CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP039233	Piscirickettsia salmonis strain SR1 plasmid unnamed6, complete sequence	0 crisprs	NA	0	1
NZ_CP039232	Piscirickettsia salmonis strain SR1 plasmid unnamed5, complete sequence	0 crisprs	NA	0	0
NZ_CP039227	Piscirickettsia salmonis strain SR1 chromosome, complete genome	3 crisprs	cas3,DEDDh,DinG,csa3	2	39
NZ_CP039228	Piscirickettsia salmonis strain SR1 plasmid unnamed1, complete sequence	0 crisprs	NA	0	3
NZ_CP039230	Piscirickettsia salmonis strain SR1 plasmid unnamed3, complete sequence	0 crisprs	NA	0	1
NZ_CP039231	Piscirickettsia salmonis strain SR1 plasmid unnamed4, complete sequence	0 crisprs	NA	0	1
NZ_CP039229	Piscirickettsia salmonis strain SR1 plasmid unnamed2, complete sequence	0 crisprs	NA	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

17451 : 27915

Erysipelothrix_phage(30.0%)

portal,head,terminase,tail,capsid

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155589668.1\|17451_18450_+	DNA-processing protein DprA	S6BFL3	Thermus_phage	1.7e-21	34.7
WP_155589669.1\|18460_19717_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_155589670.1\|19908_20292_+	HNH endonuclease	A0A2D1GNP5	Pseudomonas_phage	1.1e-26	47.2
WP_155589671.1\|20365_20860_+\|terminase	phage terminase small subunit P27 family	Q9B019	Phage_GMSE-1	1.6e-12	32.7
WP_155589672.1\|20843_22277_+\|terminase	terminase large subunit	A0A1W6JP18	Morganella_phage	1.7e-123	46.7
WP_155589673.1\|22194_22536_+	hypothetical protein	A0A2K5B285	Erysipelothrix_phage	3.2e-17	50.0
WP_155589674.1\|22532_23774_+\|portal	phage portal protein	A0A2K5B287	Erysipelothrix_phage	7.0e-86	46.6
WP_155589675.1\|23721_24165_+	hypothetical protein	K7PKX4	Enterobacterial_phage	6.4e-34	53.2
WP_155589676.1\|24145_24391_+	hypothetical protein	NA	NA	NA	NA
WP_155589677.1\|24446_24830_+	hypothetical protein	NA	NA	NA	NA
WP_155589678.1\|24781_25639_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	1.7e-59	45.0
WP_155589679.1\|25759_27115_+	hypothetical protein	NA	NA	NA	NA
WP_155589680.1\|27283_27595_+\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	1.1e-08	31.7
WP_155589681.1\|27591_27915_+\|head	phage head closure protein	A0A1W6JP44	Morganella_phage	6.0e-13	39.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP039227

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP039227_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP039227_1

686736-686835

Orphan

Consensus_repeat	Method
AATAAATATTAATTTTTTAAATT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP039227_1

>merge|NZ_CP039227|1|686736-686835|CRISPRCasFinder
AATAAATATTAATTTTTTAAATTAAATTAATATTTTTTAATAATTTATAAAAATTAATTGATAAATAGTAGTTATAAAATAAATATTAAATTTTTAAATT

>NZ_CP039227|1|1|686736-686835|CRISPRCasFinder
AATAAATATTAATTTTTTAAATT	AAATTAATATTTTTTAATAATTTATAAAAATTAATTGATAAATAGTAGTTATAA
AATAAATATTAAATTTTTAAATT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP039227.1\|WP_155068160.1\|694032_695382_+\|nucleotide-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|223936
NZ_CP039227.1\|WP_155079956.1\|678267_678756_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079964.1\|687238_688030_-\|methyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|379312
NZ_CP039227.1\|WP_155079478.1\|685461_686019_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP039227.1\|WP_155079961.1\|681932_682586_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379252
NZ_CP039227.1\|WP_155068159.1\|695378_696248_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	unknown	unknown	gnl\|CDD\|224131
NZ_CP039227.1\|WP_155079967.1\|691283_691913_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079957.1\|679045_679198_-\|phosphatase	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079445.1\|689805_690780_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP039227.1\|WP_155079969.1\|696994_697309_+\|transposase	unknown	unknown	gnl\|CDD\|279973
NZ_CP039227.1\|WP_155079960.1\|680171_681569_+\|IS66-family-transposase	unknown	unknown	gnl\|CDD\|376980
NZ_CP039227.1\|WP_155079959.1\|679778_680129_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	unknown	unknown	gnl\|CDD\|377551
NZ_CP039227.1\|WP_155079966.1\|690839_691238_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225382
NZ_CP039227.1\|WP_155079965.1\|688570_689137_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079970.1\|697305_698013_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|372671
NZ_CP039227.1\|WP_155079968.1\|692279_693920_-\|glucose-6-phosphate-isomerase	unknown	unknown	gnl\|CDD\|234679
NZ_CP039227.1\|WP_155079962.1\|683368_684427_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079958.1\|679473_679782_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155079963.1\|684705_685095_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225382
NZ_CP039227.1\|WP_155079476.1\|685091_685478_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225949

Protein	Function_ID	Function_description	E-value
NZ_CP039227.1\|WP_155068160.1\|694032_695382_+\|nucleotide-sugar-dehydrogenase	gnl\|CDD\|223936	COG1004, Ugd, Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane].	0
NZ_CP039227.1\|WP_155079964.1\|687238_688030_-\|methyltransferase-domain-containing-protein	gnl\|CDD\|379312	pfam13649, Methyltransf_25, Methyltransferase domain. This family appears to be a methyltransferase domain.	6.76864e-13
NZ_CP039227.1\|WP_155079478.1\|685461_686019_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	7.32074e-43
NZ_CP039227.1\|WP_155079961.1\|681932_682586_-\|hypothetical-protein	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.43626e-08
NZ_CP039227.1\|WP_155068159.1\|695378_696248_+\|UTP--glucose-1-phosphate-uridylyltransferase-GalU	gnl\|CDD\|224131	COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane].	2.48275e-158
NZ_CP039227.1\|WP_155079970.1\|697305_698013_-\|IS3-family-transposase	gnl\|CDD\|372671	pfam13683, rve_3, Integrase core domain.	4.25691e-27
NZ_CP039227.1\|WP_155079445.1\|689805_690780_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.4949e-75
NZ_CP039227.1\|WP_155079969.1\|696994_697309_+\|transposase	gnl\|CDD\|279973	pfam01710, HTH_Tnp_IS630, Transposase. Transposase proteins are necessary for efficient DNA transposition. This family includes insertion sequences from Synechocystis PCC 6803 three of which are characterized as homologous to bacterial IS5- and IS4- and to several members of the IS630-Tc1-mariner superfamily.	2.80673e-14
NZ_CP039227.1\|WP_155079960.1\|680171_681569_+\|IS66-family-transposase	gnl\|CDD\|376980	pfam03050, DDE_Tnp_IS66, Transposase IS66 family. Transposase proteins are necessary for efficient DNA transposition. This family includes IS66 from Agrobacterium tumefaciens.	3.8896e-99
NZ_CP039227.1\|WP_155079959.1\|679778_680129_+\|IS66-family-insertion-sequence-element-accessory-protein-TnpB	gnl\|CDD\|377551	pfam05717, TnpB_IS66, IS66 Orf2 like protein. This protein is found in insertion sequences related to IS66. The function of these proteins is uncertain, but they are probably essential for transposition.	5.82836e-44
NZ_CP039227.1\|WP_155079966.1\|690839_691238_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.31665e-15
NZ_CP039227.1\|WP_155079968.1\|692279_693920_-\|glucose-6-phosphate-isomerase	gnl\|CDD\|234679	PRK00179, pgi, glucose-6-phosphate isomerase; Reviewed.	0
NZ_CP039227.1\|WP_155079963.1\|684705_685095_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	7.00479e-14
NZ_CP039227.1\|WP_155079476.1\|685091_685478_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.31245e-09

>NZ_CP039227.1|WP_155079478.1|685461_686019_+|IS630-family-transposase
MKKEPKYKQRRDAERSEFIEKLTGIDLSQLVYLDEVGVDDNIVVEYGWSAAGVRSYAEQAGFKRKRLSLVAGLKYSDKSLVAPFEFSGAMNKDLFLGWFEQELCPKLNPGQVIIMDNASFHKSPELYDMVEAVDCELLYLPAYSPDLNPIEKFWANFKRNIRKVIKKHEHLCNAITDALIKTLPG
>NZ_CP039227.1|WP_155079476.1|685091_685478_+|helix-turn-helix-domain-containing-protein
MILLLFLHEKYSRILELQAYSQDLRERVIEAYKDGLSRREISTLFKVHYDTACEWIRRYLSTGDYSSKQGVGCGAQIRFNDKQTILDFIKKNPDANGIAIRDGIAPDLPMSTFYDALKRLKVTYKKRA
>NZ_CP039227.1|WP_155079963.1|684705_685095_+|helix-turn-helix-domain-containing-protein
MAYRHLNEKDRFYIEQRLSEGDSMRSIARALGFAPSTVSRETKRHTPSDFNGLYCHRLASRCAQEKRSNAKQGQDFQKISEKAKVLIHERLSTHTSPDVISKELIQEHNIQVSESTIYRYIADTVELTF
>NZ_CP039227.1|WP_155079962.1|683368_684427_-|hypothetical-protein
MKEIQDKYLILLAEACSTVDECARNRQSIYKPINEPTNKKCKEYVSHKAVEHFFLEESDNEIENAYKELKEKLESSNEKEALYDKFNDFFYKKTAHKIDTARIVGFSKERKFFSKSLYDNLLLNAIEFTASSKLRDSFDLAFKEANILSTHDDGIAFRALTKNLTHVTVMPLEKLDISCHLELFQQLIELGLGNQPSHILDMLDFPQQFKDFNHILQETYNQIKAHVSAQISYSQAQSHPLLSCFFSKKNNVSACFQQYQTNVTRAAFNFLFSKERDLAVLESQLTQHDANFLSSSGLKSSYPNFQGAYPKLLKQIKQPNKAEAISAQLFSQQQTATGASILANMTSDIAPI
>NZ_CP039227.1|WP_155079961.1|681932_682586_-|hypothetical-protein
MLNLADIYTDYLIAQNKHATATGLADLMPDELSHDQITRLLNKTPQTSKDLWLKIKADVREYEGLDDGVLALDDMIAEKPYSDENDIIAWHYDHSKGRTVKGINILTAMVRYGDVRLPIAYEVIEKTIRYSDLQTKKERRKSSFTKNDLFLKLLNVAIRNDLKFAYVLADRWFSSQSNMSYIHNVGKKFIMGIKSNRCVALTEKDKENGKYQRKRST
>NZ_CP039227.1|WP_155079960.1|680171_681569_+|IS66-family-transposase
METAVYPENIEDCYKVIDHVSTERDHYKALYEQLQRYRYGQRSEKLSQDQLDLFAEFLDENAEKESQQEAITVPAHQRQRPKRKPLPEHLPRERIEHDLTEGDKVCACGCAMQRIGEEITEKLEVIPAQFKVIQHVRFKYGCKACETGIKIPSLPPMLIPKSIITPSLLAMIVSDKFESHLPLHRQQQRFEALGIDLPRNTMANWVIVTAMLCESLLELMKQDLLQAKLIHADESPLRVLSEGKQKSYLWYYYGRIAEKQICCIDFQASRHSIHPAKFLKGYTGYMMTDAYSGYGEVIKNEKITSTYCWSHARRKFEAIPQPKKDSKKITLAMEMLNLIKELYRIEKEIKGKSPDIIYQHRQEKSKPILDEIKQWLEHYQPSIPPKVPLGQAMSYLHKNWNEFIRYIDEPFLSIDNNVLERQIRPLAVGRHNWLFSASEAGAQATAAFYSLVATCAASHGVLSTG
>NZ_CP039227.1|WP_155079959.1|679778_680129_+|IS66-family-insertion-sequence-element-accessory-protein-TnpB
MNFPSSIKVHLATTHCDMRKSIDGLAWEVQSRFDMDVLDGAVFVFYNRNKDKLKYIYYDGTGFCLFYKRLAKGRFKIPPLKNDCYQMSEAQLRLLLEGVEWSKIKPNRKQKYSQMF
>NZ_CP039227.1|WP_155079958.1|679473_679782_+|hypothetical-protein
MIDQTKLPNNREDWLEMVKLWKESGLTKEAFCREMSIKSSQFSYYCKIYREQNKSRLNFAEIKTAPSTTLSLKLCGQHELTIPPDFDEPTLLRLLSIANKVQ
>NZ_CP039227.1|WP_155079957.1|679045_679198_-|phosphatase
MARSGRSPFVEKRKRRYLGRYFAHPMMQNRRAKRDDYKSSAVRVTQRYVP
>NZ_CP039227.1|WP_155079956.1|678267_678756_-|hypothetical-protein
MAFKVQVMKKTFKNENGKESVLYLVTNDLSNKFAQNSIYLSSQQATRYFGKLPLRVVMRFVFFRSKLWGIRPLAIDGQPILDTYKKRWSIEEFHKSVKQNSSFEKSPTRIVTSQLNHIYYSILGFCRLERLKLKKSLNHFAIKYKLILRANQIALQELRSMV
>NZ_CP039227.1|WP_155079964.1|687238_688030_-|methyltransferase-domain-containing-protein
MAVTFKEHAKEYEERAISQRLAAKTLIKMMDIKKGDQILDVGCGGGGVTSLLADQHNVFIDAIDSCKEIFDEAVKNFGHRKNIQFSNLSANKINYENKYNWIFSNSSAYYLGDLIDIFSKFKKALKPNGKLAIQAQYKTAPQIKRCFDLILSDPLIGAIFKKHKFPVNKLNGKQFAEVLLLASFATPEFKQITHRTMHSVDEIMTIFYSGWHVPWLLNGYSGPINTEYKVNFKNLLYQGLLKQADINNKLWLEVPRVYVIANI
>NZ_CP039227.1|WP_155079965.1|688570_689137_+|hypothetical-protein
MTVYLSFFKAAVRKQGEFKRFYQDIGQFEKLKEFSDNLLQSLNAVEYKLRQGQAPRLSHLGLWISALDRGDLNLIDYLCSQNKKLDNLLKNTEFHPCIIAWRLKFYGLGQKKVTDLIFASHISLRKSVANIIKTGNITLNDWYRIQGNPLLQKAVNSFAALGKFSRDDWRTVRDNRLLQKAMIAPSVI
>NZ_CP039227.1|WP_155079445.1|689805_690780_-|IS30-family-transposase
MAYRHLNEKDRFYIEQRLSEGDSMRSIARALGFAPSTVSRETKRHTPSDFNGLYCHRLASRCAQEKRSNAKQGQDFQKISEKAKVLIHERLSTHTSPDVISKELIQEHNIQVSESTIYRYIHEDREKGGELYKSLPHSGKPYKKKVKSGDKTKIPNRVGIEQRPAIADEKTEFGHFEIDTIVGRDHKSYLLTLVDKANKMCCIRKMANKCAETVVETFRSIVASTFFDFKTITSDNGTEFAGHEDISKITDADFYFARPYRSCDRGLNEHTNGLIRRFLPKGTDFNEISDAKIAKIEHTLNARRRASLDYRAPNHVFLENLMAA
>NZ_CP039227.1|WP_155079966.1|690839_691238_-|helix-turn-helix-domain-containing-protein
MVYRHLNEKDRFYIEQRLSEGDSFRSIARALGFSPSTISREIKRHTPIDFKGLYCHRLTSRCAQEKRANAKQGQAFQQISEAAKMLIHQRLRTHTSPDVISQELIREHNIQVSESTIYRYIYALRHMKCNTQ
>NZ_CP039227.1|WP_155079967.1|691283_691913_+|hypothetical-protein
MDMNSLLSVALHVTEGVALHKTGVNFKNDWQQLKENAQLQKTVLILNQTGVNFKKQWLKIKGNKQLQETVIENNKKLQKSYYPNLKQYECHLEKNKADYHSKWKDVKKFFKISRKCARNYLMGLKNSFAPLLDTKSNMKAIYQHRRSLKSRVGLTFITSIFSAGLALMFEAGRAAVRKYQGKSFECLFLGATTSQNLAKSVKSAGLALG
>NZ_CP039227.1|WP_155079968.1|692279_693920_-|glucose-6-phosphate-isomerase
MNTAAWTKLTAHQQEIKHTHLRDLFINDSQRFNHYFKQGPHLSIDFSKNHLTNHTLKLLIALAQEHLLGDKIHALMQGATLNITEKRAAFHSALRVPASKHHQLPKEIAKQITTVHAQMRTLCAKIHSQTPLYSQGQIITDIVNLGIGGSDLGPAMVTTALTPYHKKYLRCHFVSNVDGNQLHNTLKNLKPETTLFIIASKSFTTQETFANAQSARHWLETAQLSTAQINHHFICCTSKPEKAREFGILAEHILPMWDWVGGRYSLWSSIGLPIALATGFDHFEALLTGAHAMDNHFQTASFEDNLPVMLGLIGLWYINFWHTRSHALLPYEQMLALFPNHFQQVDMESNGKHVQINGEPVHWQTAPVIWGQPGTNGQHAYHQMLFQGTEMIPMDFIVGLKTHSPYQQQHNMLVANCFAQTRGLMWGCDEQEVYQQMINQGINQAEAQRLAPHKAIIGNQPSTTILYDKLTPESLGALIALYEHKVFVQGVIWNINSFDQYGVELGKVIGQNVLAQLQGGSNIKNNNIDDYDASTQGLIHYFRNNQ
>NZ_CP039227.1|WP_155068160.1|694032_695382_+|nucleotide-sugar-dehydrogenase
MRVTVFGAGYVGLVTAACFADLGNQVICVDVDEKKLAQLAEGKSPIYEPGLDELLLRGQESGHLEFTADIQSAVEQGEFIFIAVGTPSEESGSADLQYVLAVAKSIGEYMNGYKLVIDKSTVPLGTADKVRQVISNELGARGVNYEFDVSSNPEFLKEGAAIEDFMYPDRVVIGIDNLRAEKRLKTLYTPLTKKNNCLVVMDARSAELTKYAANAMLATKISFMNEMSQLAERVGADIEMVRQGIGSDSRIGYHFIYPGCGYGGSCFPKDVRALVHTAAEHGFDTKILAAVQEVNEKQKELLLEKVLREFQGDIQGKTFALWGLAFKPKTDDIREAPSRVLMEGLWQHGAKVQAYDPAAMDNIQAVYGARDDLYLATSASSALTGADALIVVTEWTEFRSPDFNVIKKTLNQPLVIDGRNIYDAEHLESLGITYRCIGRGEWLMKDVCR
>NZ_CP039227.1|WP_155068159.1|695378_696248_+|UTP--glucose-1-phosphate-uridylyltransferase-GalU
MSIIKKAVFPVAGMGTRFLPATKATPKEMLPVVDKPLIQYAVEEAIEAGIKELIFVTSSNKRAIEDHFDRHYELEKRLEEAGKAQFLSIVRDILPQGVSCSYVRQAEPLGLGHAVLCAESLVGAEPFAVILADDLIANDGPLCLSQMVEKYNDKDADCVLAVQEVPEGDTHKYGIVATESSDRVIHMVEKPKPENAPSRQAVVGRYILSPEIFTALKNTSQGAGGEIQLTDAIASVLQNQRVLAYPFTGKRYDCGSKLGFLEATLDYALDHPELGLACQEYLQKRFQSN
>NZ_CP039227.1|WP_155079969.1|696994_697309_+|transposase
MGYPVEFRRKVFKLKEKKGLTYEEVSELFGVSMRTLFRWNTRIEIKKKAPKPRVINLEELKNDVKNHPDSYQWERAQRFGVSQHCIQHWLNFLAIVKPPFLCQV
>NZ_CP039227.1|WP_155079970.1|697305_698013_-|IS3-family-transposase
MTKIKKVLTDLAKVHHRWGFDKMMAKIKQNYAWNHKRVYRVYCELKLNLRIKPRKRVSPREAKMLVQPIVSNHCWSLDFMSDTLSNKRKFRTLNVINDYNRECLLIEPAFSLPSMVVTRLLDQVAESKGYPEVIRSDNGPEFISSDFTKWAEQHNILLHHIQPGKPAQNGFIERFNRTYRQDILDAHWFYNLEEVREITEPWVDQYNNERPHESLANLSPINFKKMRDKTTEIPL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP039227_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP039227_2

