147035_+\|type-2-isopentenyl-diphosphate-Delta-isomerase	gnl\|CDD\|235465	PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional.	2.76716e-163
NZ_CP046123.1\|WP_005228025.1\|3160702_3161056_-\|PTS-glucitol/sorbitol-transporter-subunit-IIA	gnl\|CDD\|367683	pfam03829, PTSIIA_gutA, PTS system glucitol/sorbitol-specific IIA component.	6.04593e-40
NZ_CP046123.1\|WP_010749126.1\|3147329_3149252_+\|cadmium-translocating-P-type-ATPase	gnl\|CDD\|319849	cd07551, P-type_ATPase_HM_ZosA_PfeT-like, P-type heavy metal-transporting ATPase, similar to Bacillus subtilis ZosA/PfeT which transports copper, and perhaps zinc under oxidative stress, and perhaps ferrous iron. Bacillus subtilis ZosA/PfeT (previously known as YkvW) transports copper, it may also transport zinc under oxidative stress and may also be involved in ferrous iron efflux. ZosA/PfeT is expressed under the regulation of the peroxide-sensing repressor PerR. It is involved in competence development. Disruption of the zosA/pfeT gene results in low transformability. This subfamily belongs to the P-type ATPases, a large family of integral membrane transporters that are of critical importance in all kingdoms of life. They generate and maintain (electro-) chemical gradients across cellular membranes, by translocating cations, heavy metals and lipids, and are distinguished from other main classes of transport ATPases (F- , V- , and ABC- type) by the formation of a phosphorylated (P-) intermediate state in the catalytic cycle.	0
NZ_CP046123.1\|WP_010749123.1\|3152286_3154404_-\|polyribonucleotide-nucleotidyltransferase	gnl\|CDD\|236995	PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional.	0
NZ_CP046123.1\|WP_010749118.1\|3161174_3162197_+\|lactonase-family-protein	gnl\|CDD\|378416	pfam10282, Lactonase, Lactonase, 7-bladed beta-propeller. This entry contains bacterial 6-phosphogluconolactonases (6PGL)YbhE-type (EC:3.1.1.31) which hydrolyze 6-phosphogluconolactone to 6-phosphogluconate. The entry also contains the fungal muconate lactonising enzyme carboxy-cis,cis-muconate cyclase (EC:5.5.1.5) and muconate cycloisomerase (EC:5.5.1.1), which convert cis,cis-muconates to muconolactones and vice versa as part of the microbial beta-ketoadipate pathway. Structures of proteins in this family have revealed a 7-bladed beta-propeller fold.	1.54054e-155
NZ_CP046123.1\|WP_010749128.1\|3144915_3145998_+\|phosphomevalonate-kinase	gnl\|CDD\|130287	TIGR01220, phosphomevalonate_kinase, phosphomevalonate kinase, ERG8-type, Gram-positive branch. This enzyme is part of the mevalonate pathway, one of two alternative pathways for the biosynthesis of IPP. In an example of nonorthologous gene displacement, two different types of phosphomevalonate kinase are found - the animal type and this ERG8 type. This model represents the low GC Gram-positive organism forms of the ERG8 type of phosphomevalonate kinase. [Central intermediary metabolism, Other].	0
NZ_CP046123.1\|WP_010749124.1\|3150675_3152076_-\|glycoside-hydrolase-family-1-protein	gnl\|CDD\|225343	COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].	1.27535e-178
NZ_CP046123.1\|WP_010749121.1\|3158081_3158621_-\|hypothetical-protein	gnl\|CDD\|372273	pfam12724, Flavodoxin_5, Flavodoxin domain. This is a family of flavodoxins. Flavodoxins are electron transfer proteins that carry a molecule of non-covalently bound FMN.	1.86911e-14
NZ_CP046123.1\|WP_010749120.1\|3158654_3159224_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	2.03817e-07
NZ_CP046123.1\|WP_154694622.1\|3149332_3150673_-\|PTS-cellobiose-transporter-subunit-IIC	gnl\|CDD\|181976	PRK09592, celD, PTS cellobiose transporter subunit IIC.	7.48104e-159
NZ_CP046123.1\|WP_010749131.1\|3141010_3141916_-\|magnesium-transporter-CorA-family-protein	gnl\|CDD\|213361	cd12827, EcCorA_ZntB-like_u2, uncharacterized bacterial subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB family. A uncharacterized subfamily of the Escherichia coli CorA-Salmonella typhimurium ZntB (EcCorA-ZntB_like) family of the MIT superfamily of essential membrane proteins involved in transporting divalent cations (uptake or efflux) across membranes.The EcCorA-ZntB-like family includes the Mg2+ transporters Escherichia coli and Salmonella typhimurium CorAs, which can also transport Co2+, and Ni2+. Structures of the intracellular domain of EcCorA-ZntB-like family members, Vibrio parahaemolyticus and Salmonella typhimurium ZntB, form funnel-shaped homopentamers, the tip of the funnel is formed from two C-terminal transmembrane (TM) helices from each monomer, and the large opening of the funnel from the N-terminal cytoplasmic domains. The GMN signature motif of the MIT superfamily occurs just after TM1, mutation within this motif is known to abolish Mg2+ transport through Salmonella typhimurium CorA. Natural variants such as GVN and GIN, such as occur in some ZntB family proteins, may be associated with the transport of different divalent cations, such as zinc and cadmium. The functional diversity of MIT transporters may also be due to minor structural differences regulating gating, substrate selection, and transport.	3.45873e-113
NZ_CP046123.1\|WP_034696309.1\|3142005_3142668_-\|deoxynucleoside-kinase	gnl\|CDD\|224345	COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism].	1.59403e-85
NZ_CP046123.1\|WP_005228070.1\|3155360_3156221_+\|MurR/RpiR-family-transcriptional-regulator	gnl\|CDD\|224651	COG1737, RpiR, Transcriptional regulators [Transcription].	2.64119e-64
NZ_CP046123.1\|WP_080647016.1\|3142919_3143888_+\|mevalonate-kinase	gnl\|CDD\|273130	TIGR00549, Mevalonate_kinase, mevalonate kinase. This model represents mevalonate kinase, the third step in the mevalonate pathway of isopentanyl pyrophosphate (IPP) biosynthesis. IPP is a common intermediate for a number of pathways including cholesterol biosynthesis. This model covers enzymes from eukaryotes, archaea and bacteria. The related enzyme from the same pathway, phosphmevalonate kinase, serves as an outgroup for this clade. Paracoccus exhibits two genes within the phosphomevalonate/mevalonate kinase family, one of which falls between trusted and noise cutoffs of this model. The degree of divergence is high, but if the trees created from this model are correct, the proper names of these genes have been swapped. [Central intermediary metabolism, Other].	5.71963e-91
NZ_CP046123.1\|WP_005228072.1\|3154874_3155144_-\|30S-ribosomal-protein-S15	gnl\|CDD\|180170	PRK05626, rpsO, 30S ribosomal protein S15; Reviewed.	4.10942e-52

>NZ_CP046123.1|WP_010749123.1|3152286_3154404_-|polyribonucleotide-nucleotidyltransferase
MTEKQVFKTTWGGRPLEVEVGQLAKQANGAVLVRYGDTVVLSAAVASKEAKDTDFFPLTINYEEKMYAVGKVPGGFIKREGRPSTEATLTARLIDRPIRPMFAEGFRNEVQVTNIVMSVEQDCTPAMAAMLGSSLALSISDIPFDGPIAGVDVGRVNGEYVLNPTVEQAEQTDIELTVAGTKKAINMVESGAKEVSEEDMLGALLFGFDAIKELVAFQEEVVAAVGKPKMEVKLLQVDADLKKEIFDGYYQTMKTAVMTEEKLAREDEIDKVKDTVKEVYAEKFAGHEEEAQFLKEVKQIAEDLEKDVVRELITIDKIRPDGRQLDEIRPLASEVGLLPRVHGSGLFTRGQTQALSACTLAPLGEHQIIDGLGVEESKRFIHHYNFPQFSVGSTGRAGSPGRREIGHGALGERALAQVIPDETDFPYTIRLVAEVLESNGSSSQASICAGTLALMDAGVPIKAPVAGIAMGLVSDGKNYTILTDIQGLEDHLGDMDFKVAGTKDGITALQMDIKIQGITEQILTEALDQAKKARMEILNELTSTLAAPREELSQYAPKIEMIQIDPAKIKDVIGKGGDTINGIIDETGVKIDIDQDGKVSIASADAEMIQKAIKIIEELTKEVKVGEVYLGKVVRIEKFGAFVNLIKGKDGLVHISQLANERVNKVEDVVKEGDEILVKVTEIDKQGRVNLSRKALLNEDKAEKK
>NZ_CP046123.1|WP_010749124.1|3150675_3152076_-|glycoside-hydrolase-family-1-protein
MKQTFPTDFLWGASISAHQTEGAYQTDGKGLSVQDTRPRDNHEIADFTVAVDHYHKYKEDIALLAEMGIKIFRFSIAWSRIFPEGRGTINQKGLDHYSDVIDELLKHGIQPFVTLNHFDLPQALEEEGGWTKRSTVEAFAAYAKTLFTAYGDRVTHWLTINEPNIMLLVDQKILGKKIPLSEKYQQFHHLMIAEKYAFEACHEIVPNGKIGPVPNISLVYAATSRPEDNQAALYFNSVRNWAYLDFACFGRYNTVFQDYLNQNGLTIDFGPEDEALMKRALPDFVAMNFYTTVTVEQPTEAGDMKNGISDQQSEDIMERGFYKGFTNTFLKKNAFNWTIDPLGLKTTLQTLYDRYYLPIIITENGLGAEDHLEADGTVHDPYRIDYLSQHISQCLAAINAGVDLIGYSPWSAIDLISVHEGIRKRYGFIYVDRNDAQEKEQKRVRKDSFYWYQKLIEEGAIPSLEE
>NZ_CP046123.1|WP_154694622.1|3149332_3150673_-|PTS-cellobiose-transporter-subunit-IIC
MTSVFTFLETRLMPPLNKLANLRFIRAIMQAGIITVPFTIVGSIFLIINNLPQIIPPLAGFFEQTILRFSPLYSVVTTMSVGSIAVFYCLATGYYLTEIYHKEDHLTMSSFVGALLSLFAFLMTIVQVDITDGAAQLLQSESETAIVYNGISIGGWITRFSGVGIFIGIITAVLATAVYRFCVRRKITIQMPEGVPDGVSKAFASLIPAILIAFLMVAINGVLAVFHTDLHGLLSKPFEFVKELTGSWLGIIVIMLLIHLLWAVGVHGTAVIKNSFINPILLVALTENIDGANNIFAGDFVNMYIFMGGAGSTLGLVLLMLFVAKSQQLKVLGKAAILPGLFNINEPVIFGAPIVYNPYLIIPFIITPLINVTIAYFASSFGFVDKVITGIPWISPVGIGAFLGTGGDFRAILIALINLGVSILCYYPFFKMYDGKLYTEQLANHA
>NZ_CP046123.1|WP_010749126.1|3147329_3149252_+|cadmium-translocating-P-type-ATPase
MSKSESSAVFSTIACLLLMATGFLMASFSIPYSFVPYLLAILAGGWKQTWEGTQELVHDKRLNVDLLMALAAIGACIIGHWFEGAMLTFIFCLSGALEEYTTNKSTREISSLMALQPTTALKMIESGELVEVPVEALQLKDTIMVAKGSAIPIDGIVIQGNSSVDEAAISGESIPVEKRLGSEVFGGTINLGQPLYIEVTQTSENTRFAKIIQLVEEAQQMPSQTATLIEKIERIYVPIVLIAVPLMIVLCTFFTNWGFQESFYRGMVLLVVASPCALVASATPATLAAISHAARLGVLCKGGQALDAFANVKAIAFDKTGTLTRGKPAVTDVHLLLDEPFIPQLIVGMEKQSNHPLAEAILAYFHDEKPLELAVEEQAGVGLAATYQAAHWTIGKEVDLTSVAASEQTRIHELKAAGKTLIYINRDRVLAGYLALLDQPRPEARESLAYFNEQGIHTTMLTGDHLGTAKVIAAEIGLSDYESDCLPDEKTTRIKEMKETYKINAMVGDGINDAPALATASVGIAMGEGTDVAMDVADIVLMKNDLLRLVDSHRLAKKLQRIIKQNIVFSISVILLLIASNFLEFLTLPLGVVGHEGSTILVILNGLRMLLPLHKETPQQAKPTRKDCDDCVLYQQSLHT
>NZ_CP046123.1|WP_010749127.1|3145994_3147035_+|type-2-isopentenyl-diphosphate-Delta-isomerase
MNRKDEHVSLAKAFHKEHSNDFDAVRLVHQSFPQIDVADVSIATTVFDRSFSSPFFINAMTGGSEKTLKINQELAEIAQACELMMATGSVSAALKDPSVADSFRIVRKANPDGFLLANIGAGSPVENAQRAVELFDADALQIHLNAPQELVMPEGDRQFSQWLSLLEKTMASVAVPVVVKEVGFGMSRETIQQLLAIGVQTIDVAGSGGTSFTQIENARRKKRELAYLDTFGQSTVISLLEANEIQQPFTRIASGGVRDAYDIFKALCLGADSVGLSATILVLLLSKGKEETIATLQSWKEQLQLLYTMAGQTSTKDLTKVQLIFSGAVKEWCEARQIPLAKYSLR
>NZ_CP046123.1|WP_010749128.1|3144915_3145998_+|phosphomevalonate-kinase
MIELSVPGKLFIAGEYAVVEPGHPAIIVAVDQFITVTVEEARKNGSIQSAQYSDLPIRWTRRKGELVLDHRDNPFHYILAAIRLTEKYAQEKGIPLSFYDLKVTSELDNSNGRKYGLGSSGAVTVATVKALNLYYQMEMDRLTQFKIAALAHLAVQGNGSCGDIAASCYGGWIAFSTFDHDWVLTKQKDHTLTELIAFDWPGLSIRPLTVPKSLRLLIGWTGSPASTSDLVDQVYQSKEEKENAYAAFLAASKDCVNRLIDGFLNEDSRTIKKMITENRKLLRELSALTGVPIETPALKKLCDLAENYCGAAKSSGAGGGDCGIVIVDQKTGILPLMSAWEKAEITPLPLHVYHYREDLS
>NZ_CP046123.1|WP_005228088.1|3143880_3144879_+|diphosphomevalonate-decarboxylase
MYKGKARAYTNIALIKYWGKQDETFILPMNNSLSLTLDAFYTETTVAFSPDFTQDRFTLDGVVQTDAATKKVADFLDLVRKKADCPWYATVESQNFVPTAAGLASSASGLAALAGACSEALDLNLSEQALSRLARRGSGSACRSIYGGFAEWHQGTDETSFATQVPSNGWEEELSMIFILINAQAKEVSSREGMRRTVETSSFYPGWLSATASDLVKMKQAIAEKDFTALGETTEANALKMHGTTLAAEPPFTYWSSESLRAMECVRMLRKKGLACYFTMDAGPNVKVLCQKQEEQTILRELSAHFASEQLVTAHAGKGLAFLPVEESSPIN
>NZ_CP046123.1|WP_080647016.1|3142919_3143888_+|mevalonate-kinase
MWGKLPKEMRKIMSIGTGIATGKIILMGEHSVVYGEPAIAFPFAGAKVQVEITANEKNTLISSYYHGLLEEVPSHLKNVKDLLHRLQQDFHTGPFATSIVSTIPSERGMGSSAAVAVALTRAFFDWIKKDFTKEELMTYVNFSEKIAHGNPSGIDAAAASGTDAIYFIKGHPITSFPLTIDGYLLVADTGIKGQTREAVKSVAHLFETSKQLASQAIQRLGIETKRAKEAIIANQLEILGESMNNAHQALQQLGVSNQQLDQLVSSALAHGAYGAKLTGGGRGGCMIALTKTKEQAENISRILLSDGARAAWIQGLGVYEHV
>NZ_CP046123.1|WP_034696309.1|3142005_3142668_-|deoxynucleoside-kinase
MSELGDMSVIVLAGTIGAGKSSLTALIANHFGSQAFYESIDDNEVLPLFYADPNKYAFLLQIYFLNKRFESIKQAMKDDNNVLDRSIYEDSLLFHLNADLGRATDTEVKVYDELLANMLEELPYAAHKKHPDLLVHIRVSFETMLERIEKRGREYEQLTFDPSLYDYYKELNKRYDQWYEEYNESPKIQIDGDQFNFVEDPQAAQAVLTMVEDALKDARK
>NZ_CP046123.1|WP_010749131.1|3141010_3141916_-|magnesium-transporter-CorA-family-protein
MENKHVFYDGNYEWIQVDQQDAKSVMALQKQYHLSDEMLTYSLDKNERARVEYDAEEEALLLVFNVPQQEKRDNHFETSPMTFILKKKQIFTFASHDTRYVIPMMERLILQKPQQTPLHFLFQSLFLISGTFFPLVEEVNSDRIRLNQRLREKTTNKNLLQMSDLEVGLVFLVSATKQNAVLLEQIKALSIYRLMDDDEREQLDDALIEAKQAVEMTLLAFQILEQLSGTYNNLLNNNLNDTMKFLTVWSLLLTVPSIVTSFFGMNVPLPFTNSIFGWGIALLISLVLSVWMLIALWRRIR
>NZ_CP046123.1|WP_005228072.1|3154874_3155144_-|30S-ribosomal-protein-S15
MAISKERKNEIINKFARHEGDTGSPEVQIAVLTEEINHLNEHARMHKKDHHSYRGLMKKVGHRRNLLAYLRQKDVQRYRELIQALGLRR
>NZ_CP046123.1|WP_005228070.1|3155360_3156221_+|MurR/RpiR-family-transcriptional-regulator
MSVLSRIESMKNELSLSEKKLFAFMEANPEKVPSMTASQLAEATGISAPTVVRFAKKTGFASLTDLKIQLSAESGLRHNANEHLGYADVELNEPFHAITSKLSHNAQVTMNETAQLLEEQLMLAAAELIATRERIFVCGIGASSLIAQDIQQKWTRLGKIVVFENDYNLLLPQLVKNEKKSLVWVISNSGHTPEMVHLAEIAKNLGVPILSLTRFGSNPLTKLADVPLQVSRSKEANQRSAATNSIIAHLLAVDVLFYVFLSKNEKLARNIYASRQAIADFREKYL
>NZ_CP046123.1|WP_010749122.1|3156448_3157759_-|family-20-glycosylhydrolase
MNEAHNEFVDYKKATALFATMGWQMPDHQPQIVLRPSLDADFRFEKQQIIVSTPEKVYPATTKYWRDFFTDQLREGSYAAAIPERCLMIDIGRKFYSLMDLKAVVRSMACFQFTHLQLHFSENEGFRIESEQFPEIVSEEYLTKQEIRELIAYAHEHRIAIIPDFDSPGHLRQVLAQKPEWQLPTADGTRDDRALNILDSEAVAFIQEVYREYAQLFEDSTYFHIGADEFIDFDHLENFPQMIEAARERYGEKASGIEVFIDYVNELAAFVESLGFVVRVWNDGFYRLNRQEQTTLTENCQISYWTRWNQNMAPADVFFEKGYTMINHNDNFFYYVLGEAAGYTYPTYEKISNEFQLTTFANGQQVAQEQLAQTQAIALSVWADVPEAQTSREVIQAIFWLQAAIAQKVYQEKDRPKAAYQKLFDSWVVSYLEEEQ
>NZ_CP046123.1|WP_010749121.1|3158081_3158621_-|hypothetical-protein
MKNGIIVYQSKYGAVKKYVHWLQDATGFSSLETPKAKIAEVMDYDTIIFCGGIYASGIAGLSFLKKNTNQLKDKEILIFCAGASAPEEDVVKKLKEQNLTGPLKDIPLFYGRGQWQESKMNFFDRNLVKMLRKAAAKKAPHTYDPQMKALMEANGQDCDWTDKKYLGPLVDYLEQGLFQ
>NZ_CP046123.1|WP_010749120.1|3158654_3159224_-|TetR/AcrR-family-transcriptional-regulator
MPKQRITKEMVVDAAFEIARKGGMEHVIVKNIAEKLGCSVQPIYSYCTNMEGLRTEVEQKARQFLQAYLEAHSDPQDLFRSTGHAYLQLAKEEPHILSIFVLQKRANVSSLEDLYQLETNPQVAQRIAADLTISIETAKQLHMHMLIYTIGIGTIFSVTTPGIPLDEIYAQQEKAYETFLEQAIAGTKP
>NZ_CP046123.1|WP_010749119.1|3159505_3160687_-|AI-2E-family-transporter
MKETQKKPHSWFWKWFLNNQAVTSLLVILLILLILLLFTKVSYLFEPVWQFLAIVGLPIILAGILYYLMNPTVDYLERKGIKRIYSIFGLFILVVGLIVWGVVVIIPKIQEQSMSFADNLPGYLTIIENKVNEILSDPIFSQVQEQIEASNEKLISSLTDIVQNLSRSTIQNLGSFFGAVATIVLAVITMPFILFYLLKDGRKLAPYFVKFLPTKMRQPSLVVLKEMNDQVSSYIRGQLTVAFAVAVMFMIGFSIIGLDYAITLGIAAGFLNLIPYLGSFLAMIPAVFLGIVGGPVLLIQVLIVFVIEQTIEGRLISPLVLGNELSIHPVTILLVLLTSGKLFGLVGVILGIPVYAAAKVVITHVFEWYTRVSSLYKEEEPIPEAPPENTPEV
>NZ_CP046123.1|WP_005228025.1|3160702_3161056_-|PTS-glucitol/sorbitol-transporter-subunit-IIA
MKKGTIKEIGPQAIDSQERMIIFFGEEATDTLREYSVIQTIPDSQALVVTKGDQITFGDQTYQVQYVGTVVNQILQTIQHVTFVFDEVPAEDQLSSAIYLTPTVLPKLEVGMQVTYD
>NZ_CP046123.1|WP_010749118.1|3161174_3162197_+|lactonase-family-protein
MLQTIYLGTYTRRESKGIYSIALDTEKGTLTDLTLCAEEKSPTYLARSKKEAVYSVTEVDGNGGAAAYTPDFTLLNTATEEGAPLCYVAVDETRQLLYGANYHKGEVNVYKILEDGSIEATDSIYHDEPVGSHENQDKPHVHYTDLTPDQRLAVCDLGTDRVYTYDISEDGKLTEVAVYVAEDGTGPRHLVFHPTNQYAYLVGELDSSLTVLRYNEADGSFENIQKVPTIPADFTDFNSGAAVRISNDGRFVYSSNRGHNSIAVFEVTDEGAGLTFVQSISTEGDFPRDFDLDPTNDYLVCANQNSDNLTLYKRDEATGKLTVLEKDIYAPECVCVLFKK
>NZ_CP046123.1|WP_005233740.1|3162216_3162567_+|hypothetical-protein
MFDKTPKELVLKDFSNIYNKCQSTFELVTSRKYNESLVLLTTAETYAIAEKAYIRCDTAKELQTAEVIAFFDAFEIYYFELKQVLFHDDDDFVSLKNRLEKMKDTYEALTASFHLL
>NZ_CP046123.1|WP_034696319.1|3162909_3164460_+|IS1182-family-transposase
MYTNYNMNQLTLDLSTSFSPKENHVAVFIHELVEALQINDPYLFGRPREYDLGAMLKLVLFAYTRETFTSRKIERLAEENLYARWLTQERVPTYRTIARFCVSNDVQELTNKGLDQLTEYLRARNLIDDALFIDGTKILADANKYSFVWKKNTIRFDQMNREKLLTMMTELREAYALKQIPEGTTLTVDMIDELLTRMELRLEELEKEVEATKRLSPNPAKQQRRTLKSQVRKLNTKREKVLEHQTQFSTYGTRNSYSKTDHDATFMRLKEDPMKNGQLKPAYNLQIATCNQFVLGYDVFQNPTDTKTLKPLLEKMKIAQKSPHYLVADAGYGSESNYRYIEDELPQHTALIPYGTMFKEQSKKWQTDDRKVMNWDYEPKEDFYIDPKGVRFNFHAYRQRTDADGFVRDFKEYQAEKTDANQALIPEALTPKGNRRKITVNPSWEYHKEKQKERLSTPEIQKIYGRRKIDVETVFGFMKACLGFTRYTVRGLEKVRKQTGLLITAINMMKLTKIGT