1059920-1060031

Orphan

Consensus_repeat	Method
TCATGAAGTATTAATAATGCTTTTGTTAGGT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP039227_2

>merge|NZ_CP039227|2|1059920-1060031|CRISPRCasFinder
TCATGAAGTATTAATAATGCTTTTGTTAGGTGGGTGTTATCCTTCACTTGCTGCCAATTATCTTTAAGGCTGATCTCTGCATCATGAAGTATTAATAATGCTTTTGCTAGGT

>NZ_CP039227|2|2|1059920-1060031|CRISPRCasFinder
TCATGAAGTATTAATAATGCTTTTGTTAGGT	GGGTGTTATCCTTCACTTGCTGCCAATTATCTTTAAGGCTGATCTCTGCA
TCATGAAGTATTAATAATGCTTTTGCTAGGT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP039227.1\|WP_155589558.1\|1067463_1068438_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP039227.1\|WP_155079724.1\|1051660_1052842_-\|transposase	unknown	unknown	gnl\|CDD\|379252
NZ_CP039227.1\|WP_155079476.1\|1061327_1061714_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225949
NZ_CP039227.1\|WP_155079826.1\|1069153_1070040_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP039227.1\|WP_155080160.1\|1055220_1056447_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|182898
NZ_CP039227.1\|WP_155066848.1\|1058821_1059361_-\|superoxide-dismutase	unknown	unknown	gnl\|CDD\|224943
NZ_CP039227.1\|WP_155589557.1\|1061697_1062216_+\|IS630-family-transposase	unknown	unknown	gnl\|CDD\|315923
NZ_CP039227.1\|WP_155079974.1\|1057831_1058197_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|379154
NZ_CP039227.1\|WP_155080156.1\|1045689_1046538_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080167.1\|1071349_1072078_-\|IS6-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP039227.1\|WP_155066852.1\|1066432_1066846_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|133390
NZ_CP039227.1\|WP_155079445.1\|1056644_1057619_+\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382
NZ_CP039227.1\|WP_155080166.1\|1070036_1071347_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|270622
NZ_CP039227.1\|WP_155080157.1\|1046829_1049520_+\|DUF4135-domain-containing-protein	unknown	unknown	gnl\|CDD\|271200
NZ_CP039227.1\|WP_155080163.1\|1063007_1063517_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|377437
NZ_CP039227.1\|WP_155080159.1\|1052991_1054632_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080161.1\|1058253_1058469_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|315923
NZ_CP039227.1\|WP_155080165.1\|1068624_1069092_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|271133
NZ_CP039227.1\|WP_155080158.1\|1049766_1050930_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340863
NZ_CP039227.1\|WP_155079445.1\|1064193_1065168_-\|IS30-family-transposase	unknown	unknown	gnl\|CDD\|225382

Protein	Function_ID	Function_description	E-value
NZ_CP039227.1\|WP_155589558.1\|1067463_1068438_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	3.68418e-77
NZ_CP039227.1\|WP_155079724.1\|1051660_1052842_-\|transposase	gnl\|CDD\|379252	pfam13546, DDE_5, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	4.24558e-07
NZ_CP039227.1\|WP_155079476.1\|1061327_1061714_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225949	COG3415, COG3415, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	1.31245e-09
NZ_CP039227.1\|WP_155079826.1\|1069153_1070040_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	1.18368e-43
NZ_CP039227.1\|WP_155080160.1\|1055220_1056447_+\|MFS-transporter	gnl\|CDD\|182898	PRK11010, ampG, muropeptide MFS transporter AmpG.	2.08119e-128
NZ_CP039227.1\|WP_155066848.1\|1058821_1059361_-\|superoxide-dismutase	gnl\|CDD\|224943	COG2032, SodC, Cu/Zn superoxide dismutase [Inorganic ion transport and metabolism].	1.4122e-44
NZ_CP039227.1\|WP_155589557.1\|1061697_1062216_+\|IS630-family-transposase	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	3.26095e-40
NZ_CP039227.1\|WP_155079974.1\|1057831_1058197_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|379154	pfam13384, HTH_23, Homeodomain-like domain.	1.39937e-06
NZ_CP039227.1\|WP_155066852.1\|1066432_1066846_+\|hypothetical-protein	gnl\|CDD\|133390	cd04762, HTH_MerR-trunc, Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins. Proteins in this family mostly have a truncated helix-turn-helix (HTH) MerR-like domain. They lack a portion of the C-terminal region, called Wing 2 and the long dimerization helix that is typically present in MerR-like proteins. These truncated domains are found in response regulator receiver (REC) domain proteins (i.e., CheY), cytosine-C5 specific DNA methylases, IS607 transposase-like proteins, and RacA, a bacterial protein that anchors chromosomes to cell poles.	0.000931764
NZ_CP039227.1\|WP_155080167.1\|1071349_1072078_-\|IS6-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	4.57175e-51
NZ_CP039227.1\|WP_155080166.1\|1070036_1071347_+\|hypothetical-protein	gnl\|CDD\|270622	cd00180, PKc, Catalytic domain of Protein Kinases. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. PKs make up a large family of serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which one kinase activates a second kinase, which in turn, may act on other kinases; this sequential action transmits a signal from the cell surface to target proteins, which results in cellular responses. The PK family is one of the largest known protein families with more than 100 homologous yeast enzymes and more than 500 human proteins. A fraction of PK family members are pseudokinases that lack crucial residues for catalytic activity. The mutiplicity of kinases allows for specific regulation according to substrate, tissue distribution, and cellular localization. PKs regulate many cellular processes including proliferation, division, differentiation, motility, survival, metabolism, cell-cycle progression, cytoskeletal rearrangement, immunity, and neuronal functions. Many kinases are implicated in the development of various human diseases including different types of cancer. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase.	8.57082e-09
NZ_CP039227.1\|WP_155079445.1\|1056644_1057619_+\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.4949e-75
NZ_CP039227.1\|WP_155080157.1\|1046829_1049520_+\|DUF4135-domain-containing-protein	gnl\|CDD\|271200	cd04792, LanM-like, Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.	5.88754e-88
NZ_CP039227.1\|WP_155080163.1\|1063007_1063517_-\|hypothetical-protein	gnl\|CDD\|377437	pfam04986, Y2_Tnp, Putative transposase. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases IS1294 and IS801. This is a rolling-circle transposase.	9.01988e-28
NZ_CP039227.1\|WP_155080161.1\|1058253_1058469_+\|hypothetical-protein	gnl\|CDD\|315923	pfam13358, DDE_3, DDE superfamily endonuclease. This family of proteins are related to pfam00665 and are probably endonucleases of the DDE superfamily. Transposase proteins are necessary for efficient DNA transposition. This domain is a member of the DDE superfamily, which contain three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction.	2.45e-11
NZ_CP039227.1\|WP_155080165.1\|1068624_1069092_+\|hypothetical-protein	gnl\|CDD\|271133	cd14663, STKc_SnRK3, Catalytic domain of the Serine/Threonine Kinases, Sucrose nonfermenting 1-related protein kinase subfamily 3. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SnRKs form three different subfamilies designated SnRK1-3. SnRK3 is represented in this cd. The SnRK3 group contains members also known as CBL-interacting protein kinase, salt overly sensitive 2, SOS3-interacting proteins and protein kinase S. These kinases interact with calcium-binding proteins such as SOS3, SCaBPs, and CBL proteins, and are involved in responses to salt stress and in sugar and ABA signaling. The SnRKs belong to a larger superfamily that includes the catalytic domains of other STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.	0.00152218
NZ_CP039227.1\|WP_155080158.1\|1049766_1050930_+\|MFS-transporter	gnl\|CDD\|340863	cd06173, MFS_MefA_like, Macrolide efflux protein A and similar proteins of the Major Facilitator Superfamily of transporters. This family is composed of Streptococcus pyogenes macrolide efflux protein A (MefA) and similar transporters, many of which remain uncharacterized. Some members may be multidrug resistance (MDR) transporters, which are drug/H+ antiporters (DHAs) that mediate the efflux of a variety of drugs and toxic compounds, conferring resistance to these compounds. MefA confers resistance to 14-membered macrolides including erythromycin and to 15-membered macrolides. It functions as an efflux pump to regulate intracellular macrolide levels. The MefA-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	4.57594e-24
NZ_CP039227.1\|WP_155079445.1\|1064193_1065168_-\|IS30-family-transposase	gnl\|CDD\|225382	COG2826, Tra8, Transposase and inactivated derivatives, IS30 family [DNA replication, recombination, and repair].	1.4949e-75