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Identity
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_CP012385	Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence	115087-115111	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135340	Enterococcus faecium isolate E7356 plasmid 2	61608-61632	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_CP012367	Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence	146682-146706	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135298	Enterococcus faecium isolate E7429 plasmid 2	167426-167450	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	MT074686	Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence	186269-186293	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135279	Enterococcus faecium isolate E6975 plasmid 2	103666-103690	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135198	Enterococcus faecium isolate E6055 plasmid 2	171062-171086	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135182	Enterococcus faecium isolate E1774 plasmid 2	142461-142485	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_AP022823	Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence	53060-53084	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135489	Enterococcus faecium isolate E8414 plasmid 2	177216-177240	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135365	Enterococcus faecium isolate E8195 plasmid 2	154412-154436	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135415	Enterococcus faecium isolate E8328 plasmid 2	187352-187376	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135395	Enterococcus faecium isolate E8290 plasmid 2	187352-187376	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135345	Enterococcus faecium isolate E8202 plasmid 2	136374-136398	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135409	Enterococcus faecium isolate E8284 plasmid 2	187352-187376	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_LR135385	Enterococcus faecium isolate E7933 plasmid 2	185805-185829	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_CP040704	Enterococcus faecium strain HOU503 plasmid p1, complete sequence	15460-15484	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_CP044275	Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence	148556-148580	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_CP018066	Enterococcus faecium strain E1 plasmid pE1_230, complete sequence	126397-126421	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_AP019409	Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence	129782-129806	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NC_020208	Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence	33029-33053	1.0
NZ_CP046123_1	1.1\|989248\|25\|NZ_CP046123\|CRISPRCasFinder	989248-989272	25	NZ_MG674581	Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence	114355-114379	1.0

1. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_CP012385 (Enterococcus durans strain KLDS 6.0930 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

2. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135340 (Enterococcus faecium isolate E7356 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

3. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_CP012367 (Enterococcus durans strain KLDS 6.0933 plasmid unnamed 1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

4. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135298 (Enterococcus faecium isolate E7429 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

5. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to MT074686 (Enterococcus faecium strain E1077 plasmid pE1077-217, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

6. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135279 (Enterococcus faecium isolate E6975 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

7. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135198 (Enterococcus faecium isolate E6055 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

8. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135182 (Enterococcus faecium isolate E1774 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

9. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_AP022823 (Enterococcus saigonensis strain VE80 plasmid pVE80-1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

10. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135489 (Enterococcus faecium isolate E8414 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

11. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135365 (Enterococcus faecium isolate E8195 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

12. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135415 (Enterococcus faecium isolate E8328 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

13. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135395 (Enterococcus faecium isolate E8290 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

14. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135345 (Enterococcus faecium isolate E8202 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

15. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135409 (Enterococcus faecium isolate E8284 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

16. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_LR135385 (Enterococcus faecium isolate E7933 plasmid 2) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

17. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_CP040704 (Enterococcus faecium strain HOU503 plasmid p1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

18. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_CP044275 (Enterococcus faecium strain V2937 plasmid pHVH-V2937-1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

19. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_CP018066 (Enterococcus faecium strain E1 plasmid pE1_230, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

20. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_AP019409 (Enterococcus faecium strain SMVRE20 plasmid pSMVRE20L, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

21. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NC_020208 (Enterococcus faecium ATCC 8459 = NRRL B-2354 plasmid pNB2354_1, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

22. spacer 1.1|989248|25|NZ_CP046123|CRISPRCasFinder matches to NZ_MG674581 (Enterococcus faecium strain HL1 plasmid pHLSA, complete sequence) position: , mismatch: 0, identity: 1.0

ctaaactcgatacaaatccggaacg	CRISPR spacer
ctaaactcgatacaaatccggaacg	Protospacer
*************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

753531 : 762258

uncultured_virus(28.57%)

protease,integrase

attL 757876:757895|attR 765209:765228

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154694178.1\|753531_754962_+	6-phospho-beta-glucosidase	A0A0B5JD41	Pandoravirus	2.9e-35	28.3
WP_154694179.1\|755004_755649_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_005225291.1\|755866_756151_+	co-chaperone GroES	A0A221S465	uncultured_virus	5.2e-13	44.6
WP_154694180.1\|756183_757812_+	chaperonin GroEL	A0A219YK78	uncultured_virus	1.4e-155	56.4
757876:757895	attL	NA	NA	NA	NA
WP_154694181.1\|757896_759036_-\|integrase	tyrosine-type recombinase/integrase	A0A1P8BMN3	Lactococcus_phage	5.6e-90	48.6
WP_154694182.1\|759139_760081_-	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_154694183.1\|760093_760855_+	N-acetylmuramoyl-L-alanine amidase	A0A0B5D123	Listeria_phage	2.2e-29	56.9
WP_154694184.1\|760900_761281_+	transcriptional regulator	C9E2L2	Enterococcus_phage	5.0e-27	49.2
WP_142962785.1\|761370_762258_+	hypothetical protein	A0A1P8BLQ4	Lactococcus_phage	8.1e-36	54.2
765209:765228	attR	NA	NA	NA	NA

DBSCAN-SWA_2

964746 : 991264

Streptococcus_phage(40.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_002389568.1\|964746_965427_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.6e-119	90.7
WP_002305082.1\|965941_966835_+	ROK family protein	NA	NA	NA	NA
WP_002305084.1\|966908_968348_+	glycoside hydrolase family 1 protein	A0A0B5JD41	Pandoravirus	1.7e-51	31.5
WP_002305086.1\|968395_968698_+	PTS sugar transporter subunit IIB	NA	NA	NA	NA
WP_081132261.1\|968716_970081_+	PTS sugar transporter subunit IIC	NA	NA	NA	NA
WP_002305088.1\|970136_970451_+	PTS lactose/cellobiose transporter subunit IIA	NA	NA	NA	NA
WP_002319287.1\|970784_971831_+	LacI family transcriptional regulator	NA	NA	NA	NA
WP_154694245.1\|972180_972633_+	recombinase family protein	A0A1J1J8Z4	Escherichia_phage	2.0e-30	47.0
WP_002389568.1\|972651_973332_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.6e-119	90.7
WP_154694246.1\|973396_974534_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.4e-77	57.3
WP_154694247.1\|974894_977546_+	hypothetical protein	NA	NA	NA	NA
WP_154694248.1\|977548_978763_+	hypothetical protein	NA	NA	NA	NA
WP_154694641.1\|979177_980632_+	ATP-dependent helicase	A7J284	Streptococcus_phage	7.1e-05	20.8
WP_154694175.1\|980810_981973_-\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.6
WP_154694249.1\|982183_982756_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.4e-20	39.7
WP_124007094.1\|982940_983648_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_028790832.1\|983876_984215_+	hypothetical protein	NA	NA	NA	NA
WP_014125708.1\|984199_984613_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_154694250.1\|984622_984871_+	hypothetical protein	NA	NA	NA	NA
WP_154694226.1\|984935_986321_+\|transposase	ISNCY family transposase	NA	NA	NA	NA
WP_154694642.1\|986398_986662_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_003103602.1\|986808_987042_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_154694251.1\|987239_989102_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	9.8e-100	35.5
WP_005237711.1\|989371_989551_+	hypothetical protein	NA	NA	NA	NA
WP_142429341.1\|990123_991264_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.5e-77	57.3

DBSCAN-SWA_3

994384 : 1051792

Streptococcus_phage(31.25%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114148892.1\|994384_995795_+\|transposase	IS3 family transposase	A0A0C5AC89	Paenibacillus_phage	1.8e-21	31.3
WP_154694253.1\|995887_996514_-	CadD family cadmium resistance transporter	NA	NA	NA	NA
WP_154694254.1\|996914_997109_-	hypothetical protein	NA	NA	NA	NA
WP_086293440.1\|997976_998240_+	hypothetical protein	NA	NA	NA	NA
WP_081132265.1\|998570_998924_+	hypothetical protein	NA	NA	NA	NA
WP_115224856.1\|999496_999583_-	type I toxin-antitoxin system Fst family toxin	NA	NA	NA	NA
WP_154694255.1\|999704_999938_+	hypothetical protein	NA	NA	NA	NA
WP_002337562.1\|1000466_1001423_-	hypothetical protein	NA	NA	NA	NA
WP_002337563.1\|1001708_1002086_+	hypothetical protein	NA	NA	NA	NA
WP_016612331.1\|1002801_1003281_+	phage transcriptional regulator, ArpU family	NA	NA	NA	NA
WP_002290540.1\|1003513_1003717_+	hypothetical protein	NA	NA	NA	NA
WP_154694256.1\|1004109_1004796_+\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_002337544.1\|1005324_1005780_+	copper-responsive transcriptional repressor TcrY	NA	NA	NA	NA
WP_002337543.1\|1005792_1008258_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	1.5e-103	35.6
WP_002294571.1\|1008341_1008548_+	copper chaperone TcrZ	NA	NA	NA	NA
WP_086294040.1\|1008686_1010789_+	copper-translocating P-type ATPase TcrB	A0A218MNH6	uncultured_virus	1.7e-60	30.3
WP_154694175.1\|1012017_1013179_+\|transposase	IS3 family transposase	A0A2I7SC85	Paenibacillus_phage	2.0e-79	51.6
WP_002337548.1\|1013682_1014372_-	class A sortase	NA	NA	NA	NA
WP_002337549.1\|1014374_1015742_-	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	8.4e-16	41.3
WP_002337550.1\|1016014_1016419_+	NusG domain II-containing protein	NA	NA	NA	NA
WP_005237611.1\|1016620_1017904_+	hypothetical protein	NA	NA	NA	NA
WP_154694257.1\|1018504_1018690_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002307648.1\|1018686_1018911_-	DUF2933 domain-containing protein	NA	NA	NA	NA
WP_002294779.1\|1018894_1019698_-	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_002319974.1\|1019853_1020468_+	TIGR01906 family membrane protein	NA	NA	NA	NA
WP_154694258.1\|1020483_1020849_+	CopY family transcriptional regulator	NA	NA	NA	NA
WP_154694259.1\|1020832_1023277_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-88	31.0
WP_002325575.1\|1023293_1023503_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_002294786.1\|1024144_1024369_+	heavy-metal-associated domain-containing protein	NA	NA	NA	NA
WP_142429341.1\|1024505_1025646_+\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	2.5e-77	57.3
WP_154694260.1\|1025828_1027352_+	multicopper oxidase domain-containing protein	NA	NA	NA	NA
WP_002294790.1\|1027379_1028060_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-36	37.4
WP_154694261.1\|1028059_1029454_+	GHKL domain-containing protein	W8CYF6	Bacillus_phage	7.2e-39	33.2
WP_154694262.1\|1029468_1029675_+	hypothetical protein	NA	NA	NA	NA
WP_154694263.1\|1029704_1030292_+	DUF1541 domain-containing protein	NA	NA	NA	NA
WP_105208453.1\|1030974_1031661_-\|transposase	IS6-like element IS1216 family transposase	A0A1X9I6C6	Streptococcus_phage	5.9e-127	99.1
WP_003104876.1\|1032748_1033255_+	ECF transporter S component	NA	NA	NA	NA
WP_003105997.1\|1033238_1033613_+	DUF4430 domain-containing protein	NA	NA	NA	NA
WP_003105575.1\|1033646_1035437_-	oligoendopeptidase F	A0A1X9I5X5	Streptococcus_phage	3.5e-102	36.3
WP_154694264.1\|1035631_1038448_+	phosphoenolpyruvate carboxylase	NA	NA	NA	NA
WP_154694265.1\|1038587_1040699_+\|tRNA	lysine--tRNA ligase	A0A2K9L3L6	Tupanvirus	1.8e-89	40.9
WP_154694266.1\|1040818_1043857_+	AAA family ATPase	NA	NA	NA	NA
WP_154694267.1\|1043910_1044921_-	formimidoylglutamase	NA	NA	NA	NA
WP_154694268.1\|1047679_1048039_-	Cd(II)-sensing metalloregulatory transcriptional repressor CadC	E4ZFI8	Streptococcus_phage	4.0e-26	50.0
WP_154694269.1\|1048318_1048873_+	helix-turn-helix domain-containing protein	A0A0F7LA37	Escherichia_phage	7.0e-38	53.4
WP_154694270.1\|1048876_1051792_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	8.0e-173	36.8

DBSCAN-SWA_4

1230285 : 1238875

Escherichia_phage(37.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010747881.1\|1230285_1231233_+	DUF616 domain-containing protein	A0A1V0SIH1	Klosneuvirus	3.0e-12	25.6
WP_154694304.1\|1231372_1232614_+	oligosaccharide repeat unit polymerase	NA	NA	NA	NA
WP_010747883.1\|1232660_1233530_+	glucose-1-phosphate thymidylyltransferase RfbA	K7QKA7	Escherichia_phage	5.8e-103	63.7
WP_010747884.1\|1233532_1234114_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	3.5e-40	47.3
WP_010747885.1\|1234128_1235157_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	3.6e-72	43.6
WP_010747886.1\|1235207_1236038_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	9.3e-34	37.4
WP_010747887.1\|1236090_1237257_+	nucleotide sugar dehydrogenase	M1HZB2	Paramecium_bursaria_Chlorella_virus	1.4e-104	52.1
WP_010747888.1\|1237278_1238151_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.1e-72	49.7
WP_154694305.1\|1238260_1238875_-	helix-turn-helix domain-containing protein	A0A0S2MVM8	Bacillus_phage	9.3e-07	39.6

DBSCAN-SWA_5

1349108 : 1391999

Enterococcus_phage(28.57%)

terminase,integrase,coat,tail,head,portal

attL 1341811:1341825|attR 1359900:1359914

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1341811:1341825	attL	NA	NA	NA	NA
WP_154694332.1\|1349108_1350251_-\|integrase	tyrosine-type recombinase/integrase	Q9AZR0	Lactococcus_phage	2.1e-92	47.3
WP_034872770.1\|1350340_1350754_-	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_154694333.1\|1350764_1351160_-	helix-turn-helix domain-containing protein	A0A1S5SDR1	Streptococcus_phage	1.6e-15	36.2
WP_154694334.1\|1351344_1351542_+	XRE family transcriptional regulator	A0A0C5AC96	Paenibacillus_phage	7.3e-06	39.3
WP_144770898.1\|1351554_1351875_+	DUF771 domain-containing protein	Q4ZC28	Staphylococcus_virus	1.2e-08	29.6
WP_154694335.1\|1351998_1352232_-	hypothetical protein	NA	NA	NA	NA
WP_154694336.1\|1352307_1353057_+	phage antirepressor	A0A1Q1PVU2	Staphylococcus_phage	1.7e-63	51.8
WP_121262166.1\|1353136_1353685_-	hypothetical protein	NA	NA	NA	NA
WP_154694337.1\|1353818_1354295_-	hypothetical protein	NA	NA	NA	NA
WP_154694338.1\|1354341_1354623_+	hypothetical protein	NA	NA	NA	NA
WP_154694339.1\|1354921_1355182_+	hypothetical protein	NA	NA	NA	NA
WP_154694340.1\|1355268_1355604_+	hypothetical protein	NA	NA	NA	NA
WP_154694341.1\|1355600_1356245_+	recombinase	A0A2I7QYL5	Vibrio_phage	1.1e-34	47.3
WP_154694342.1\|1356250_1356928_+	hypothetical protein	A0A0S2MYA3	Enterococcus_phage	2.2e-73	57.3
WP_154694343.1\|1356932_1357721_+	DnaD domain protein	A0A0S2MYA8	Enterococcus_phage	1.1e-39	57.3
WP_142962877.1\|1357725_1358562_+	AAA family ATPase	Q8LTN1	Lactococcus_phage	2.7e-17	27.7
WP_154694344.1\|1358564_1358765_+	hypothetical protein	NA	NA	NA	NA
WP_142962879.1\|1358754_1359168_+	hypothetical protein	NA	NA	NA	NA
WP_154694644.1\|1359248_1359533_+	RusA family crossover junction endodeoxyribonuclease	A0A0A7RTR1	Clostridium_phage	6.6e-24	59.8
WP_154694345.1\|1359529_1359709_+	hypothetical protein	NA	NA	NA	NA
WP_154694346.1\|1359705_1360176_+	single-stranded DNA-binding protein	A0A2P0VJ33	Streptococcus_phage	2.9e-48	66.9
1359900:1359914	attR	NA	NA	NA	NA
WP_154694347.1\|1360488_1361088_+	DUF1642 domain-containing protein	A0A0C5JZC6	Enterococcus_phage	5.9e-22	66.7
WP_154694348.1\|1361091_1361325_+	hypothetical protein	NA	NA	NA	NA
WP_154694349.1\|1361321_1361636_+	hypothetical protein	NA	NA	NA	NA
WP_051095343.1\|1361851_1362253_+	hypothetical protein	NA	NA	NA	NA
WP_154694350.1\|1362290_1362686_+	hypothetical protein	NA	NA	NA	NA
WP_154694645.1\|1362688_1363054_+	hypothetical protein	NA	NA	NA	NA
WP_154694351.1\|1363338_1363596_+	hypothetical protein	NA	NA	NA	NA
WP_154694352.1\|1363585_1363777_+	hypothetical protein	NA	NA	NA	NA
WP_154694353.1\|1363779_1363974_+	hypothetical protein	NA	NA	NA	NA
WP_154694646.1\|1364063_1364264_+	hypothetical protein	NA	NA	NA	NA
WP_113849809.1\|1364264_1364678_+	hypothetical protein	A0A2H4JB30	uncultured_Caudovirales_phage	7.6e-13	32.8
WP_154694354.1\|1365523_1366720_+	helix-turn-helix domain-containing protein	E3W8E5	Leuconostoc_phage	4.4e-85	43.3
WP_154694355.1\|1367207_1367687_+\|terminase	terminase small subunit	A0A1S5S7T9	Streptococcus_phage	6.1e-38	54.5
WP_154694356.1\|1367679_1369002_+\|terminase	PBSX family phage terminase large subunit	D2J001	Enterococcus_phage	5.6e-158	64.6
WP_154694357.1\|1369015_1370434_+\|portal	phage portal protein	D2J002	Enterococcus_phage	1.6e-243	90.4
WP_154694358.1\|1370423_1370729_+	hypothetical protein	NA	NA	NA	NA
WP_154694359.1\|1370741_1371890_+\|head	phage head morphogenesis protein	D2J004	Enterococcus_phage	8.3e-158	73.8
WP_154694360.1\|1371973_1372642_+	DUF4355 domain-containing protein	D2J005	Enterococcus_phage	4.9e-62	83.3
WP_154694361.1\|1372657_1373692_+\|coat	coat protein	D2J006	Enterococcus_phage	5.0e-178	93.0
WP_154694362.1\|1373703_1374030_+	hypothetical protein	A0A059NT99	Lactococcus_phage	9.2e-30	62.3
WP_154694363.1\|1374010_1374361_+	hypothetical protein	A0A059NT74	Lactococcus_phage	1.2e-30	60.2
WP_154694364.1\|1374350_1374893_+	HK97 gp10 family phage protein	A0A182BQ89	Lactococcus_phage	1.2e-69	68.3
WP_154694365.1\|1374892_1375255_+	hypothetical protein	A0A059NT89	Lactococcus_phage	5.4e-39	63.3
WP_086317165.1\|1375267_1375690_+\|tail	phage tail protein	A0A182BQ87	Lactococcus_phage	5.7e-56	76.5
WP_154694366.1\|1375785_1376193_+	hypothetical protein	D2J012	Enterococcus_phage	3.3e-53	79.4
WP_154694367.1\|1376216_1376591_+	hypothetical protein	D2J013	Enterococcus_phage	2.4e-34	61.7
WP_154694368.1\|1376601_1381509_+\|tail	phage tail protein	A0A059NT57	Lactococcus_phage	2.6e-253	53.2
WP_010749498.1\|1381522_1381879_+	hypothetical protein	A0A1S5SCJ5	Streptococcus_phage	8.0e-35	60.5
WP_154694369.1\|1381890_1385937_+	hypothetical protein	D7RWK2	Brochothrix_phage	1.1e-07	55.6
WP_154694647.1\|1385959_1386370_+	DUF1617 family protein	NA	NA	NA	NA
WP_154694370.1\|1386412_1386661_+	hypothetical protein	Q6SE67	Lactobacillus_prophage	1.4e-06	36.6
WP_010749285.1\|1386695_1386989_+	hypothetical protein	NA	NA	NA	NA
WP_010749286.1\|1386990_1387236_+	hypothetical protein	A0A1U9WRD5	Streptococcus_virus	4.7e-10	49.3
WP_154694371.1\|1387274_1388054_+	hypothetical protein	A0A0B5D123	Listeria_phage	3.9e-50	55.6
WP_154694648.1\|1388814_1389210_+	DUF4065 domain-containing protein	I6R0L8	Salmonella_phage	4.3e-13	35.4
WP_154694372.1\|1389213_1389651_+	hypothetical protein	NA	NA	NA	NA
WP_154694373.1\|1389713_1390352_-	hypothetical protein	NA	NA	NA	NA
WP_154694374.1\|1390483_1390777_-	hypothetical protein	NA	NA	NA	NA
WP_154694375.1\|1390667_1391009_-	hypothetical protein	NA	NA	NA	NA
WP_154694376.1\|1390938_1391229_-	hypothetical protein	NA	NA	NA	NA
WP_154694377.1\|1391381_1391999_-	DUF4352 domain-containing protein	A0A059T7Z1	Listeria_phage	3.2e-31	41.5