>NZ_CP039227.1|WP_155066848.1|1058821_1059361_-|superoxide-dismutase
MKHLLLPLKIASLMLFSVTAYHTYANANAHTHKHSAEKVTLYTVAKGTPSHNIGYVLLKDSPNGLLILPHLSHVPAGFHGFHIHVNPSCKDHGMAAGGHYDPTKTGKHLGPYGRGHLGDLPVLYANKKGDINGPVIAPHLTLKQIHGRSLMLHAGGDNYADKPESLGGGGARFACGIIH
>NZ_CP039227.1|WP_155080161.1|1058253_1058469_+|hypothetical-protein
MDEAGMDDTERYAYGHSAKGKRCYAEKPGSKSIRINFMGGLRGKQFIAPMVVEGYCNNNVCQAYIDQSLRV
>NZ_CP039227.1|WP_155079974.1|1057831_1058197_+|helix-turn-helix-domain-containing-protein
MPSPYSYDLRVRALKMIDEGIPITQVSKLLKISRDTLHRWKNRRDHTGDVKARFGYQTGYNHKISDMEEFQKFIDQNSGKTHQQLADLYPVEMSAKTMGVWIKRLGYTRKKRASDTKNVMH
>NZ_CP039227.1|WP_155079445.1|1056644_1057619_+|IS30-family-transposase
MAYRHLNEKDRFYIEQRLSEGDSMRSIARALGFAPSTVSRETKRHTPSDFNGLYCHRLASRCAQEKRSNAKQGQDFQKISEKAKVLIHERLSTHTSPDVISKELIQEHNIQVSESTIYRYIHEDREKGGELYKSLPHSGKPYKKKVKSGDKTKIPNRVGIEQRPAIADEKTEFGHFEIDTIVGRDHKSYLLTLVDKANKMCCIRKMANKCAETVVETFRSIVASTFFDFKTITSDNGTEFAGHEDISKITDADFYFARPYRSCDRGLNEHTNGLIRRFLPKGTDFNEISDAKIAKIEHTLNARRRASLDYRAPNHVFLENLMAA
>NZ_CP039227.1|WP_155080160.1|1055220_1056447_+|MFS-transporter
MNLSLSRRTTAVFLLTFSSSLPLILVGSTLSAWYTVAGVSLLGIGALSMVQQPYIFKFLWTPLMDRFSLFGWCRRRSWILLTQVLLVIGLVLMAYTGPKQYPFGLAMIALILAFFSASQDIAIDAYRIDILHANELGMGAAITSLAGRIAMLFGGAVALVFAAEIGWQNTYLIMAAVMALEILATLAAPALRNEEATPRSLQESIVGPLKDFVRREHALSILIFILTYKMCDALALALNTPFLIRGVGFSLLEMGTIYKTMSLVASLLGTVVGGFFYKRLGLYRTLMCYGILQALSNLAYMGLALASKSYFLMATAVFVEYFCGALSTVAFVAYLMSLCKQRFSATQYAILSAIIAIPRVYFGPLAAIMIDYFGWAQFYLITCLIGFPPLILLFRMKKYLLNYWLDTE
>NZ_CP039227.1|WP_155080159.1|1052991_1054632_-|hypothetical-protein
MSTIDDLLRDLSASRQRELLEELTAVYNSSSSRQHLNTESREKYRQLLRDFGYMNRLQQFDKTEGEYSSLNHGLGPWPGVQFFPDWNYTRLLLLRFRRQAQAIADAFHSNVFNQNLGHREVGIGFSILGVVWYLPRLLRHTVLSLKHLLTNEKSSSDYFKKHWFQFFNDLIWAATGAITLGIGTGWYLGPWAAALGPGGIILTVALYAFDVVNMVAKAYTKIRKMNRIIAHTNEQIQGVCGELGLLFSTSIDIESLYTYVKEQIQQGATEDELEKLNKLKDLLDIRERMLLRKSYVKYDQFSKVGITVGLLAGMVLMLTGPIGAAVGAGVVLVTCGIQYWLNHYFLPKKEVQLASDPLELLHLKLNSHVDKQIIKLTEELQYLKNGPEKEQTNHKLLMYMRARGALNRWRDRPERNNDSTMLLQAAALTMDASKIRRKGTGAPASYKDLKSALKHFSTPWRDAFNDAQKQFSLLLKNFSASSKVKSSTESPLSRSSTDSQGSSNDENFDKGIFEKAAAQAAAGSDYQPLQSESGITTASSASPALG
>NZ_CP039227.1|WP_155079724.1|1051660_1052842_-|transposase
MLNLADIYTDYLIAQNKHATATGLADLMPDELSHDQITRLLNKTPQTSKDLWLKIKADVREYEGLDDGVLALDDMIAEKPYSDENDIIAWHYDHSKGRTVKGINILTAMVRYGDVRLPIAYEVIEKTIRYSDLQTKKERRKSSFTKNDLFLKLLNVAIRNDLKFAYVLADRWFSSQSNMSYIHNVGKKFIMGIKSNRCVALTEKDKENGKYQQLKQISLEDGIPQTVYLKGMAFKVQVMKKTFKNENGKESVLYLVTNDLSNKFAQNSIYLSSQQATRYFGKLPLRVVMRFVFFRSKLRGIRPLAIDGQPILDTYKKRWSIEEFHKSVKQNSSFEKSPTRIVTSQLNHIYYSILGFCRLERLKLKKSLNHFAIKYKLILRANQIALQELRSMA
>NZ_CP039227.1|WP_155080158.1|1049766_1050930_+|MFS-transporter
MEAIRLVRKSAIFRVVLALSFLESFALMMDFTVLYTVIVYLWKLPLYKVILFSFTVSIPSIIISPFAGRLVDAKGSIICIQYSSILCFFLTIGLIFTNSYFILFTLVFIRSSLKAVFSPALSRIIKLTVDKKQLLSVNSLIQFNANGLLIIAPIIGMVVFSTLGKKWCFLITSILFFLTFSLSFFLKGVSDKRSQVDMGLLLQSDLDIKKLLVPFLGMMIAAFAIYLGDSLFPLLLKSTGLDFKDFALIGSFFGIGGMAASIFCQCYKNSNEVTLIKLGAILVIISMFTYGMFSSMLSQCVFFVFAMLNAGGITLISISSATLLQKNTPAHMMGKVSSINNMIFGLASIIVPAFGLTFSQLVSVKLPFLLLSIITLSLLLTLRAMEC
>NZ_CP039227.1|WP_155080157.1|1046829_1049520_+|DUF4135-domain-containing-protein
MNKNEAFLDIYRSIIGQFISSKDVQNILDSFPQGKISETILTKSFLKLYSSLLDVTLYRVLEVDSQIYFKENKSNDYNQYLTGFDLNTCLSKYHSTDSFDLQCHFLKDALLQFYLRLAADIREIESHILAGEKIEVITEVSPVGDFHGALECGFCIGFKSQLKESGEFYYKPRLSHLFEKYNNFITWLNEVEHSAMLDNIALKNINKQDYSWIQSVHAILTATADHQRLSPALQGQNDHLAFERFGALLCLAYVFSSCDLHYENIVFNGDYPVIVDIETIFSGKWHKYQEVGHLYDTLMLPRSILNREEEASPLTYDTNRKNAFETHIDDLIVGFEKTYDLIIKIKPDFIIKVNELFSDIDYRVILRGTKTYFNIIKNINHPVTLIKQSQALEINKMYEVDLPTALYQYEAEQLKSASIPIFYAKFDSKKLCSYDGKVLFTKMEKSAKDLFDIKIKLLSNKDKENQINNILVAKKAFVARRDGITLTEISPDINTLKRKDFFDAGVSHIEIIQSTWQRLVNKLCYISSTVHMPTIILENNTWNGLASLDLYNGTPGILLVWHQLHTALKIKKTKHYKAIRNDIKHYFCRERISYEPSLYQGLVGCLYVYIITSENLLEELPVIQVALQKIAYGVAALEVKSVLDLDVIKGLSGIVLGLLTIKSQLQSYHAISKSLGCICQSTVLKIVNALDQHLNDKTLLGFAHGTAGIIAALSAYMNHYGRNIQYIKVINMLMKRERSFFDPSINHWRRPDNGQFDESWCHGSIGIVLSKLYARRYINIDFDKEINTVLTHIELSKSANLNLCHGLAGYLEFLNTILTLSQLDIKEDTRLRCEAVKDNLIKKIDLIYLNYSVLVDNYYHEDELPGLLSGTAGFLLTLLSCYKKNIVDNILSIGVH
>NZ_CP039227.1|WP_155080156.1|1045689_1046538_+|hypothetical-protein
MEVEMSFSPLRSKIRQWLIELRQVVMDKSGNIYNPAFSIKDYDPLLTIRKTLSAVTTAQSGGDLLDALNYLERDYLKRNSKLSKYLLNIRGSQLIAELYTQLNEYRESCKIYIESGLVTSAEQKQAIAKEEKAVAKEKKFVELRQTLQNFDTSASKQEALGQCQTLQDLCFAASIRQKSGLLHLGNTTATANELVRLLNLPTNGLLRQEICSDGEKVRMRDVRHYARFGVKSSSQRYFLSAEDRENERFFSHLKNEKQSQPMLMFDRYKVAQNQTLEVCLDA
>NZ_CP039227.1|WP_155079476.1|1061327_1061714_+|helix-turn-helix-domain-containing-protein
MILLLFLHEKYSRILELQAYSQDLRERVIEAYKDGLSRREISTLFKVHYDTACEWIRRYLSTGDYSSKQGVGCGAQIRFNDKQTILDFIKKNPDANGIAIRDGIAPDLPMSTFYDALKRLKVTYKKRA
>NZ_CP039227.1|WP_155589557.1|1061697_1062216_+|IS630-family-transposase
MKKEPKYKQRRDAERSEFIEKLTGIDLSQLVYLDEVGVDDNIVVEYGWSAAGVRSYAEQAGFKRKRLSLVAGLSGAMNKDLFLGWFEQELCPKLNPGQVIIMDNASFHKSPELYDMVEAVDCELLYLPAYSPDLNPIEKFWANFKRNIRKVIKKHEHLCNAITDALIKTLPG
>NZ_CP039227.1|WP_155080163.1|1063007_1063517_-|hypothetical-protein
MNVTVPARIIFLKFLNLQHNVDYLGRYIKRPALANARMEHYDGNVVIFRYLDHKTKQQKMKKQSIDDFIDRLTQHIPDKFFKMIRYYGFLSYRTRTIILPKIYDLVGQTIEAYNQVTFVSLMKSNFNYNPLKCILCGSQLRRISTQFGLTLREKYSYYEELATSRFRGF
>NZ_CP039227.1|WP_155079445.1|1064193_1065168_-|IS30-family-transposase
MAYRHLNEKDRFYIEQRLSEGDSMRSIARALGFAPSTVSRETKRHTPSDFNGLYCHRLASRCAQEKRSNAKQGQDFQKISEKAKVLIHERLSTHTSPDVISKELIQEHNIQVSESTIYRYIHEDREKGGELYKSLPHSGKPYKKKVKSGDKTKIPNRVGIEQRPAIADEKTEFGHFEIDTIVGRDHKSYLLTLVDKANKMCCIRKMANKCAETVVETFRSIVASTFFDFKTITSDNGTEFAGHEDISKITDADFYFARPYRSCDRGLNEHTNGLIRRFLPKGTDFNEISDAKIAKIEHTLNARRRASLDYRAPNHVFLENLMAA
>NZ_CP039227.1|WP_155066852.1|1066432_1066846_+|hypothetical-protein
MTDISTTAAASLVEVSVRKIQRMIKLGEISAIRNSKGSWRIDLSELGRVFGLTIDELSERLSAIEIRKNTSGSDKINTENLENLAVLSQEVELLKSHIFSKDEQITLLTKEKEELMQLLEQLKKQRKKKGFFAKLFS
>NZ_CP039227.1|WP_155589558.1|1067463_1068438_+|IS30-family-transposase
MVYRHLNEKDRFYIEQRLSEGDSLRSIARALGFSPSTISREIKRHTPIDFKGLYCHRLTSRCAQEKRANAKQGQAFQQISEEEKMLIHQRLSTHTSPDVISQELIREHNIQVSESTIYRYIYDDREQGGELYKNLPHSGKPYKKKVSRGDQTKIPNRVGIEQQPAIADEKTEFGHFEIDTVVGRDHPSYLLTLVDKANKMCCIRKMPNKQAKTVINTFMNVVGSTFFDFKTITSDNGTEFAGHEAISKITEADFYFARPYRSCDRGLNEHTNGLIRRFLPKGTDFNEISDKETAKIEHTLNTRRRASLNYRSPNHVFLEYLMAA
>NZ_CP039227.1|WP_155080165.1|1068624_1069092_+|hypothetical-protein
MPKVAWKNKEQEAAEWRVVKRYLGEYAGTQLGSNHNDKTTFIDPLTKKQVYLTHRYLRGADGEIFVKSNGKALGAGTFGKVTFGQTENGQMWAIKKSPTMVILPEKGKVNLLPSLLKESDIAVDLGKARRSFQGKDGSKYYQIYQFLGTPLDKHL
>NZ_CP039227.1|WP_155079826.1|1069153_1070040_+|IS630-family-transposase
MPSPYSYDLRIRALKMIDEGIPITQVSKLLKISRDTLHRWKNRRDHTGDVKARFGYQTGYNHKISDMEEFQKFIDQNSGKTHQQLADLYPVEMSAKTMGVWIKKLLYQKKKSFRYQERDALKRKAFLEKVAKIDNDKIVYMDEAGMDDTERYAYGHSAKGKRCYAEKPGSKSIRINFMGGLRGKQFIAPMVVEGYCNNNVCQAYIDQCLIPCLSPGETVIMDNASFHKSKGVKEAIEDAGCHLLFLPPYSPDLNPIEHVWSPLKNRVRMKLDQDEINLEAALSQVMKSMSETVR
>NZ_CP039227.1|WP_155080166.1|1070036_1071347_+|hypothetical-protein
MSAISENALGEEQRFDLAIKIAQAVYHLHVGSYARSKALYAHLDLKPANICVDDQGQVHLIDYGFSESLTGTLSRLKGTLIFLPQQPVGISKEALDVFALLRILYLPELFRTPKDWVSRADSHKEGVVSLFNYDFVEKNNLTLLLDTSDGRANDKSIVFILCKLILLRWNLATDANLKKVLERPQQFNENYECLVALGLNSAEYVQQVMTNPDSIEGFKQEQSNLLKLNQLGLDQAVYINALLASPNLIDQFEQNQGQFLRLNQLGLNQVVYIQQVLEDPGQFDKDYCYLKSFGLDRPETVKKMLDCLESQSALVEILLEAALDKAIEDCRQRGSQKKLTIAKFLKSKISIDPVNLILRNTVNILSHRSGLLKSKSYGVAMPYLLECKRLLEISEQDWNAMLATGYGFAGLHSGHEGTVAKNYSELQKGYFLVLSA
>NZ_CP039227.1|WP_155080167.1|1071349_1072078_-|IS6-family-transposase
MVKRKRFKKNQPFKWKHYSGEIILWLVRWYGRYALSYRDLKEIAAERGLELERSTICRWVHEYGPEIAKRLRPHFRQTCASWRLDETLVKIKGRWYYLYRAIDKYGHTLDWMLSRHQNAKAALRFFKKAMAQPYVKSPRVVNVDKHASFPPAHQKAKDEGVFSRRCKLRRVKYLNNYIENDHKAVKRKSRFRQWYQSLSTARPTIDIMEAMRMVQKGQLRYIKKKNICAQNQLIDKLFGLAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP039227_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP039227_3

1435263-1435495

Orphan

Consensus_repeat	Method
TTGAGGATTCTGCTTCTCAAGGTTCT	CRISPRCasFinder

4 spacers

The CRISPR arrays of NZ_CP039227_3

>merge|NZ_CP039227|3|1435263-1435495|CRISPRCasFinder
TTGAAGAGCCAGGTCTTGAAGGTTCTAAGCTTATAGATTCTTTACCTGGGACTGATACTGCAATTTCTACTTCTCAAGGTTCTATTCTTGAGGATTCTGCTTCTCAAGGTTCTATTTTTGAGGGTTCTGCTTCTCAGGGTTCTGCTTTTGAAGATTCTGCTTCTCAAGGTTCTGCTTCTCAAGATTCTGCTGCTCAGGATTCTGCTGCTCAAGGTTCTGCTTCTCAGGATTCT

>NZ_CP039227|3|3|1435263-1435495|CRISPRCasFinder
TTGAAGAGCCAGGTCTTGAAGGTTCT	AAGCTTATAGATTCTTTACCTGGGACTGATA
CTGCAATTTCTACTTCTCAAGGTTCT	ATTCTTGAGGATTCTGCTTCTCAAGGTTCTATTT
TTGAGGGTTCTGCTTCTCAGGGTTCT	GCTTTTGAAGATTCTGCTT
CTCAAGGTTCTGCTTCTCAAGATTCT	GCTGCTCAGGATTCTGCTG
CTCAAGGTTCTGCTTCTCAGGATTCT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP039227.1\|WP_155080371.1\|1448281_1449163_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_122942954.1\|1432460_1432694_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155067607.1\|1429964_1430300_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155067611.1\|1424300_1425095_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155081510.1\|1431639_1432260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080363.1\|1429343_1429964_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|378659
NZ_CP039227.1\|WP_155080366.1\|1439553_1440291_+\|deoxyribose-phosphate-aldolase	unknown	unknown	gnl\|CDD\|235387
NZ_CP039227.1\|WP_155067605.1\|1430707_1431673_+\|PAP2-family-protein	unknown	unknown	gnl\|CDD\|379588
NZ_CP039227.1\|WP_155080361.1\|1425124_1428238_+\|DotA/TraY-family-protein	unknown	unknown	gnl\|CDD\|275142
NZ_CP039227.1\|WP_155080362.1\|1428274_1429108_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|235124
NZ_CP039227.1\|WP_155080369.1\|1445581_1445995_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080364.1\|1433247_1434987_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080368.1\|1443947_1445225_+\|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC	unknown	unknown	gnl\|CDD\|234978
NZ_CP039227.1\|WP_155067596.1\|1440543_1441686_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	unknown	unknown	gnl\|CDD\|129307
NZ_CP039227.1\|WP_155067602.1\|1438257_1439529_+\|phosphopentomutase	unknown	unknown	gnl\|CDD\|235430
NZ_CP039227.1\|WP_155080370.1\|1447358_1448039_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155067606.1\|1430306_1430717_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_017378241.1\|1443774_1443951_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|234978
NZ_CP039227.1\|WP_155589561.1\|1445952_1446225_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP039227.1\|WP_155080367.1\|1441702_1443304_-\|cytochrome-bd-I-ubiquinol-oxidase-subunit-CydA	unknown	unknown	gnl\|CDD\|185052