DBSCAN-SWA_6

1741341 : 1754245

Streptococcus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154694455.1\|1741341_1742532_+	ImmA/IrrE family metallo-endopeptidase	A0A0A7RTT7	Clostridium_phage	1.6e-34	29.6
WP_154694456.1\|1742607_1742775_+	hypothetical protein	NA	NA	NA	NA
WP_154694457.1\|1742853_1743996_+	DNA (cytosine-5-)-methyltransferase	A0A1S5SEK0	Streptococcus_phage	9.5e-130	62.6
WP_154694458.1\|1743985_1744276_+	hypothetical protein	NA	NA	NA	NA
WP_154694459.1\|1744535_1745717_+	helix-turn-helix domain-containing protein	A0A1S5SEX3	Streptococcus_phage	1.4e-136	59.8
WP_125282204.1\|1745713_1745851_+	DUF3789 domain-containing protein	NA	NA	NA	NA
WP_002298822.1\|1745855_1746077_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	4.5e-28	87.7
WP_154694460.1\|1746089_1746593_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	4.3e-50	57.6
WP_154694461.1\|1746666_1747494_+	hypothetical protein	NA	NA	NA	NA
WP_154694462.1\|1747500_1748229_-	hypothetical protein	NA	NA	NA	NA
WP_154694463.1\|1748292_1748682_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	1.0e-43	68.3
WP_154694464.1\|1748668_1751116_+	ATP/GTP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.4
WP_154694465.1\|1751120_1753244_+	FUSC family protein	A0A1S5SF30	Streptococcus_phage	8.9e-182	59.4
WP_154694466.1\|1753240_1754245_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	2.1e-117	63.5

DBSCAN-SWA_7

2184729 : 2259013

Enterococcus_phage(40.48%)

tRNA,transposase,terminase,holin,tail,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010749526.1\|2184729_2186163_+\|tRNA	proline--tRNA ligase	A0A2K9L3R9	Tupanvirus	5.1e-88	43.5
WP_010749525.1\|2186208_2187213_-	lipoate--protein ligase	NA	NA	NA	NA
WP_005229857.1\|2187231_2187972_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_010749524.1\|2188178_2188949_-	DUF975 family protein	NA	NA	NA	NA
WP_010749523.1\|2188973_2190056_-	M42 family metallopeptidase	NA	NA	NA	NA
WP_010749522.1\|2190244_2192299_-	ABC transporter permease	NA	NA	NA	NA
WP_010749521.1\|2192288_2193053_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.8e-29	35.5
WP_010749520.1\|2193340_2195536_+	anaerobic ribonucleoside-triphosphate reductase	A0A0C5KKX3	Enterococcus_phage	1.0e-273	65.0
WP_005229836.1\|2195619_2196216_+	anaerobic ribonucleoside-triphosphate reductase activating protein	A0A0C5K925	Enterococcus_phage	2.3e-50	54.5
WP_010749519.1\|2196352_2197009_-	DNA alkylation repair protein	NA	NA	NA	NA
WP_010749518.1\|2197028_2198153_-	DNA polymerase IV	NA	NA	NA	NA
WP_005229830.1\|2198303_2198645_-	P-II family nitrogen regulator	NA	NA	NA	NA
WP_154694514.1\|2198661_2199879_-	ammonium transporter	NA	NA	NA	NA
WP_154694515.1\|2200050_2200911_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	2.9e-83	57.6
WP_080646990.1\|2200981_2201329_-	DNA replication initiation control protein YabA	M1PFV3	Streptococcus_phage	1.6e-16	39.3
WP_005229821.1\|2201348_2202149_-	stage 0 sporulation family protein	NA	NA	NA	NA
WP_005231923.1\|2202178_2203111_-	DNA polymerase III subunit delta'	A0A1L2BWV7	Bacteriophage	4.5e-13	33.3
WP_005229817.1\|2203125_2203455_-	hypothetical protein	NA	NA	NA	NA
WP_005229815.1\|2203487_2204135_-	dTMP kinase	M1PSC7	Streptococcus_phage	8.2e-54	52.7
WP_005229813.1\|2204155_2204752_-	recombination protein RecR	NA	NA	NA	NA
WP_005229811.1\|2204766_2205081_-	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_010749515.1\|2205101_2206823_-	DNA polymerase III subunit gamma/tau	A0A1U9WR94	Streptococcus_virus	1.6e-51	41.9
WP_154694516.1\|2207106_2208336_+	virion core protein	NA	NA	NA	NA
WP_010749513.1\|2208352_2209474_+	hypothetical protein	NA	NA	NA	NA
WP_010749512.1\|2209470_2210295_+	TPM domain-containing protein	NA	NA	NA	NA
WP_010749511.1\|2210493_2211462_-	pyridoxal-phosphate dependent enzyme	NA	NA	NA	NA
WP_005229799.1\|2211672_2212692_+	branched-chain amino acid aminotransferase	NA	NA	NA	NA
WP_114148908.1\|2213215_2214490_+\|transposase	ISL3 family transposase	A0A2D1GQC1	Lysinibacillus_phage	5.4e-09	21.2
WP_010749509.1\|2214864_2215428_+	DUF5067 domain-containing protein	NA	NA	NA	NA
WP_010749508.1\|2215531_2215822_+	hypothetical protein	NA	NA	NA	NA
WP_080646991.1\|2215751_2216090_+	hypothetical protein	NA	NA	NA	NA
WP_034695953.1\|2216010_2216295_+	hypothetical protein	NA	NA	NA	NA
WP_010749505.1\|2216452_2217913_-	hypothetical protein	NA	NA	NA	NA
WP_010749504.1\|2217937_2218975_-	hypothetical protein	NA	NA	NA	NA
WP_010749503.1\|2219799_2220579_-	hypothetical protein	A0A0B5D123	Listeria_phage	1.7e-50	56.1
WP_010749502.1\|2220617_2221115_-\|holin	phage holin family protein	A0A097BY69	Enterococcus_phage	9.7e-47	70.7
WP_010749501.1\|2221230_2221479_-	hypothetical protein	Q6SE67	Lactobacillus_prophage	3.4e-08	41.3
WP_034696047.1\|2221500_2221911_-	DUF1617 family protein	NA	NA	NA	NA
WP_010749499.1\|2221933_2225980_-	hypothetical protein	D7RWK2	Brochothrix_phage	1.1e-07	55.6
WP_010749498.1\|2225991_2226348_-	hypothetical protein	A0A1S5SCJ5	Streptococcus_phage	8.0e-35	60.5
WP_010749497.1\|2226361_2231257_-	transglycosylase SLT domain-containing protein	A0A059NT57	Lactococcus_phage	3.6e-250	50.7
WP_010749496.1\|2231267_2231642_-	hypothetical protein	D2J013	Enterococcus_phage	1.2e-38	67.5
WP_010749495.1\|2231665_2232073_-	hypothetical protein	D2J012	Enterococcus_phage	6.3e-52	75.0
WP_010749494.1\|2232112_2232376_-	hypothetical protein	C9E2K1	Enterococcus_phage	1.5e-17	67.5
WP_008377743.1\|2232396_2232810_-\|tail	major tail protein	A0A182BQ87	Lactococcus_phage	1.1e-56	77.6
WP_010749493.1\|2232822_2233185_-	hypothetical protein	A0A059NT89	Lactococcus_phage	5.4e-39	63.3
WP_010749492.1\|2233184_2233727_-	hypothetical protein	A0A182BQ89	Lactococcus_phage	2.9e-68	68.3
WP_010749491.1\|2233716_2234067_-	hypothetical protein	A0A059NT74	Lactococcus_phage	2.2e-29	59.3
WP_010749490.1\|2234063_2234399_-	hypothetical protein	D2J007	Enterococcus_phage	4.7e-13	44.8
WP_010749489.1\|2234412_2234673_-	hypothetical protein	NA	NA	NA	NA
WP_010749488.1\|2234684_2235707_-	hypothetical protein	S5MA55	Brevibacillus_phage	3.7e-125	65.8
WP_010749487.1\|2235729_2236056_-	hypothetical protein	NA	NA	NA	NA
WP_010749486.1\|2236076_2236742_-	DUF4355 domain-containing protein	Q6SE80	Lactobacillus_prophage	1.1e-13	30.4
WP_010749485.1\|2236901_2237105_-	hypothetical protein	NA	NA	NA	NA
WP_010749483.1\|2238531_2238837_-	hypothetical protein	NA	NA	NA	NA
WP_010749482.1\|2238826_2240269_-\|portal	phage portal protein	D2J002	Enterococcus_phage	6.0e-113	46.9
WP_034695954.1\|2240273_2241617_-\|terminase	PBSX family phage terminase large subunit	A0A1B1UZZ1	Enterococcus_phage	3.3e-158	66.4
WP_010749480.1\|2241588_2242095_-\|terminase	terminase small subunit	A0A2K9V3C4	Faecalibacterium_phage	1.9e-37	58.5
WP_010749479.1\|2242354_2242948_-	hypothetical protein	NA	NA	NA	NA
WP_010749478.1\|2243187_2243418_-	hypothetical protein	NA	NA	NA	NA
WP_114148912.1\|2243615_2243999_-	sigma-70 family RNA polymerase sigma factor	A0A1J0MFD1	Staphylococcus_phage	1.9e-13	33.6
WP_010749476.1\|2244028_2244256_-	hypothetical protein	A0A097BY46	Enterococcus_phage	1.2e-20	54.3
WP_010749475.1\|2244256_2244649_-	RusA family crossover junction endodeoxyribonuclease	A0A097BY81	Enterococcus_phage	7.2e-53	72.3
WP_010749474.1\|2245061_2247287_-	AAA family ATPase	A0A097BY39	Enterococcus_phage	0.0e+00	84.1
WP_010749473.1\|2247344_2248229_+	DUF4393 domain-containing protein	A0A1S5SAN8	Streptococcus_phage	2.4e-32	35.9
WP_010749471.1\|2248681_2248870_-	hypothetical protein	NA	NA	NA	NA
WP_010749469.1\|2249041_2249281_-	hypothetical protein	NA	NA	NA	NA
WP_010749468.1\|2249280_2249433_-	hypothetical protein	NA	NA	NA	NA
WP_010749467.1\|2249435_2251037_-	DEAD/DEAH box helicase	A0A097BY72	Enterococcus_phage	2.0e-266	85.9
WP_010749466.1\|2251091_2251850_+	DUF4145 domain-containing protein	A0A1X9I5M7	Streptococcus_phage	4.2e-33	35.4
WP_010749465.1\|2251827_2252058_-	hypothetical protein	NA	NA	NA	NA
WP_010749464.1\|2252069_2252834_-	hypothetical protein	A0A097BY87	Enterococcus_phage	3.6e-85	63.5
WP_010749463.1\|2252838_2253267_-	hypothetical protein	A0A097BY30	Enterococcus_phage	4.4e-56	76.1
WP_010749462.1\|2253279_2253897_-	hypothetical protein	A0A097BY29	Enterococcus_phage	5.8e-73	83.0
WP_010749461.1\|2253909_2254977_-	ATP-binding protein	A0A097BY66	Enterococcus_phage	5.1e-162	77.5
WP_010749460.1\|2254976_2256317_-	AAA family ATPase	Q5YA97	Bacillus_phage	1.9e-158	74.3
WP_010749459.1\|2256313_2256646_-	hypothetical protein	NA	NA	NA	NA
WP_051095380.1\|2256673_2257267_-	hypothetical protein	NA	NA	NA	NA
WP_010749457.1\|2257267_2257498_-	HTH domain-containing protein	NA	NA	NA	NA
WP_010749456.1\|2257675_2257870_-	hypothetical protein	NA	NA	NA	NA
WP_010749455.1\|2257872_2258157_-	hypothetical protein	NA	NA	NA	NA
WP_010749454.1\|2258156_2258348_-	transcriptional regulator	NA	NA	NA	NA
WP_010749453.1\|2258662_2259013_+	helix-turn-helix transcriptional regulator	A0A1S5SED8	Streptococcus_phage	1.1e-25	54.8

DBSCAN-SWA_8

2409832 : 2423740

Escherichia_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_010749354.1\|2409832_2412907_-	glycosyltransferase	A0A1V0SAH6	Catovirus	4.4e-12	40.8
WP_010749353.1\|2412933_2414163_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	8.7e-12	27.0
WP_005229524.1\|2414164_2414965_-	ABC transporter permease	NA	NA	NA	NA
WP_154694527.1\|2415174_2416341_-	nucleotide sugar dehydrogenase	M1HV26	Paramecium_bursaria_Chlorella_virus	8.8e-99	49.6
WP_010749350.1\|2416357_2417209_-	dTDP-4-dehydrorhamnose reductase	A0A1D8EQE2	Escherichia_phage	2.7e-28	35.2
WP_010749349.1\|2417251_2418280_-	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	1.4e-71	43.4
WP_010749348.1\|2418292_2418865_-	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	4.6e-40	49.2
WP_010749347.1\|2418880_2419747_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.2e-103	62.8
WP_010749346.1\|2419853_2420558_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_010749345.1\|2420554_2421385_-	glycosyltransferase	NA	NA	NA	NA
WP_005229506.1\|2421384_2422173_-	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_005229504.1\|2422441_2423740_-\|tRNA	asparagine--tRNA ligase	A0A2P1EMB4	Moumouvirus	6.5e-58	30.0

DBSCAN-SWA_9

2535467 : 2602632

Lactococcus_phage(44.83%)