Protein	Function_ID	Function_description	E-value
NZ_CP039227.1\|WP_155080368.1\|1443947_1445225_+\|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC	gnl\|CDD\|234978	PRK01747, mnmC, bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC.	1.43476e-110
NZ_CP039227.1\|WP_155067596.1\|1440543_1441686_-\|cytochrome-d-ubiquinol-oxidase-subunit-II	gnl\|CDD\|129307	TIGR00203, ubiquinol_oxidase_subunit_2, cytochrome d oxidase, subunit II (cydB). part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport].	2.00911e-127
NZ_CP039227.1\|WP_155067602.1\|1438257_1439529_+\|phosphopentomutase	gnl\|CDD\|235430	PRK05362, PRK05362, phosphopentomutase; Provisional.	0
NZ_CP039227.1\|WP_155080361.1\|1425124_1428238_+\|DotA/TraY-family-protein	gnl\|CDD\|275142	TIGR04346, DotA_TraY, conjugal transfer/type IV secretion protein DotA/TraY. Members of this protein family include transfer protein TraY of IncI1 plasmid R64 and DotA (defect in organelle trafficking A) of Legionella pneumophila.	2.29496e-31
NZ_CP039227.1\|WP_155080366.1\|1439553_1440291_+\|deoxyribose-phosphate-aldolase	gnl\|CDD\|235387	PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional.	1.11689e-76
NZ_CP039227.1\|WP_017378241.1\|1443774_1443951_+\|hypothetical-protein	gnl\|CDD\|234978	PRK01747, mnmC, bifunctional tRNA (5-methylaminomethyl-2-thiouridine)(34)-methyltransferase MnmD/FAD-dependent 5-carboxymethylaminomethyl-2-thiouridine(34) oxidoreductase MnmC.	6.84751e-22
NZ_CP039227.1\|WP_155067605.1\|1430707_1431673_+\|PAP2-family-protein	gnl\|CDD\|379588	pfam14378, PAP2_3, PAP2 superfamily.	4.16757e-30
NZ_CP039227.1\|WP_155080363.1\|1429343_1429964_+\|hypothetical-protein	gnl\|CDD\|378659	pfam11393, T4BSS_DotI_IcmL, Type-IV b secretion system, inner-membrane complex component. IcmL contains two amphipathic beta-sheet regions, required for the pore-forming ability which may be related to the transfer of this protein into a host cell membrane. The icmL gene shows significant similarity to plasmid genes involved in conjugation however IcmL is thought to be required for macrophage killing. It is unknown whether conjugation plays a role in macrophage killing. This is a family of DotI/IcmL proteins of type IVb secretion systems, that reside in the inner-membrane. It carries a single transmembrane helix in the N-terminal conserved region, has an extra-periplasmic domain, and is conserved in all T4BSSs including I-type conjugation systems (TraM). DotI/IcmL (and DotJ) may form an inner membrane complex that associates with the core complex.	1.391e-52
NZ_CP039227.1\|WP_155080362.1\|1428274_1429108_+\|hypothetical-protein	gnl\|CDD\|235124	PRK03427, PRK03427, cell division protein ZipA; Provisional.	0.000877741
NZ_CP039227.1\|WP_155080367.1\|1441702_1443304_-\|cytochrome-bd-I-ubiquinol-oxidase-subunit-CydA	gnl\|CDD\|185052	PRK15097, PRK15097, cytochrome bd-I ubiquinol oxidase subunit CydA.	0

>NZ_CP039227.1|WP_155080364.1|1433247_1434987_+|hypothetical-protein
MKFIELKQKFILVLQLVDGLSGSGATKHQGTAHSTEDKKDLISAVEEILSVRFLEGLSAVLTDSGRPKQAEILTRTQENIVFLLEDPDVKDSLGLLTTAKIAKFEIVYKYLLGEEGEELDALVQALFAQKSTDSQEINVCRYEAIEGFSSYFDLKANIPPREELFGEFHNEMRKINNEIKSAENTILELESKKITADSLARRKINLVTNQSNALTSIAALYIQGDRKLGLKSHSASYFNKIFGPYFEFNGGSPVIAPGYSLVDGKSDFEQILAGIVDNCQRKRTFWARVWGKLQAGKISALLLEAVDKGCSKTALKIHSGNVRTGEAFSSSWIGKKPSECEAEAKALSDEFNKEKYLLELSSTTIEAGEAKKQKLLNDFTQKVTDYGKELKRVFNAIRSFRLLVQKAEKKGAAAGGLDSQVKGAEGGEKLQQETFLPKELRLTGERKVDGAIIVKHIEGITGNEQLLSLYNELREKEYLIKGNLLRIFSHFRTTMSGEAVKCSETWHTIEAAFTNRVRSNHQAMGGSEQDWTQLVTDYPFLRNHMQAQTGVALEALVFGSVLQQSTEVSPEELNCVAHL
>NZ_CP039227.1|WP_122942954.1|1432460_1432694_+|hypothetical-protein
MKKSFVIILVIIALFSCFMVSFIAGGANGFLKIFSSLLSLLEWGILGFIIFVTGLFVIFGSIVVCAAVWDELFKKQK
>NZ_CP039227.1|WP_155081510.1|1431639_1432260_-|hypothetical-protein
MIYLTYVGTLIMIKIKKLPCILTLMPPLLSSLSSCSIYPVDLGTDATYKSPVTASALPFPIQVAPIKLTKAGLYKHYRFYSTEHFPAALRLTVQSMLTQANLGSPLNNNTHLKKVSTLKIKLYPIAINDSSKNTVIGTFSFSTTLENNQQTLWSKKLSATITGSSLDHLFNQAAQEIAYAINYTLTQECRFNINTVQCKGERFKIR
>NZ_CP039227.1|WP_155067605.1|1430707_1431673_+|PAP2-family-protein
MEVTGDKAATCKRNNVLITFISYLNKNFSYLDKATILLSTILILLSFLFSYINCKYTHYLSSVTPPLFIGSILIILAIMLTLLALPLRQALPKISLVFKLIGLYLIAWVAMLLAYNMQFTPFDPLDDYLYHIDLALGFDLGLWMQWLHQHPYIQQSLLYIYDSLEYQAFILPIIACFLVNQQDIELFLAKFAFLNLIGCLIYYFWPTASPASMVNSPYFTQGQLDIALQFKQLHEGIQPSVIGAGLISFPSFHVIWSALFTCLFKKKPYLFWPLLTLNIILWFSTVLLGWHYILDVIVGLILVLFAIAIFDYLILKRSPLH
>NZ_CP039227.1|WP_155067606.1|1430306_1430717_+|hypothetical-protein
MFKKIVSSFKSAASYSFLKESFSFIFSTSKKILTVSPDNKNGEKTQINELEISNYEIKKAKSVFRFLMWVYFLFFIIIFTYTLVNIVNHSLMTAIIGIAASLACLSLAFKYHFWLTQIKVGQLGITLKEWYESLWK
>NZ_CP039227.1|WP_155067607.1|1429964_1430300_+|hypothetical-protein
MDYNSTLAKVMRLYMGHRFFWKGDEISHEDVLSLSGNIIETLLRKVNLTYSFLFDSKISYSRKRLEGQSQESIHINSDKETAFILLLIVIDIMEEAVIKSGDDVYLDNYIK
>NZ_CP039227.1|WP_155080363.1|1429343_1429964_+|hypothetical-protein
MADSALTQVKLRNDFYRDNFRRVSLILLISILINVALLAAFIVSLSSRPEPKYFATTSNGQLIKLHSLSFPVMNDSAVISWLSDIVPNINSLDFLNYRTQIREKRKYFTSYGWEQYLKAFQPIVEKIRDNKYVARAVVSDVPVVIQKGNIDGVYSWRLQVPIIITYQQGASRDTQNVIWTVLIQRSNEHADSLFGIAQIIQKGDET
>NZ_CP039227.1|WP_155080362.1|1428274_1429108_+|hypothetical-protein
MPSPGNLDDNPNPLDQPAAGPEPASDQPIAQPAAGPEPAYEMAGGQPIAQSAAPAEGQEECDPDAEEQSVQDQAEAAADQERSTAASATEKEKKEKKKRLTEMRDALGKSHEDMGKQPERGRSISKQHRDKGNELTQRMEKLSNTDPKNVTDEEKNQFMDELKALGREANQLAMSDKEKVLLRGGFLGTLVSLFQKFITWDREYKVDFQLEAIKDQAEALKQKFDSELSEYNTAGADGPKPGGTGPKCADDEEDADNQRDEEKKKKQKEEMMKEFAM
>NZ_CP039227.1|WP_155080361.1|1425124_1428238_+|DotA/TraY-family-protein
MLSLVPGPGNDQSVYFLWQIFGNIIYWVSGQETSESDLTIIHYVISAFNSGLLSLLLVIYALVIFIGTLNTAHQGEFLGRNWSSLWMPIRAIFGPLCVVPVKYGFCLAQVVLLYGVLVGVQLANYVWNSLETDLDGTAIPSVPVSLLNSVKENVGRAVLYRSVQKVSDSLGLKTTDLPSTRLKSSYACDEVQGANQFYNIGNTPTFCANSQSLIPTSLLSKLTSYTSQLCQPNKFDNFIAAMRWFYQDPYNDNGMTIKPAGVPGLSSGTLAQQCVDAVDSLLTGGSSSMEKVYNYNFSVAGKNQVIALKANLGDAYLHDNNENKERYVNAVGHIAFNFENQNYSSGKASDYSKSADEFTRTIVNDLYKNDVKQAHSSLNDYLNELNKNLLNVAGDATNRLVKNTNVPTDVSVRQGTDIVTHSVNCNNYLINGNLSLRYLECLQLKDSGQTFSMYDVSNKDYPFENYIKSWWIGGGSYLAVDKIMNYNLEMVKNKLDQEISYPGMNIVSTVHYEIPLSVNYYPLINGHPPRYQNSEGNTEYASDVKTTIVSANAGVTSVTNTIPDGLSMVSSSWASNVYHAVPACIENSGSQACKDIITLQTQLLNLPSEWRPPFIYLFNLIKSGSKLAMKSISDSPKDVTFLNNVFYFLKQNGIYQSTTTTAVPVYAVIGRIFDQVGGNGLSSDMTAVMNEFYNLGMPSSNLFSKIMQAQQVGADVVQAVIDSFTNIFENYQEQFKDIQSTAESMIADWSWGAGIAGALGGLFGAGSIGTAAAILGQTAVQLYMATQIGNLSMSLAWLPIALVVLGSLFTAAISFVVMMPLIPYFLFWAGTIVWALSILEGLVAAPLVALALVYPEGHEILGHGSPAIKIALNIIFRPVLMVIGVVAAMALTYVLITYSAQGFHLVAPLILNNFSASGMVNGIVSCFLIFIYASFMMMAFSKCFSVIYLIPDKVFDWIGASAGHRAGAEEVQQLQGKTEGMGSQAGQSMGSGVQQGIQAKQTETQSSVQAQSQDIQVAEKAGEAAGSEARSAAEMAT
>NZ_CP039227.1|WP_155067611.1|1424300_1425095_+|hypothetical-protein
MNIIKKTLIVFAVISSVSLNSIQVVHADAVSLAVLLKELNAIESHQKVGNKELEKANSALNSGFPPDALKSFENLSPEPSLSKFSEYMQDIAHSGSKSKENNSVKAQIKNLPDNKYLMSLVQGQYYDKEVKENLLSAGASPQAVVLATAVLSQVNLNEKTNGQLLKAVQAQLSKNWQDGLRVSTRDQLLRMISLQLSVSNLSQYQQLRTQELMALLQLAGLMDHGVLLGKLTEINNKSIRIDKKLSEVNRQLDIINRHFKKSSN
>NZ_CP039227.1|WP_155067602.1|1438257_1439529_+|phosphopentomutase
MLKGRVIILLMDSFGVGASEDAEQFGDAGADTFGHIVEHAAHGLADSPERQGALKLPYLASLGLEQAAKQSRGRPIAKTITGDLELPIQGVYGYAIEQSCAKDTTSGHWEITGVPVEFEWDYFHKAAECKTPGQYSSCFPADFMRRFLVETGLTQGVLDAGHASGTEVINRLGDEHCLTGKPIVYTSADSVFQIACHEKSFGLERLYGLCQTARELFDEMGLNIGRVIARPFVGNKAGEYQRTGNRHDYSVPPPQPTLLEYVVKSGGEVISVGKIADIFADRGISHKVKATGITELFDQSLAAFKRSKAGSLVFTNFVDFDSQYGHRRDVAGYAKALEYFDSRLPELMDSMEPGDLMILTADHGCDPTWPGSDHTREHIPVLAWGPGLQSKNIGQRHSFADIGQSIADFMGLAPLAHGQSFLS
>NZ_CP039227.1|WP_155080366.1|1439553_1440291_+|deoxyribose-phosphate-aldolase
MDKTKKIVMALIDLTSLNLNDNDQMIMDVCAKASNRLGKVAAVCIDPKFVSLAKRLLKNQHIAVASVVNFPLGNDPIETVLADINQVLIDGADEVDLVIPYQDYLQKGGSEWALHLVKASKALCNDKLLKVILETGELKSHALIFKAACDAINAGADFIKTSTGKTAVGATVSAVKAMLDAIQVNLHYHPHVGLKVSGGIKTLAEASQYIHLAKEVYGKEKIQVSSMNLRFGASRLVDDLLSNDS
>NZ_CP039227.1|WP_155067596.1|1440543_1441686_-|cytochrome-d-ubiquinol-oxidase-subunit-II
MIDLPTLQVIGWVIVGATLLAFALTSGFDSGIGILLPFIGRNDTERRLTLNVIGPTWDGNQVWLIAAGGAVFAIWPLVYSTAFSGYYVAMLLILWSLFLRPVGFEYRSKLPNQTWRNNWDVGIFIASFIPILIMGIAFGNLLLGSPFSYDPVFLRMQYTGSFIDLLSPFALLSGVIAIFMVTCHGAAYLNLRTKGIIKTRAQKALRLFAWCYLIAFALAGLLITYKIPGYLLGSQAGSIHDPLINHVNRHVGAWLNNYHTHHWMVLAPVIGFLGAFLAIISTHANRAIWSFIGTSFIQIGTLLTAAFSLFPFIMPSSSDPAHSLTVWNASTSQHTLTIIAIVAVIMVPIIFCYTSFVYIKMWRDGPIHEKDIEKNQHILY
>NZ_CP039227.1|WP_155080367.1|1441702_1443304_-|cytochrome-bd-I-ubiquinol-oxidase-subunit-CydA
MLPIEHVVELSRWQFGITALYHFIFVPLTLGMTWILFGMECLYVKTGKQVYKDMVRFWGKLFGINFAMGVVTGITMEFEFGVNWAYYSQYVGDIFGAPLAIEGLVAFMLESTFFGIFFFGWDKLSKKQHLFATFCLAIGSMFSALFILIANGWMQHPVGSQFNIDSMRMELTSFYDVLLNPTAQAEFAHTITAGLVTAAMFVTGISSYYLLKGRDIVFAKRSFIYGSFFGLIVLLGVAFFGDHAGLDVDETQPMKMAAIEGLWETPEAPAPWTILALPSNNQLKNLAAIKIPYALSIIATHSLDGTVKGMQEIIADNVVRMTQGRKAYLALIELRTEKNIDGKTLSAEQLTTAKHTLERYKDDLGYGLLLKSYISDIQHASEAQIQHVAKQAIPEVWAVFYSFRLMIGCFGIMLLIVLAAGFFNLRGKLWEQRWLFRTALYAIPLPFLACLFGWFVAEHGRQPWVVQNTLPTAMGTSSVSTGQLTFSLTGFALFYTLLFIIEIYLMFKYARLGPSALHTGCYHFEQPAHVNKS
>NZ_CP039227.1|WP_017378241.1|1443774_1443951_+|hypothetical-protein
MIDSIDTAMAQLTHNSGSFATFTSAGVVRRALTQAGFVVKKIPGFAGKREMMRGWETI
>NZ_CP039227.1|WP_155080368.1|1443947_1445225_+|FAD-dependent-5-carboxymethylaminomethyl-2-thiouridine(34)-oxidoreductase-MnmC
MTMLVEGNYAPWNRLAASVTSPNVIVVGAGIAGASTSWALSTQGFNVTLVEKAAEAAQEASGNLAGLMMPALATDQSSFAEYFIQAYLYSIQHAKTLAQSHQFNFSQTGIIQLAFNDRQQKRQKNWLELEHVADLLEWVSQEQVMALSGLDFSCSGVYFKEAAWLSPYLYVKSHIHACKTSINCLFNCYVNQLHYEQGLWKLYDQHQHLIAEAPTLILANASDATRLLGQFSSVLPLSLRTVRGQVSALENHARISQLKLPVCYDGYITPVINGKNYLGATFIDDYQAKCLHQDRVQNIQQLKQVLPGLNIDKREYKDISQDRAALRCITTDYLPVIGPVPDVAFYRQHYSRLIQDRRESRYPSAQYLPGLFMNIGHGSRGMVSAPFATKLLVSELMGKNLKLSKRLREHLHPGRFLIRQLKKGK
>NZ_CP039227.1|WP_155080369.1|1445581_1445995_+|hypothetical-protein
MPINIKQSLKRFQAQDALQASGSFLKKGLPEGTNQADFIKAVNREIQIVIDGMQSIVRNNQPSASSYRGEDSVSGLLELQFLLSQLIAEPKQAISKAFLTLIASIIYQYYKQTEIYSKKMENEGWLYLRKKYQKKRF
>NZ_CP039227.1|WP_155589561.1|1445952_1446225_+|hypothetical-protein
MAILKKKISEKKILIPENKEEILFNDLFKSLEKNFYGIGIDSNSGSSGCFLAWVERGEITESEESAGWYNLKCPLPSDKKEPQLRNYFCL
>NZ_CP039227.1|WP_155080370.1|1447358_1448039_+|hypothetical-protein
MGIISIVRKNPSEPESNEFIFVAATTATASSGQEDHGLLHSSRNFKQENNFSYSGLKGVSSATTQTNSKNLIHIINQKIQSTIDEISEKKVNLCFKTAIRKKSVKELKNLQNVLEIIFTEPEEKLTKEFVQLIQEKISQAYEEKITYKNKRLVCCLFDELKQDLSALHCSIDSLSAGLSVANVSDKSQVQQCESVQSPMLFHQQHEQNLQPVDRDRSCYVMYETSV
>NZ_CP039227.1|WP_155080371.1|1448281_1449163_+|hypothetical-protein
MDLDENAFSYHKKNKRMDQEVDVGCFHILNVKKMNYHKSSGIFFVDKIAFLEVKKFLDNGHDLQVVTAGAYPPEMISKVFNELGIDIKLQHGENYFNRFDFGVGGSGALNKQEFIDKHLNNNKAMLIDDQFCNQPKAKEGVLFTLTLPSRPFPTLVAIDKQLVLNLQKVGIDYDEIWKHAKDNLELQALAATTVSSVEGWQKAKQFIVVKSALESFNPAQSYQTPFSLITVNKRENLRDLRGLCSAVAASEEHSGLLVGELARLLNLPSNNALKLEICPEGNAVSMNDIVKTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP039227_3	3.1\|1435289\|31\|NZ_CP039227\|CRISPRCasFinder	1435289-1435319	31	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85746-85776	0	1.0
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83226-83259	3	0.912
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84366-84399	3	0.912
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83076-83109	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83106-83139	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83136-83169	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83166-83199	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83196-83229	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83256-83289	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83286-83319	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83316-83349	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83346-83379	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83376-83409	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83406-83439	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83436-83469	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83466-83499	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83496-83529	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83526-83559	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83556-83589	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83586-83619	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83616-83649	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83646-83679	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83676-83709	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83706-83739	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83736-83769	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83766-83799	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83796-83829	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83826-83859	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83856-83889	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83886-83919	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83916-83949	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83946-83979	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	83976-84009	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84006-84039	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84036-84069	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84066-84099	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84096-84129	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84126-84159	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84156-84189	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84186-84219	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84216-84249	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84246-84279	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84276-84309	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84306-84339	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84336-84369	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84396-84429	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84426-84459	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84456-84489	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84486-84519	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84516-84549	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84546-84579	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84576-84609	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84606-84639	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84636-84669	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84666-84699	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84696-84729	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84726-84759	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84756-84789	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84786-84819	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84816-84849	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84846-84879	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84876-84909	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84906-84939	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84936-84969	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84966-84999	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	84996-85029	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85026-85059	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85056-85089	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85086-85119	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85116-85149	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85146-85179	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85176-85209	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85206-85239	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85236-85269	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85266-85299	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85296-85329	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85326-85359	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85356-85389	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85386-85419	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85416-85449	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85446-85479	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85476-85509	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85506-85539	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85536-85569	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85566-85599	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85596-85629	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85626-85659	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85656-85689	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	NZ_CP039048	Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence	85686-85719	4	0.882
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	KU686195	Synechococcus phage S-CAM1 isolate 0810SB17, complete genome	76685-76718	9	0.735
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	KU686193	Synechococcus phage S-CAM1 isolate 0310NB17, complete genome	76687-76720	9	0.735
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	KU686194	Synechococcus phage S-CAM1 isolate 0809CC03, complete genome	76685-76718	9	0.735
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	KU686196	Synechococcus phage S-CAM1 isolate 0910CC29, complete genome	76685-76718	9	0.735
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	KU686192	Synechococcus phage S-CAM1 isolate 0309SB33, complete genome	76684-76717	9	0.735
NZ_CP039227_3	3.2\|1435346\|34\|NZ_CP039227\|CRISPRCasFinder	1435346-1435379	34	HQ634177	Synechococcus phage S-CAM1 genomic sequence	17036-17069	9	0.735

1. spacer 3.1|1435289|31|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 0, identity: 1.0

aagcttatagattctttacctgggactgata	CRISPR spacer
aagcttatagattctttacctgggactgata	Protospacer
*******************************

2. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.912

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctgcttctcaaggttctactt	Protospacer
*.*.***************************.**

3. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.912

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctgcttctcaaggttctactt	Protospacer
*.*.***************************.**

4. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

5. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

6. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

7. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

8. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

9. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

10. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

11. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

12. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

13. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

14. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

15. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

16. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

17. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

18. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

19. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

20. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

21. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

22. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

23. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

24. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

25. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

26. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

27. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

28. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

29. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

30. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

31. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

32. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

33. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

34. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

35. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

36. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

37. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

38. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

39. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

40. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

41. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

42. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

43. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

44. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

45. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

46. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

47. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

48. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

49. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

50. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

51. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

52. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

53. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

54. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

55. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

56. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

57. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

58. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

59. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

60. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

61. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

62. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

63. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

64. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

65. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

66. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

67. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

68. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

69. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

70. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

71. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

72. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

73. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgaggattctacttctcaaggttctactt	Protospacer
*.*.***********.***************.**

74. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

75. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

76. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

77. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

78. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

79. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

80. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

81. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

82. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

83. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

84. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

85. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

86. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

87. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

88. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

89. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to NZ_CP039048 (Piscirickettsia salmonis strain Psal-073 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.882

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
acttttgagggttctgcttctcaaggttctactt	Protospacer
*.*.******.********************.**

90. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to KU686195 (Synechococcus phage S-CAM1 isolate 0810SB17, complete genome) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

91. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to KU686193 (Synechococcus phage S-CAM1 isolate 0310NB17, complete genome) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

92. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to KU686194 (Synechococcus phage S-CAM1 isolate 0809CC03, complete genome) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

93. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to KU686196 (Synechococcus phage S-CAM1 isolate 0910CC29, complete genome) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

94. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to KU686192 (Synechococcus phage S-CAM1 isolate 0309SB33, complete genome) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

95. spacer 3.2|1435346|34|NZ_CP039227|CRISPRCasFinder matches to HQ634177 (Synechococcus phage S-CAM1 genomic sequence) position: , mismatch: 9, identity: 0.735

attcttgaggattctgcttctcaaggttctattt	CRISPR spacer
gtaggtgtagattctgcttctcaaggtactgttg	Protospacer
.*   ** .****************** **.**

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

8320 : 67215

unidentified_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079413.1\|8320_9490_-\|transposase	transposase	NA	NA	NA	NA
WP_155079415.1\|9631_9940_+	YcgL domain-containing protein	NA	NA	NA	NA
WP_155066245.1\|9945_10401_+	YcgN family cysteine cluster protein	NA	NA	NA	NA
WP_155066246.1\|10468_11398_+	16S rRNA (cytosine(1402)-N(4))-methyltransferase RsmH	NA	NA	NA	NA
WP_155066247.1\|11403_11724_+	cell division protein FtsL	NA	NA	NA	NA
WP_155066248.1\|11723_13448_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_155081463.1\|13404_14937_+	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase	NA	NA	NA	NA
WP_155079417.1\|14902_16297_+	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase	NA	NA	NA	NA
WP_155079419.1\|16290_17331_+	phospho-N-acetylmuramoyl-pentapeptide- transferase	NA	NA	NA	NA
WP_155079421.1\|17332_18706_+	UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase	NA	NA	NA	NA
WP_155079422.1\|18702_19866_+	putative lipid II flippase FtsW	NA	NA	NA	NA
WP_155081464.1\|19882_20965_+	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase	NA	NA	NA	NA
WP_155079424.1\|20939_22397_+	UDP-N-acetylmuramate--L-alanine ligase	NA	NA	NA	NA
WP_155079426.1\|22393_23431_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_155066256.1\|23432_24152_+	FtsQ-type POTRA domain-containing protein	NA	NA	NA	NA
WP_016209355.1\|24197_25445_+	cell division protein FtsA	NA	NA	NA	NA
WP_016209342.1\|25489_26623_+	cell division protein FtsZ	NA	NA	NA	NA
WP_155066257.1\|26701_27562_+	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_155079429.1\|27703_30436_+	preprotein translocase subunit SecA	NA	NA	NA	NA
WP_155066259.1\|30645_31779_+	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	2.4e-40	31.8
WP_155068597.1\|31808_32081_-	acylphosphatase	NA	NA	NA	NA
WP_155066260.1\|32188_33001_+	hypothetical protein	NA	NA	NA	NA
WP_155079431.1\|33014_33236_-	hypothetical protein	NA	NA	NA	NA
WP_155079433.1\|33442_34798_+	hypothetical protein	NA	NA	NA	NA
WP_155066264.1\|35391_35760_-	(2Fe-2S) ferredoxin domain-containing protein	NA	NA	NA	NA
WP_155079435.1\|36875_38651_+	peptidase M4 family protein	NA	NA	NA	NA
WP_155079437.1\|39552_39693_-	phosphatase	NA	NA	NA	NA
WP_155066936.1\|39760_40111_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|40142_40595_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079439.1\|41134_42021_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	1.7e-09	28.8
WP_155079441.1\|44356_47050_-	DNA polymerase I	A0A2H4J6W7	uncultured_Caudovirales_phage	5.2e-70	31.0
WP_155068598.1\|47081_47669_-	hypothetical protein	NA	NA	NA	NA
WP_155079443.1\|47713_48754_+	beta-eliminating lyase	NA	NA	NA	NA
WP_155066269.1\|48874_49099_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|49384_50359_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079447.1\|50707_51442_-	DUF3750 domain-containing protein	NA	NA	NA	NA
WP_155079448.1\|52065_53592_+	2,3-bisphosphoglycerate-independent phosphoglycerate mutase	NA	NA	NA	NA
WP_155068599.1\|53731_54805_+	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_027242742.1\|54844_56152_+	S41 family peptidase	A0A0R6PIZ1	Moraxella_phage	1.2e-24	28.4
WP_155079450.1\|56126_57296_+	glycoside hydrolase family 3 protein	NA	NA	NA	NA
WP_155079452.1\|57350_58076_+	16S rRNA (uracil(1498)-N(3))-methyltransferase	NA	NA	NA	NA
WP_155079454.1\|58513_58705_-	hypothetical protein	NA	NA	NA	NA
WP_155079457.1\|58815_59745_-\|transposase	transposase	NA	NA	NA	NA
WP_155079459.1\|59796_59997_-	hypothetical protein	NA	NA	NA	NA
WP_155079461.1\|60133_61108_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.5e-27	31.3
WP_155079463.1\|61572_62376_+	hypothetical protein	NA	NA	NA	NA
WP_155079465.1\|62601_63090_+	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|63098_63551_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079467.1\|63582_63828_-\|transposase	transposase	NA	NA	NA	NA
WP_155079470.1\|64312_65167_+	hypothetical protein	NA	NA	NA	NA
WP_155079472.1\|65342_65687_-	hypothetical protein	NA	NA	NA	NA
WP_155079474.1\|65828_66272_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|66287_66674_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|66657_67215_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_2

75064 : 131164

Hokovirus(15.38%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079487.1\|75064_76114_+\|transposase	transposase	NA	NA	NA	NA
WP_155079488.1\|76130_76250_+	hypothetical protein	NA	NA	NA	NA
WP_155079490.1\|76327_77302_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.3e-28	31.5
WP_155079492.1\|77325_77559_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|77590_78043_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079495.1\|78293_79247_-	glutathione synthase	NA	NA	NA	NA
WP_155079497.1\|79291_80455_-	radical SAM family heme chaperone HemW	NA	NA	NA	NA
WP_155079499.1\|80460_81060_-	RdgB/HAM1 family non-canonical purine NTP pyrophosphatase	NA	NA	NA	NA
WP_155081467.1\|81247_81739_+	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	1.0e-19	41.2
WP_155079501.1\|81765_82854_+	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_155079503.1\|82992_84237_+	hypothetical protein	NA	NA	NA	NA
WP_155079505.1\|84233_85076_+	shikimate dehydrogenase	NA	NA	NA	NA
WP_155079507.1\|85055_85859_-	hypothetical protein	NA	NA	NA	NA
WP_155068602.1\|86057_86273_+	hypothetical protein	NA	NA	NA	NA
WP_155079509.1\|86273_87242_+	TonB family protein	NA	NA	NA	NA
WP_155081468.1\|87297_87849_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_155066294.1\|87975_88398_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_155081469.1\|88390_89152_+	hypothetical protein	NA	NA	NA	NA
WP_155066295.1\|89206_89905_+	YggS family pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_155079511.1\|89915_90740_+	pyrroline-5-carboxylate reductase	A0A1X9I6T5	Streptococcus_phage	2.1e-25	35.5
WP_155066936.1\|90954_91305_+\|transposase	transposase	NA	NA	NA	NA
WP_155081470.1\|91336_91789_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079513.1\|92316_92601_+	hypothetical protein	NA	NA	NA	NA
WP_155079515.1\|92824_92962_-	phosphatase	NA	NA	NA	NA
WP_155066301.1\|93305_94520_-	aromatic amino acid transport family protein	NA	NA	NA	NA
WP_155068606.1\|94831_95893_+	uroporphyrinogen decarboxylase	NA	NA	NA	NA
WP_155066302.1\|95906_97634_+	oxaloacetate-decarboxylating malate dehydrogenase	NA	NA	NA	NA
WP_155066303.1\|97666_98398_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_155068607.1\|98397_99186_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_155079519.1\|99290_99914_+	hypothetical protein	NA	NA	NA	NA
WP_155079521.1\|100103_100292_+	hypothetical protein	NA	NA	NA	NA
WP_155066306.1\|100379_101132_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_155066307.1\|106811_107435_+	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_155081471.1\|107474_107957_+	low molecular weight phosphotyrosine protein phosphatase	NA	NA	NA	NA
WP_155066308.1\|108005_109151_+	lipoprotein	NA	NA	NA	NA
WP_155079523.1\|109152_111423_+	polysaccharide biosynthesis tyrosine autokinase	NA	NA	NA	NA
WP_155081472.1\|111424_112273_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.0e-67	51.1
WP_155079524.1\|112279_113152_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.9e-91	58.3
WP_155079526.1\|113148_114153_+	dTDP-glucose 4,6-dehydratase	A0A1D7XFE8	Escherichia_phage	5.7e-78	48.5
WP_155066313.1\|114172_114580_+	adenylyltransferase/cytidyltransferase family protein	A0A1V0SGE7	Hokovirus	1.8e-27	48.9
WP_155079528.1\|114607_115996_+	oligosaccharide flippase family protein	NA	NA	NA	NA
WP_155079530.1\|115992_117165_+	glycerophosphotransferase	NA	NA	NA	NA
WP_155079533.1\|117196_118048_+	glycosyltransferase	NA	NA	NA	NA
WP_155079535.1\|118063_119221_+	hypothetical protein	NA	NA	NA	NA
WP_155068609.1\|119295_120225_+	glycosyltransferase	B6EFC4	Stygiolobus_rod-shaped_virus	2.7e-05	34.2
WP_155066318.1\|120221_121358_+	glycosyltransferase	NA	NA	NA	NA
WP_155066319.1\|121354_122281_+	NAD-dependent epimerase/dehydratase family protein	A0A2K9L4U8	Tupanvirus	1.7e-57	45.0
WP_155066320.1\|122370_123768_-	mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase	A0A1V0SH58	Hokovirus	9.7e-52	30.4
WP_155079537.1\|124042_125455_+	undecaprenyl-phosphate glucose phosphotransferase	NA	NA	NA	NA
WP_155079539.1\|125536_126364_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|126431_126989_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|126972_127359_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079541.1\|127527_128532_+	OmpA family protein	NA	NA	NA	NA
WP_155066325.1\|128583_128814_-	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.7e-06	40.7
WP_036771588.1\|128822_129701_-	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	2.0e-39	40.9
WP_155066327.1\|130063_131164_+\|protease	trypsin-like serine protease	A0A1B1IT49	uncultured_Mediterranean_phage	3.1e-21	28.1

DBSCAN-SWA_3

197123 : 240461

unidentified_phage(75.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079617.1\|197123_197777_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155079619.1\|198291_199080_-	MFS transporter	NA	NA	NA	NA
WP_155589541.1\|199956_200409_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|200558_201116_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|201099_201486_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079622.1\|201554_201833_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_155066404.1\|201894_202780_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079624.1\|202807_203164_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_155079626.1\|203287_204547_-	hypothetical protein	NA	NA	NA	NA
WP_155079627.1\|205035_206073_-\|transposase	transposase	NA	NA	NA	NA
WP_155079629.1\|206201_206795_+	CDP-alcohol phosphatidyltransferase	NA	NA	NA	NA
WP_155066393.1\|206763_207417_-	hypothetical protein	NA	NA	NA	NA
WP_155079631.1\|207595_208585_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_155066395.1\|208607_209504_-	branched-chain amino acid transaminase	NA	NA	NA	NA
WP_017377592.1\|209663_210107_+	hypothetical protein	NA	NA	NA	NA
WP_155066396.1\|210103_210745_-	uracil phosphoribosyltransferase	NA	NA	NA	NA
WP_155066397.1\|210855_211434_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|212010_212361_+\|transposase	transposase	NA	NA	NA	NA
WP_155079634.1\|212287_212527_+	hypothetical protein	NA	NA	NA	NA
WP_155081475.1\|213026_213305_+	hypothetical protein	NA	NA	NA	NA
WP_155079635.1\|213357_213546_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|213600_213951_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|213982_214435_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079638.1\|215072_215534_+	hypothetical protein	NA	NA	NA	NA
WP_155079640.1\|215819_216290_+\|transposase	transposase	NA	NA	NA	NA
WP_155079642.1\|216332_216734_+	hypothetical protein	NA	NA	NA	NA
WP_155079644.1\|216791_217382_+\|transposase	transposase	NA	NA	NA	NA
WP_155589542.1\|217463_217799_+	hypothetical protein	NA	NA	NA	NA
WP_155079648.1\|218315_218522_+	hypothetical protein	NA	NA	NA	NA
WP_155085302.1\|218560_219664_+	hypothetical protein	NA	NA	NA	NA
WP_155079655.1\|219741_220716_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	9.8e-27	30.7
WP_155079657.1\|220920_221181_+	hypothetical protein	NA	NA	NA	NA
WP_155081476.1\|221208_223215_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155079659.1\|223351_225682_-	PBP1A family penicillin-binding protein	NA	NA	NA	NA
WP_155079660.1\|225812_226655_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|226655_227213_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|227196_227583_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079662.1\|227762_228158_+	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|228297_229272_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155068789.1\|229503_230763_+	type IV pilus secretin PilQ	G4WZN6	Enterobacteria_phage	6.1e-13	24.1
WP_155068500.1\|231011_231536_+	shikimate kinase AroK	NA	NA	NA	NA
WP_155068499.1\|231643_232645_+	AAA family ATPase	NA	NA	NA	NA
WP_155079663.1\|232732_233629_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155079665.1\|233772_234990_+	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_155068496.1\|235453_236770_+	MFS transporter	NA	NA	NA	NA
WP_155079667.1\|236868_237177_+	hypothetical protein	NA	NA	NA	NA
WP_155079669.1\|237787_238762_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.5e-27	30.7
WP_155079671.1\|238799_239417_+\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_155068622.1\|239626_240079_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|240110_240461_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_4

280938 : 313241

Faustovirus(25.0%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|280938_281496_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155068461.1\|281966_282821_-	SIS domain-containing protein	NA	NA	NA	NA
WP_017378137.1\|283295_283514_+	50S ribosomal protein L31	NA	NA	NA	NA
WP_155079703.1\|283615_284866_+	malate dehydrogenase	NA	NA	NA	NA
WP_155079705.1\|284921_285404_-	hypothetical protein	NA	NA	NA	NA
WP_155079706.1\|285748_286105_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|287668_288226_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079708.1\|288209_288596_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079710.1\|288997_289963_-	hypothetical protein	NA	NA	NA	NA
WP_155079712.1\|291145_291970_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_155079713.1\|292172_293249_+	4-hydroxyphenylpyruvate dioxygenase	NA	NA	NA	NA
WP_155079714.1\|293333_294320_+	2-keto-4-pentenoate hydratase	NA	NA	NA	NA
WP_155079716.1\|294338_294983_+	maleylacetoacetate isomerase	NA	NA	NA	NA
WP_155589543.1\|294994_296104_+	histidinol-phosphate transaminase	A0A142C026	Faustovirus	1.2e-17	23.5
WP_155079720.1\|296216_296948_-	hypothetical protein	NA	NA	NA	NA
WP_155068448.1\|297443_299327_-	phosphomethylpyrimidine synthase ThiC	NA	NA	NA	NA
WP_155068447.1\|299640_301140_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_155079722.1\|301229_302012_+	exodeoxyribonuclease III	E3T4M6	Cafeteria_roenbergensis_virus	4.1e-31	33.3
WP_155068445.1\|302139_303060_+	SPFH/Band 7/PHB domain protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	2.2e-20	27.5
WP_155068444.1\|303083_303542_+	NfeD family protein	NA	NA	NA	NA
WP_155079724.1\|304172_305354_-\|transposase	transposase	NA	NA	NA	NA
WP_155079726.1\|306339_307314_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.4e-28	31.8
WP_155079728.1\|307874_308480_-	hypothetical protein	NA	NA	NA	NA
WP_155079730.1\|308580_308742_+	hypothetical protein	NA	NA	NA	NA
WP_155079731.1\|309006_309255_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|309238_309796_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079733.1\|309929_310979_+\|transposase	transposase	NA	NA	NA	NA
WP_155068441.1\|311305_312283_+	Nudix family hydrolase	NA	NA	NA	NA
WP_155068440.1\|312392_313241_+\|protease	zinc metalloprotease HtpX	NA	NA	NA	NA

DBSCAN-SWA_5

424483 : 486964

unidentified_phage(44.44%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|424483_425041_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079803.1\|425021_425240_-	hypothetical protein	NA	NA	NA	NA
WP_155066524.1\|425502_425805_-	hypothetical protein	NA	NA	NA	NA
WP_155079804.1\|426386_427556_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|427970_428357_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|428340_428898_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|428955_429342_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|429325_429883_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589545.1\|429883_430432_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155079806.1\|430735_431821_+	hypothetical protein	NA	NA	NA	NA
WP_155079807.1\|431804_432671_-\|transposase	transposase	NA	NA	NA	NA
WP_155079808.1\|432744_433053_+	hypothetical protein	NA	NA	NA	NA
WP_155079809.1\|433095_434070_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	5.8e-27	31.3
WP_155079810.1\|434109_434901_+\|transposase	transposase	NA	NA	NA	NA
WP_155079811.1\|434967_435141_+	hypothetical protein	NA	NA	NA	NA
WP_155079812.1\|435259_437026_-	hypothetical protein	NA	NA	NA	NA
WP_155079813.1\|437404_438103_+	DUF21 domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|438179_439154_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079814.1\|439177_439483_+	CBS domain-containing protein	NA	NA	NA	NA
WP_155079815.1\|439502_440477_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.0e-28	31.2
WP_017376982.1\|440704_441178_+\|tRNA	tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL	NA	NA	NA	NA
WP_155079816.1\|441219_441735_-	disulfide bond formation protein B	NA	NA	NA	NA
WP_155079817.1\|441734_442751_-\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_155079818.1\|443158_443944_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155079819.1\|444007_444622_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_016210574.1\|444762_445182_+	prokaryotic dksA/traR C4-type zinc finger family protein	NA	NA	NA	NA
WP_155079820.1\|445237_445861_+	YihA family ribosome biogenesis GTP-binding protein	NA	NA	NA	NA
WP_155079821.1\|446083_447841_+\|tRNA	arginine--tRNA ligase	NA	NA	NA	NA
WP_155081480.1\|447962_448946_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_017376975.1\|449026_449578_+\|protease	ATP-dependent protease subunit HslV	NA	NA	NA	NA
WP_017376974.1\|449588_450956_+\|protease	ATP-dependent protease ATPase subunit HslU	A0A173GFL6	Erwinia_phage	1.6e-43	29.9
WP_155068778.1\|451106_451343_+	hypothetical protein	NA	NA	NA	NA
WP_155079822.1\|451401_452145_+	bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE	NA	NA	NA	NA
WP_155079823.1\|452144_452786_+	hypothetical protein	NA	NA	NA	NA
WP_155079824.1\|452785_454450_+	ubiquinone biosynthesis regulatory protein kinase UbiB	E5ERK4	Ostreococcus_lucimarinus_virus	1.1e-33	28.5
WP_155079825.1\|454477_454813_+	HIT domain-containing protein	NA	NA	NA	NA
WP_155081481.1\|454940_456539_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	64.3
WP_155079741.1\|456594_457569_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155079826.1\|457858_458745_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079827.1\|458808_459750_+\|transposase	transposase	NA	NA	NA	NA
WP_155068353.1\|459818_460109_+	hypothetical protein	NA	NA	NA	NA
WP_155081482.1\|460321_460753_+	hypothetical protein	NA	NA	NA	NA
WP_155079828.1\|460815_463296_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	5.9e-193	44.0
WP_155079829.1\|463383_463863_+	lipopolysaccharide-assembly family protein	NA	NA	NA	NA
WP_155079830.1\|463835_464876_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_155068349.1\|464812_465529_+	nicotinate-nucleotide adenylyltransferase	NA	NA	NA	NA
WP_016210374.1\|465541_465877_+	ribosome silencing factor	NA	NA	NA	NA
WP_155079831.1\|465913_466384_+	23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH	NA	NA	NA	NA
WP_155081483.1\|466429_468265_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_155068346.1\|468261_469398_+	rod shape-determining protein RodA	NA	NA	NA	NA
WP_155068345.1\|469419_470481_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_155068344.1\|470558_471074_+	SPOR domain-containing protein	NA	NA	NA	NA
WP_017376955.1\|471114_472392_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.8e-66	39.0
WP_155079832.1\|472406_473258_+	aminotransferase class IV family protein	NA	NA	NA	NA
WP_155079833.1\|473283_473934_+	lipoyl(octanoyl) transferase LipB	NA	NA	NA	NA
WP_155081484.1\|473930_474890_+	lipoyl synthase	NA	NA	NA	NA
WP_155079834.1\|476440_476626_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|476690_477248_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|477231_477618_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079835.1\|477728_478001_-	hypothetical protein	NA	NA	NA	NA
WP_155079836.1\|478080_478287_-	hypothetical protein	NA	NA	NA	NA
WP_155079837.1\|479190_480174_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079838.1\|480334_481537_+	hypothetical protein	NA	NA	NA	NA
WP_155079839.1\|481689_482265_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155079478.1\|482265_482823_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|482806_483193_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079840.1\|483925_484804_+	hypothetical protein	NA	NA	NA	NA
WP_155079841.1\|485313_485496_+	hypothetical protein	NA	NA	NA	NA
WP_155079842.1\|485587_485980_-	ribosome-associated heat shock protein Hsp15	NA	NA	NA	NA
WP_155079476.1\|486036_486423_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|486406_486964_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_6

508600 : 593125

Acinetobacter_phage(28.57%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155066278.1\|508600_509650_+\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|510011_510986_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079851.1\|511207_511948_-	tryptophan 2,3-dioxygenase	NA	NA	NA	NA
WP_155079852.1\|512051_512780_-	DUF541 domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|513175_514150_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079853.1\|514192_515236_-	hypothetical protein	NA	NA	NA	NA
WP_016210764.1\|515552_515813_-	30S ribosomal protein S20	NA	NA	NA	NA
WP_155079854.1\|515986_517525_+	murein biosynthesis integral membrane protein MurJ	NA	NA	NA	NA
WP_155068776.1\|517703_518630_+	bifunctional riboflavin kinase/FAD synthetase	A0A1V0SJE1	Klosneuvirus	7.2e-11	33.6
WP_155068307.1\|518769_521583_+\|tRNA	isoleucine--tRNA ligase	K7YVP8	Megavirus	3.9e-76	26.7
WP_155068306.1\|521575_522085_+	lipoprotein signal peptidase	NA	NA	NA	NA
WP_017377277.1\|522088_522532_+	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_155079855.1\|522618_523938_-	MFS transporter	NA	NA	NA	NA
WP_155068304.1\|524200_524581_+	hypothetical protein	NA	NA	NA	NA
WP_155068303.1\|524572_525295_-	aquaporin family protein	M1H9L8	Acanthocystis_turfacea_Chlorella_virus	2.1e-26	37.6
WP_155067805.1\|526277_527156_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_155066936.1\|528044_528395_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|528426_528879_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079478.1\|529171_529729_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|529712_530099_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079856.1\|531131_531461_+	hypothetical protein	NA	NA	NA	NA
WP_155079857.1\|531846_532212_+	hypothetical protein	NA	NA	NA	NA
WP_155068300.1\|532335_533196_+	DUF692 family protein	NA	NA	NA	NA
WP_155079858.1\|533182_533962_+	DUF2063 domain-containing protein	NA	NA	NA	NA
WP_016210168.1\|534038_534722_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079859.1\|534882_535413_-	hypothetical protein	NA	NA	NA	NA
WP_017377265.1\|535704_536208_+	RNA pyrophosphohydrolase	NA	NA	NA	NA
WP_155068297.1\|536409_536664_+	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_155079860.1\|537165_537633_+	DoxX family membrane protein	NA	NA	NA	NA
WP_155079861.1\|537868_538012_-	hypothetical protein	NA	NA	NA	NA
WP_155079862.1\|538648_539002_-	hypothetical protein	NA	NA	NA	NA
WP_155079863.1\|539570_540035_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	5.9e-30	45.9
WP_155079864.1\|540103_541259_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-50	39.0
WP_155079864.1\|541567_542724_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-50	39.0
WP_155079865.1\|543726_544344_-	hypothetical protein	NA	NA	NA	NA
WP_155079866.1\|544750_545818_-	hypothetical protein	NA	NA	NA	NA
WP_155079867.1\|546101_546353_+\|transposase	transposase	NA	NA	NA	NA
WP_155079868.1\|546309_547466_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155079869.1\|547682_548492_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.4e-47	39.1
WP_155079627.1\|548507_549545_-\|transposase	transposase	NA	NA	NA	NA
WP_155079870.1\|549587_549926_-	hypothetical protein	NA	NA	NA	NA
WP_155079871.1\|549897_550194_-	hypothetical protein	NA	NA	NA	NA
WP_155079872.1\|550383_551004_-	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|551041_551927_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079873.1\|551891_552401_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|552876_553434_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|553417_553804_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079874.1\|554158_554548_-	hypothetical protein	NA	NA	NA	NA
WP_155079875.1\|554474_554825_-\|transposase	transposase	NA	NA	NA	NA
WP_155079476.1\|555249_555636_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|555619_556177_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155068292.1\|556329_557490_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	1.1e-120	58.5
WP_155079876.1\|557783_557924_+	hypothetical protein	NA	NA	NA	NA
WP_155068291.1\|558073_560077_+	transketolase	NA	NA	NA	NA
WP_155079877.1\|560145_561153_+	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_155079878.1\|561226_562411_+	phosphoglycerate kinase	NA	NA	NA	NA
WP_155079879.1\|562420_563875_+	pyruvate kinase	NA	NA	NA	NA
WP_017376008.1\|563905_564943_+	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_155079476.1\|565359_565746_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079880.1\|565729_566239_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079478.1\|566340_566898_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|566881_567268_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079881.1\|567290_567704_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|567687_568074_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079882.1\|568089_568404_+	hypothetical protein	NA	NA	NA	NA
WP_155079883.1\|568349_568925_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079884.1\|569053_569872_+	DSD1 family PLP-dependent enzyme	NA	NA	NA	NA
WP_155081485.1\|570034_570559_+	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	1.5e-50	58.4
WP_155068294.1\|570558_571089_+	ferric uptake regulator family protein	NA	NA	NA	NA
WP_155079885.1\|571209_571917_-	hypothetical protein	NA	NA	NA	NA
WP_155079886.1\|572118_572487_-	hypothetical protein	NA	NA	NA	NA
WP_155079887.1\|572710_573253_+	hypothetical protein	NA	NA	NA	NA
WP_155079888.1\|573227_573374_-	hypothetical protein	NA	NA	NA	NA
WP_155079889.1\|573349_573892_+	hypothetical protein	NA	NA	NA	NA
WP_155079890.1\|573998_574649_-	isoprenoid biosynthesis glyoxalase ElbB	NA	NA	NA	NA
WP_155068276.1\|574749_575409_-	hypothetical protein	NA	NA	NA	NA
WP_155081486.1\|575638_576091_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|576122_576473_-\|transposase	transposase	NA	NA	NA	NA
WP_155068773.1\|577352_577634_+	hypothetical protein	NA	NA	NA	NA
WP_155079891.1\|578516_579644_+	hypothetical protein	NA	NA	NA	NA
WP_155066488.1\|580644_580995_+\|transposase	transposase	NA	NA	NA	NA
WP_155079892.1\|580921_581389_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|581502_582732_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079893.1\|582831_583119_-	hypothetical protein	NA	NA	NA	NA
WP_155079730.1\|583134_583296_+	hypothetical protein	NA	NA	NA	NA
WP_155079731.1\|583560_583809_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|583792_584350_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079894.1\|584634_585753_-\|transposase	transposase	NA	NA	NA	NA
WP_155079895.1\|585767_585983_-	hypothetical protein	NA	NA	NA	NA
WP_155079896.1\|585986_586541_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|586521_587079_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079897.1\|587062_587449_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079898.1\|587547_588276_+	hypothetical protein	NA	NA	NA	NA
WP_155079899.1\|588304_588931_-	ribonuclease T	NA	NA	NA	NA
WP_155079900.1\|588960_590160_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_155068263.1\|590397_591495_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.8e-06	43.1
WP_155079901.1\|591607_593125_+\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	1.7e-86	36.1

DBSCAN-SWA_7

597788 : 647426

unidentified_phage(22.22%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|597788_598346_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079908.1\|598711_599344_-	riboflavin synthase subunit alpha	A0A1V0SE20	Indivirus	8.1e-14	32.8
WP_155068250.1\|599547_600498_-	alpha-L-glutamate ligase-like protein	NA	NA	NA	NA
WP_155079909.1\|600494_602027_-	transglutaminase	NA	NA	NA	NA
WP_155079910.1\|602023_602554_-\|protease	ATP-dependent zinc protease	NA	NA	NA	NA
WP_155068247.1\|602731_602872_+	hypothetical protein	NA	NA	NA	NA
WP_155079911.1\|602889_603537_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|603654_604212_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|604195_604582_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079912.1\|604820_605525_-	hypothetical protein	NA	NA	NA	NA
WP_155079913.1\|605819_606044_-	hypothetical protein	NA	NA	NA	NA
WP_155068241.1\|606123_606579_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_155079914.1\|606547_607489_-	EamA family transporter	NA	NA	NA	NA
WP_155079915.1\|607737_608925_+	Bcr/CflA family efflux MFS transporter	S4TR35	Salmonella_phage	2.2e-20	25.6
WP_016210937.1\|609016_609298_+	RNA chaperone Hfq	NA	NA	NA	NA
WP_027242634.1\|609383_610061_-	TIGR00153 family protein	NA	NA	NA	NA
WP_155079916.1\|610106_611366_-	phosphate permease	E5ESL8	Bathycoccus_sp._RCC1105_virus	4.5e-24	34.7
WP_155079917.1\|611563_612613_+	pyridine nucleotide-disulfide oxidoreductase	NA	NA	NA	NA
WP_155068236.1\|612691_613498_+	prolipoprotein diacylglyceryl transferase	NA	NA	NA	NA
WP_155079918.1\|613519_614314_+	thymidylate synthase	A6M9A2	Geobacillus_virus	1.2e-102	66.7
WP_155068769.1\|614412_615432_+	S-methyl-5-thioribose-1-phosphate isomerase	NA	NA	NA	NA
WP_155079919.1\|615478_616090_+	methylthioribulose 1-phosphate dehydratase	NA	NA	NA	NA
WP_155079920.1\|616093_616780_+	acireductone synthase	NA	NA	NA	NA
WP_155068232.1\|616776_617319_+	acireductone dioxygenase	NA	NA	NA	NA
WP_155079921.1\|617400_618588_-	S-methyl-5-thioribose kinase	NA	NA	NA	NA
WP_155079922.1\|618833_619571_+	D-Ala-D-Ala dipeptidase	NA	NA	NA	NA
WP_155068768.1\|620529_620826_-	nucleic acid-binding protein	NA	NA	NA	NA
WP_155081487.1\|621544_621721_-	hypothetical protein	NA	NA	NA	NA
WP_155079923.1\|621892_622294_-	hypothetical protein	NA	NA	NA	NA
WP_155079924.1\|622350_622635_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|622734_623709_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079925.1\|624183_626007_-	hypothetical protein	NA	NA	NA	NA
WP_155079926.1\|626457_627717_-	diphosphate--fructose-6-phosphate 1-phosphotransferase	NA	NA	NA	NA
WP_155068224.1\|628330_629713_+	UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase	NA	NA	NA	NA
WP_155068767.1\|629705_630323_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_155079927.1\|630401_631118_+	hypothetical protein	NA	NA	NA	NA
WP_155068222.1\|631289_633614_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-21	47.1
WP_155079634.1\|634469_634709_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|634635_634986_-\|transposase	transposase	NA	NA	NA	NA
WP_155079928.1\|635040_635790_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.3e-10	29.8
WP_155079929.1\|636565_637987_+	hypothetical protein	NA	NA	NA	NA
WP_155079930.1\|638173_639265_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155079931.1\|639298_639937_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_155068218.1\|639975_640248_-	DUF1315 family protein	NA	NA	NA	NA
WP_144420763.1\|640328_640571_-	BolA/IbaG family iron-sulfur metabolism protein	NA	NA	NA	NA
WP_155068216.1\|640588_640891_-	YciI family protein	NA	NA	NA	NA
WP_155068215.1\|640974_641517_-	septation protein A	NA	NA	NA	NA
WP_016210074.1\|641678_642305_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_155079932.1\|642310_643150_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	3.6e-09	23.8
WP_155079933.1\|643139_643790_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	1.1e-18	32.9
WP_155068213.1\|643793_644627_+	pseudouridine synthase	NA	NA	NA	NA
WP_155079934.1\|645087_645294_-	hypothetical protein	NA	NA	NA	NA
WP_155079874.1\|645580_645970_-	hypothetical protein	NA	NA	NA	NA
WP_155066739.1\|645896_646247_-\|transposase	transposase	NA	NA	NA	NA
WP_155066936.1\|646591_646942_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|646973_647426_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_8

651145 : 746410

108

Vibrio_phage(14.29%)

tRNA,integrase,transposase

attL 646522:646581|attR 698059:698542

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
646522:646581	attL	NA	NA	NA	NA
WP_155068208.1\|651145_652342_+\|tRNA	tyrosine--tRNA ligase	A0A1V0SHQ2	Klosneuvirus	1.6e-10	24.8
WP_155079938.1\|652362_652959_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_155079939.1\|655072_655741_-	BAX inhibitor (BI)-1/YccA family protein	A0A2H4JFM9	uncultured_Caudovirales_phage	6.1e-28	44.1
WP_155068206.1\|655888_657190_-	inosine/guanosine kinase	NA	NA	NA	NA
WP_155081488.1\|657446_658265_+	hypothetical protein	NA	NA	NA	NA
WP_036777829.1\|658691_659096_+	hypothetical protein	NA	NA	NA	NA
WP_155079941.1\|659329_660412_+	alanine racemase	A0A0P0YM39	Yellowstone_lake_mimivirus	1.7e-19	28.2
WP_155068204.1\|660396_660999_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155079942.1\|661063_661939_+	6-pyruvoyl tetrahydropterin synthase	A0A140B3P3	Vibrio_phage	1.8e-11	24.0
WP_122942894.1\|662016_662592_+	spermidine N1-acetyltransferase	NA	NA	NA	NA
WP_155079943.1\|663322_664456_+	DUF4102 domain-containing protein	A0A1V0E8G8	Vibrio_phage	1.9e-90	48.5
WP_155081489.1\|664456_664726_+\|integrase	integrase	A0A1V0E8G8	Vibrio_phage	1.2e-14	55.1
WP_155079476.1\|664945_665332_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|665315_665873_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079944.1\|665880_666525_+	hypothetical protein	NA	NA	NA	NA
WP_155079945.1\|666607_666982_+	hypothetical protein	NA	NA	NA	NA
WP_155079946.1\|667086_667275_+	AlpA family phage regulatory protein	A0A0R6PC61	Moraxella_phage	1.1e-06	49.1
WP_155079947.1\|667231_668290_+	hypothetical protein	Q7M2A8	Enterobacteria_phage	5.0e-32	35.5
WP_155079948.1\|668286_669492_+	hypothetical protein	A0A1L6BZE6	Pasteurella_phage	1.0e-17	29.9
WP_155079487.1\|669538_670588_+\|transposase	transposase	NA	NA	NA	NA
WP_155079949.1\|670604_670850_+	hypothetical protein	NA	NA	NA	NA
WP_155079950.1\|671300_671993_+	hypothetical protein	NA	NA	NA	NA
WP_155079951.1\|672035_673085_+\|transposase	transposase	NA	NA	NA	NA
WP_155079952.1\|673101_673485_+	hypothetical protein	NA	NA	NA	NA
WP_155079953.1\|673522_673864_-	hypothetical protein	NA	NA	NA	NA
WP_155079954.1\|673974_674343_+	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|674385_675435_+\|transposase	transposase	NA	NA	NA	NA
WP_155589548.1\|675606_676026_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|676453_677011_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|676994_677381_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079956.1\|678267_678756_-	hypothetical protein	NA	NA	NA	NA
WP_155079957.1\|679045_679198_-	phosphatase	NA	NA	NA	NA
WP_155079958.1\|679473_679782_+	hypothetical protein	NA	NA	NA	NA
WP_155079959.1\|679778_680129_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155079960.1\|680171_681569_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	5.9e-65	32.6
WP_155079961.1\|681932_682586_-	hypothetical protein	NA	NA	NA	NA
WP_155079962.1\|683368_684427_-	hypothetical protein	NA	NA	NA	NA
WP_155079963.1\|684705_685095_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079476.1\|685091_685478_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|685461_686019_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079964.1\|687238_688030_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155079965.1\|688570_689137_+	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|689805_690780_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079966.1\|690839_691238_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079967.1\|691283_691913_+	hypothetical protein	NA	NA	NA	NA
WP_155079968.1\|692279_693920_-	glucose-6-phosphate isomerase	NA	NA	NA	NA
WP_155068160.1\|694032_695382_+	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	1.8e-74	37.0
WP_155068159.1\|695378_696248_+	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	1.2e-68	47.2
WP_155079969.1\|696994_697309_+\|transposase	transposase	NA	NA	NA	NA
WP_155079970.1\|697305_698013_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	4.8e-47	43.1
WP_155066936.1\|698128_698479_+\|transposase	transposase	NA	NA	NA	NA
WP_155079971.1\|698405_698576_+	hypothetical protein	NA	NA	NA	NA
698059:698542	attR	NA	NA	NA	NA
WP_155067991.1\|698834_699251_+\|transposase	transposase	NA	NA	NA	NA
WP_155589549.1\|700113_700944_-\|transposase	transposase	NA	NA	NA	NA
WP_155068155.1\|701456_701903_+	hypothetical protein	NA	NA	NA	NA
WP_155081490.1\|701989_702490_+	DoxX family membrane protein	NA	NA	NA	NA
WP_155079973.1\|702599_702794_+\|transposase	transposase	NA	NA	NA	NA
WP_155066278.1\|702790_703840_-\|transposase	transposase	NA	NA	NA	NA
WP_155079974.1\|704164_704530_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079975.1\|704475_705051_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|705236_705623_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|705606_706164_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079976.1\|706214_706826_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.1e-23	35.0
WP_155068600.1\|707082_707307_+	hypothetical protein	NA	NA	NA	NA
WP_155079977.1\|709469_710462_+	hypothetical protein	NA	NA	NA	NA
WP_155079978.1\|711523_712345_-	amidohydrolase family protein	NA	NA	NA	NA
WP_017377842.1\|712491_712746_-	DUF2282 domain-containing protein	NA	NA	NA	NA
WP_155068763.1\|712846_714631_-	SLC13 family permease	NA	NA	NA	NA
WP_155068124.1\|714719_715439_-\|tRNA	tRNA (guanosine(46)-N7)-methyltransferase TrmB	NA	NA	NA	NA
WP_155068123.1\|715597_715804_-	hypothetical protein	NA	NA	NA	NA
WP_155079979.1\|715803_716040_-	hypothetical protein	NA	NA	NA	NA
WP_155079980.1\|716052_716430_-	sel1 repeat family protein	NA	NA	NA	NA
WP_155079981.1\|716926_717778_+	hypothetical protein	NA	NA	NA	NA
WP_155068119.1\|717870_718068_-	hypothetical protein	NA	NA	NA	NA
WP_155079982.1\|718161_719547_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_155068117.1\|719673_720264_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_155081491.1\|720705_721158_-\|transposase	transposase	NA	NA	NA	NA
WP_155068097.1\|721189_721540_-\|transposase	transposase	NA	NA	NA	NA
WP_155079983.1\|722505_723294_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155079906.1\|723297_723570_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|723656_724007_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|724038_724491_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|724840_725227_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|725210_725768_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079984.1\|726054_727536_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	1.4e-69	32.9
WP_155079959.1\|727578_727929_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155079958.1\|727925_728234_-	hypothetical protein	NA	NA	NA	NA
WP_155079986.1\|728282_728948_-	hypothetical protein	NA	NA	NA	NA
WP_155079987.1\|729275_730250_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079988.1\|730496_731447_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|731469_731856_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|731839_732397_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079989.1\|732399_733389_+	DUF1561 family protein	NA	NA	NA	NA
WP_155079990.1\|734259_735024_+	DUF1561 family protein	NA	NA	NA	NA
WP_155079478.1\|735004_735562_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079897.1\|735545_735932_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079991.1\|736000_736606_+	hypothetical protein	NA	NA	NA	NA
WP_155066404.1\|736819_737706_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155068114.1\|738028_738694_-	fumarylacetoacetate hydrolase family protein	NA	NA	NA	NA
WP_155079992.1\|738753_739710_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	1.8e-33	31.9
WP_155067468.1\|740051_740198_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|740294_740852_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|740835_741222_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079993.1\|741240_742191_-\|transposase	transposase	NA	NA	NA	NA
WP_155068112.1\|742293_742911_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155079994.1\|742950_744087_-	hypothetical protein	NA	NA	NA	NA
WP_155079995.1\|744563_745412_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079741.1\|745435_746410_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3

DBSCAN-SWA_9

766584 : 802259

unidentified_phage(33.33%)

tRNA,integrase,transposase

attL 771835:771894|attR 802612:802750

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080005.1\|766584_767470_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080006.1\|767434_767707_-	hypothetical protein	NA	NA	NA	NA
WP_155081491.1\|768939_769392_-\|transposase	transposase	NA	NA	NA	NA
WP_155068097.1\|769423_769774_-\|transposase	transposase	NA	NA	NA	NA
WP_155080007.1\|769967_770942_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	5.8e-27	31.3
WP_155080008.1\|771080_771545_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080009.1\|771574_772258_-	hypothetical protein	NA	NA	NA	NA
771835:771894	attL	NA	NA	NA	NA
WP_155079478.1\|772283_772841_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|772824_773211_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080010.1\|773207_773714_-	hypothetical protein	NA	NA	NA	NA
WP_155080011.1\|773839_774007_-	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|774652_775105_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|775136_775487_-\|transposase	transposase	NA	NA	NA	NA
WP_155080012.1\|775686_777123_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB	NA	NA	NA	NA
WP_155068095.1\|777199_778660_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA	NA	NA	NA	NA
WP_155068094.1\|778780_779068_-\|tRNA	Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC	NA	NA	NA	NA
WP_016210526.1\|779257_780301_+	rod shape-determining protein	NA	NA	NA	NA
WP_155068093.1\|780316_781216_+	rod shape-determining protein MreC	NA	NA	NA	NA
WP_155068092.1\|781212_781731_+	rod shape-determining protein MreD	NA	NA	NA	NA
WP_155080013.1\|781800_782418_+	septum formation inhibitor Maf	NA	NA	NA	NA
WP_155080014.1\|782427_783915_+	ribonuclease G	NA	NA	NA	NA
WP_155080015.1\|783924_787605_+	hypothetical protein	NA	NA	NA	NA
WP_155080016.1\|787678_788491_+	3-deoxy-manno-octulosonate cytidylyltransferase	NA	NA	NA	NA
WP_155068087.1\|788487_789168_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_155080017.1\|790081_791311_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080018.1\|792047_792503_-	hypothetical protein	NA	NA	NA	NA
WP_155080019.1\|792728_792914_-	hypothetical protein	NA	NA	NA	NA
WP_155081492.1\|792840_793230_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|793261_793612_-\|transposase	transposase	NA	NA	NA	NA
WP_155080020.1\|793677_794604_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|795554_795941_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|795924_796482_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|796578_796965_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|796948_797506_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080021.1\|797591_797858_-	hypothetical protein	NA	NA	NA	NA
WP_155081493.1\|799510_799687_-\|transposase	transposase	NA	NA	NA	NA
WP_155066936.1\|799720_800071_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|800102_800555_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080022.1\|800549_800795_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	S5WIU1	Leptospira_phage	5.3e-14	47.9
WP_155079868.1\|800861_802017_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080023.1\|801974_802259_-\|transposase	transposase	NA	NA	NA	NA
802612:802750	attR	NA	NA	NA	NA

DBSCAN-SWA_10

875485 : 912265

unidentified_phage(28.57%)

integrase,transposase

attL 878038:878097|attR 899492:900451

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155068622.1\|875485_875938_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|875969_876320_-\|transposase	transposase	NA	NA	NA	NA
WP_155589554.1\|877471_878068_+\|transposase	IS30 family transposase	NA	NA	NA	NA
878038:878097	attL	NA	NA	NA	NA
WP_155079476.1\|878064_878451_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|878434_878992_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080055.1\|879674_881141_+	protein kinase	NA	NA	NA	NA
WP_155080056.1\|882623_883127_+	hypothetical protein	NA	NA	NA	NA
WP_155079487.1\|883245_884295_+\|transposase	transposase	NA	NA	NA	NA
WP_155079487.1\|884565_885615_-\|transposase	transposase	NA	NA	NA	NA
WP_155080057.1\|885629_886451_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155085254.1\|886595_887069_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|887175_888150_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080058.1\|888887_889163_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|890472_890823_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|890854_891307_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080059.1\|891471_891864_+	hypothetical protein	NA	NA	NA	NA
WP_155080060.1\|891967_893002_-	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	1.3e-32	34.2
WP_155068017.1\|892998_893709_-	response regulator	W8CYM9	Bacillus_phage	1.3e-31	34.8
WP_155080061.1\|893917_894385_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q6H9S3	Enterobacteria_phage	7.3e-12	30.9
WP_155080062.1\|894351_894519_-	hypothetical protein	NA	NA	NA	NA
WP_155080063.1\|894575_894749_-	hypothetical protein	NA	NA	NA	NA
WP_155080064.1\|894890_895094_-	phosphatase	NA	NA	NA	NA
WP_155079612.1\|895234_896464_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080065.1\|896563_896758_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080066.1\|896989_897574_+	hypothetical protein	NA	NA	NA	NA
WP_155080067.1\|897539_897686_+	hypothetical protein	NA	NA	NA	NA
WP_155080068.1\|897844_898327_+	hypothetical protein	NA	NA	NA	NA
WP_155080069.1\|898330_898807_-	hypothetical protein	NA	NA	NA	NA
WP_155080070.1\|899028_899559_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|899518_899905_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|899888_900446_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|900527_900914_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
899492:900451	attR	NA	NA	NA	NA
WP_155080071.1\|901081_902235_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.6e-58	44.2
WP_155079612.1\|903121_904351_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155589555.1\|904425_904653_-	hypothetical protein	NA	NA	NA	NA
WP_155068012.1\|904771_905104_-	GIY-YIG nuclease family protein	D7F5V9	Apocheima_cinerarium_nucleopolyhedrovirus	2.8e-05	35.4
WP_155080073.1\|905139_908091_-	FAD-binding protein	NA	NA	NA	NA
WP_155080074.1\|908137_908644_-	chagasin	NA	NA	NA	NA
WP_155079461.1\|909190_910165_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.5e-27	31.3
WP_155066936.1\|910361_910712_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|910743_911196_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080075.1\|911200_912265_-\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_11

932206 : 975528

Staphylococcus_phage(14.29%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155066936.1\|932206_932557_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|932588_933041_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080087.1\|933321_934171_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066440.1\|934247_935222_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.2e-29	32.6
WP_155080088.1\|935432_935822_+	hypothetical protein	NA	NA	NA	NA
WP_155080089.1\|936483_937533_-\|transposase	transposase	NA	NA	NA	NA
WP_155080090.1\|938190_938601_-	hypothetical protein	NA	NA	NA	NA
WP_155080091.1\|938687_939338_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.5e-47	50.3
WP_155080092.1\|939334_940045_-	hypothetical protein	NA	NA	NA	NA
WP_155080093.1\|941482_941698_-	hypothetical protein	NA	NA	NA	NA
WP_155081498.1\|942076_942865_+	hypothetical protein	NA	NA	NA	NA
WP_155079887.1\|943607_944150_+	hypothetical protein	NA	NA	NA	NA
WP_155080094.1\|944124_944403_-	hypothetical protein	NA	NA	NA	NA
WP_155080243.1\|944378_944921_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|945234_945585_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|945616_946069_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080096.1\|946341_947055_-	5'-methylthioadenosine/adenosylhomocysteine nucleosidase	NA	NA	NA	NA
WP_155080097.1\|947144_948236_-	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_155080098.1\|948307_948889_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_155080099.1\|948894_949521_-	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_155067986.1\|949618_950566_-	ribose-phosphate diphosphokinase	A0A1V0SHF7	Hokovirus	2.6e-40	34.3
WP_155068753.1\|950912_951575_-	outer membrane lipoprotein LolB	NA	NA	NA	NA
WP_017377908.1\|951748_952408_-	hypothetical protein	NA	NA	NA	NA
WP_155080100.1\|952576_953836_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_017377906.1\|953832_954918_+	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	4.3e-07	41.2
WP_155589556.1\|954910_955792_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_155068752.1\|955780_957037_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_155079887.1\|957240_957783_+	hypothetical protein	NA	NA	NA	NA
WP_155080102.1\|957821_958274_+\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_155080103.1\|958330_958846_+	hypothetical protein	NA	NA	NA	NA
WP_155080104.1\|959566_960616_-\|transposase	transposase	NA	NA	NA	NA
WP_155080105.1\|961031_961601_+	hypothetical protein	NA	NA	NA	NA
WP_155068903.1\|961736_961934_-	hypothetical protein	NA	NA	NA	NA
WP_155080106.1\|963108_964080_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080107.1\|963947_964343_-	hypothetical protein	NA	NA	NA	NA
WP_155067975.1\|965209_967663_+	kinase	NA	NA	NA	NA
WP_155080108.1\|967750_968800_+\|transposase	transposase	NA	NA	NA	NA
WP_155067973.1\|968913_969273_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
WP_155067972.1\|969269_969587_+	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
WP_155080109.1\|969651_970761_-	AI-2E family transporter	NA	NA	NA	NA
WP_155080110.1\|970787_971873_-	DUF2066 domain-containing protein	NA	NA	NA	NA
WP_155067968.1\|971995_973036_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A1D7SR00	Cyanophage	7.7e-70	45.3
WP_155067967.1\|973050_973701_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	1.1e-21	35.7
WP_155080111.1\|973818_974361_+	hypothetical protein	NA	NA	NA	NA
WP_155080112.1\|974335_974509_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|974553_975528_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3

DBSCAN-SWA_12

989625 : 1228049

236

unidentified_phage(20.0%)

tRNA,integrase,transposase

attL 1056724:1056783|attR 1094804:1095430

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079445.1\|989625_990600_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080120.1\|990585_991017_-	hypothetical protein	NA	NA	NA	NA
WP_155080121.1\|991371_992517_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.9e-61	41.7
WP_016211408.1\|992725_994072_+\|tRNA	tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB	NA	NA	NA	NA
WP_155066807.1\|994186_995179_+	AAA family ATPase	A0A0S0MVD6	Pseudomonas_phage	9.3e-49	45.1
WP_155066808.1\|995181_995679_+	rRNA maturation RNase YbeY	NA	NA	NA	NA
WP_155066809.1\|995675_996515_+	CBS domain-containing protein	NA	NA	NA	NA
WP_155080122.1\|996547_998080_+	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_155079413.1\|998588_999758_-\|transposase	transposase	NA	NA	NA	NA
WP_155080131.1\|1000030_1000417_+\|transposase	transposase	NA	NA	NA	NA
WP_155080132.1\|1000710_1001334_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.2e-23	37.3
WP_155080133.1\|1001513_1002398_-	DUF2608 domain-containing protein	NA	NA	NA	NA
WP_155080134.1\|1002527_1003349_-	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase	NA	NA	NA	NA
WP_155080135.1\|1003350_1004388_-	asparaginase	NA	NA	NA	NA
WP_155080136.1\|1004388_1007046_-	[protein-PII] uridylyltransferase	NA	NA	NA	NA
WP_155080137.1\|1007123_1007933_-	type I methionyl aminopeptidase	NA	NA	NA	NA
WP_017376219.1\|1008342_1009110_+	30S ribosomal protein S2	NA	NA	NA	NA
WP_155066817.1\|1009289_1010168_+	elongation factor Ts	NA	NA	NA	NA
WP_064004235.1\|1010171_1010909_+	UMP kinase	NA	NA	NA	NA
WP_017376216.1\|1010912_1011470_+	ribosome recycling factor	NA	NA	NA	NA
WP_155080138.1\|1011477_1012224_+	isoprenyl transferase	R9W0U9	Flavobacterium_phage	3.3e-22	43.3
WP_155066819.1\|1012231_1013038_+	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_155080139.1\|1013129_1014005_+	lipid A biosynthesis acyltransferase	NA	NA	NA	NA
WP_155080140.1\|1014706_1015924_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080141.1\|1015988_1017248_-	hypothetical protein	NA	NA	NA	NA
WP_155080142.1\|1017724_1019677_-	hypothetical protein	NA	NA	NA	NA
WP_155066825.1\|1020218_1020758_-	isopentenyl-diphosphate Delta-isomerase	NA	NA	NA	NA
WP_155080143.1\|1020754_1021783_-	diphosphomevalonate decarboxylase	NA	NA	NA	NA
WP_155080144.1\|1021772_1022837_-	GHMP kinase	NA	NA	NA	NA
WP_155080145.1\|1022824_1025053_-	hydroxymethylglutaryl-CoA synthase	NA	NA	NA	NA
WP_155080146.1\|1025039_1026107_-	hydroxymethylglutaryl-CoA reductase	NA	NA	NA	NA
WP_155080147.1\|1026394_1028794_+	outer membrane protein assembly factor BamA	NA	NA	NA	NA
WP_155066831.1\|1028880_1029417_+	OmpH family outer membrane protein	NA	NA	NA	NA
WP_155066832.1\|1029465_1030515_+	UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase	NA	NA	NA	NA
WP_075275393.1\|1030532_1030979_+	3-hydroxyacyl-ACP dehydratase FabZ	NA	NA	NA	NA
WP_016209377.1\|1030978_1031752_+	acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase	NA	NA	NA	NA
WP_155080148.1\|1031770_1032925_+	lipid-A-disaccharide synthase	NA	NA	NA	NA
WP_155080149.1\|1033139_1033709_+	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	3.4e-27	42.9
WP_155080150.1\|1033732_1037239_+	DNA polymerase III subunit alpha	A0A291AVA6	Streptomyces_phage	1.4e-192	38.5
WP_155080151.1\|1037316_1038276_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_155080152.1\|1038250_1039696_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_155080153.1\|1040019_1041549_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	1.5e-85	42.6
WP_155080154.1\|1042125_1043823_+	hypothetical protein	NA	NA	NA	NA
WP_155080155.1\|1044365_1045334_+	hypothetical protein	NA	NA	NA	NA
WP_155080156.1\|1045689_1046538_+	hypothetical protein	NA	NA	NA	NA
WP_155080157.1\|1046829_1049520_+	DUF4135 domain-containing protein	NA	NA	NA	NA
WP_155080158.1\|1049766_1050930_+	MFS transporter	NA	NA	NA	NA
WP_155079724.1\|1051660_1052842_-\|transposase	transposase	NA	NA	NA	NA
WP_155080159.1\|1052991_1054632_-	hypothetical protein	