transposase,holin,tail,capsid,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_114148911.1\|2535467_2536879_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	6.8e-37	44.0
WP_005229243.1\|2536979_2537624_-	V-type ATP synthase subunit D	NA	NA	NA	NA
WP_005237151.1\|2537623_2539012_-	V-type ATP synthase subunit B	NA	NA	NA	NA
WP_010749209.1\|2539011_2540787_-	V-type ATP synthase subunit A	NA	NA	NA	NA
WP_005229240.1\|2540818_2541133_-	V-type ATP synthase subunit F	NA	NA	NA	NA
WP_005229238.1\|2541125_2542127_-	V-type ATP synthase subunit C	NA	NA	NA	NA
WP_010749208.1\|2542141_2542732_-	hypothetical protein	NA	NA	NA	NA
WP_005229236.1\|2542748_2543222_-	V-type ATP synthase subunit K	NA	NA	NA	NA
WP_010749207.1\|2543205_2545197_-	V-type ATP synthase subunit I	NA	NA	NA	NA
WP_010749206.1\|2545197_2545509_-	hypothetical protein	NA	NA	NA	NA
WP_010749205.1\|2545893_2547111_-	arginine deiminase	NA	NA	NA	NA
WP_154694533.1\|2547544_2549542_+	cellulase family glycosylhydrolase	NA	NA	NA	NA
WP_154694534.1\|2549624_2550077_-	hypothetical protein	NA	NA	NA	NA
WP_010749202.1\|2550274_2551795_-\|transposase	IS66 family transposase	NA	NA	NA	NA
WP_010749201.1\|2551890_2552247_-	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_002300846.1\|2552236_2552419_-	hypothetical protein	NA	NA	NA	NA
WP_034696083.1\|2559356_2560862_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	2.8e-20	25.2
WP_005229193.1\|2560876_2561563_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.8e-28	31.7
WP_010749660.1\|2561702_2563124_-	NADP-dependent phosphogluconate dehydrogenase	E3SIC7	Synechococcus_phage	1.4e-34	31.5
WP_005229191.1\|2563310_2563490_-	50S ribosomal protein L32	NA	NA	NA	NA
WP_010749661.1\|2563546_2564107_-	DUF177 domain-containing protein	NA	NA	NA	NA
WP_005229179.1\|2564302_2566087_-	pyruvate kinase	NA	NA	NA	NA
WP_005229169.1\|2566170_2567133_-	6-phosphofructokinase	NA	NA	NA	NA
WP_010749662.1\|2567294_2570606_-	DNA polymerase III subunit alpha	A0A291AVG1	Streptomyces_phage	2.0e-151	32.3
WP_008377814.1\|2570753_2570936_+	YjzD family protein	NA	NA	NA	NA
WP_005231893.1\|2570983_2572189_-	multidrug efflux MFS transporter	NA	NA	NA	NA
WP_010749663.1\|2572290_2573730_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.4e-39	28.6
WP_154694535.1\|2573991_2574795_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_010749664.1\|2574849_2576745_-	asparagine synthase (glutamine-hydrolyzing)	F2Y1H0	Organic_Lake_phycodnavirus	6.8e-24	27.5
WP_005229151.1\|2577420_2577609_-	hypothetical protein	NA	NA	NA	NA
WP_010749665.1\|2577837_2578497_+	hypothetical protein	NA	NA	NA	NA
WP_154694536.1\|2579496_2581611_-	YfhO family protein	NA	NA	NA	NA
WP_154694537.1\|2582011_2583007_+	glycosyltransferase	NA	NA	NA	NA
WP_154694538.1\|2583076_2583856_-	hypothetical protein	A0A0B5D123	Listeria_phage	3.0e-50	55.6
WP_154694539.1\|2583894_2584392_-\|holin	holin	A0A097BY69	Enterococcus_phage	1.7e-46	69.9
WP_154694540.1\|2584505_2584709_-	hypothetical protein	NA	NA	NA	NA
WP_154694541.1\|2584722_2588937_-	hypothetical protein	Q38319	Lactococcus_phage	5.2e-56	25.6
WP_154694542.1\|2588917_2590423_-	hypothetical protein	A0A2H4J836	uncultured_Caudovirales_phage	1.8e-35	26.5
WP_154694543.1\|2590426_2592796_-\|tail	phage tail protein	A0A1B1IMY1	Lactococcus_phage	9.1e-135	56.1
WP_154694544.1\|2592795_2593179_-	hypothetical protein	M1PS20	Streptococcus_phage	5.6e-34	60.6
WP_154694545.1\|2593190_2593454_-	hypothetical protein	A0A1P8BMR6	Lactococcus_phage	4.5e-19	52.3
WP_154694546.1\|2593450_2594032_-\|tail	phage tail protein	A0A1P8BMS0	Lactococcus_phage	3.2e-65	67.6
WP_154694547.1\|2594043_2594379_-	hypothetical protein	A0A1B1IMT0	Lactococcus_phage	6.6e-39	73.9
WP_041120510.1\|2594379_2594616_-	hypothetical protein	M1NRG9	Streptococcus_phage	2.1e-23	71.8
WP_154694548.1\|2594608_2594947_-	hypothetical protein	A0A1P8BMP0	Lactococcus_phage	8.9e-44	72.3
WP_154694549.1\|2594888_2595332_-	hypothetical protein	A0A1B1IMX8	Lactococcus_phage	4.6e-48	76.9
WP_154694550.1\|2595336_2595663_-	hypothetical protein	A0A1P8BKC8	Lactococcus_phage	1.3e-10	41.8
WP_142964708.1\|2595662_2596565_-\|capsid	phage major capsid protein	A0A1P8BML3	Lactococcus_phage	2.6e-106	64.4
WP_142964707.1\|2596569_2597031_-	DUF4355 domain-containing protein	A0A1B1IMS4	Lactococcus_phage	3.0e-34	55.0
WP_154694551.1\|2597111_2598521_-\|terminase	terminase	A0A1P8BMS5	Lactococcus_phage	1.4e-223	78.5
WP_154694552.1\|2598580_2599342_-	hypothetical protein	A0A1B1IMX1	Lactococcus_phage	1.9e-86	57.8
WP_154694553.1\|2599334_2600576_-\|portal	phage portal protein	M1PKV8	Streptococcus_phage	3.3e-176	73.5
WP_154694554.1\|2600723_2601056_-	HNH endonuclease	O64273	Lactococcus_phage	3.7e-50	82.4
WP_142972057.1\|2601089_2601437_-	hypothetical protein	A0A1J1J9Q7	Escherichia_phage	2.9e-21	46.7
WP_154694555.1\|2601433_2601628_-	hypothetical protein	D2IYV2	Enterococcus_phage	5.3e-17	67.7
WP_154694556.1\|2601687_2601894_-	sporulation protein Cse60	NA	NA	NA	NA
WP_142972060.1\|2602152_2602632_-	hypothetical protein	A0A2H4JFW6	uncultured_Caudovirales_phage	2.9e-24	43.7

DBSCAN-SWA_10

3031614 : 3038636

Streptococcus_phage(85.71%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_154694614.1\|3031614_3032736_+	DNA (cytosine-5-)-methyltransferase	Q6V7R9	Burkholderia_virus	1.1e-40	32.6
WP_002405419.1\|3032957_3033365_+	hypothetical protein	NA	NA	NA	NA
WP_005228395.1\|3033512_3033827_+	YdcP family protein	A0A1S5SF38	Streptococcus_phage	1.8e-38	74.8
WP_002405422.1\|3033842_3034208_+	YdcP family protein	A0A1S5SF96	Streptococcus_phage	8.7e-45	75.2
WP_154694615.1\|3034211_3035588_+	DUF87 domain-containing protein	A0A1S5SFB5	Streptococcus_phage	5.4e-164	66.6
WP_002405424.1\|3035577_3035862_+	hypothetical protein	NA	NA	NA	NA
WP_002405425.1\|3035915_3036269_+	hypothetical protein	NA	NA	NA	NA
WP_002405427.1\|3036693_3037884_+	helix-turn-helix domain-containing protein	A0A1S5SEX3	Streptococcus_phage	7.3e-149	65.4
WP_002405428.1\|3037897_3038119_+	hypothetical protein	A0A1S5SEY0	Streptococcus_phage	2.4e-29	91.8
WP_010783150.1\|3038135_3038636_+	antirestriction protein ArdA	A0A1S5SF25	Streptococcus_phage	4.0e-56	64.8

DBSCAN-SWA_11

3042738 : 3054636

Streptococcus_phage(88.89%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005228382.1\|3042738_3043146_+	conjugal transfer protein	A0A1S5SEX7	Streptococcus_phage	4.4e-45	65.4
WP_033593701.1\|3043120_3045577_+	ATP-binding protein	A0A1S5SF64	Streptococcus_phage	0.0e+00	76.1
WP_154694617.1\|3045638_3047825_+	YtxH domain-containing protein	A0A1S5SF30	Streptococcus_phage	6.0e-173	59.9
WP_154694618.1\|3047835_3048855_+	peptidase P60	A0A1S5SEZ8	Streptococcus_phage	7.4e-118	62.5
WP_002405436.1\|3048871_3049789_+	conjugal transfer protein	A0A1S5SF22	Streptococcus_phage	5.2e-70	46.0
WP_002405437.1\|3050617_3052558_+	tetracycline resistance ribosomal protection protein Tet(S)	A0A2K5B2A5	Erysipelothrix_phage	6.0e-294	78.7
WP_005228365.1\|3052645_3052813_+	conjugal transfer protein	D0R0F6	Streptococcus_phage	8.1e-14	64.0
WP_002405438.1\|3053327_3053687_-	helix-turn-helix transcriptional regulator	A0A1S5SFA6	Streptococcus_phage	2.3e-26	60.2
WP_002405439.1\|3054162_3054636_+	sigma-70 family RNA polymerase sigma factor	A0A1S5SEW0	Streptococcus_phage	2.1e-35	54.7

DBSCAN-SWA_12

3412066 : 3422971

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080647003.1\|3412066_3412642_-	TIGR00730 family Rossman fold protein	A0A1G5S9X4	Enterococcus_phage	1.6e-16	35.7
WP_010748957.1\|3412713_3413055_+	hypothetical protein	NA	NA	NA	NA
WP_010748956.1\|3413205_3414219_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_010748955.1\|3414211_3414994_-	ABC transporter ATP-binding protein	A0A1V0SKJ1	Klosneuvirus	5.5e-12	28.5
WP_005233272.1\|3414998_3416072_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.0e-16	25.4
WP_005230622.1\|3416544_3417018_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.5e-36	50.0
WP_080647004.1\|3417039_3418251_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.5e-104	50.5
WP_005230617.1\|3418228_3418816_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.0e-31	39.4
WP_010748953.1\|3418800_3419877_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	6.4e-43	34.5
WP_154694629.1\|3420146_3420311_-	hypothetical protein	NA	NA	NA	NA
WP_010748952.1\|3420322_3422971_-	HAD-IC family P-type ATPase	M1HXH2	Paramecium_bursaria_Chlorella_virus	1.5e-72	28.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046125

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046123

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection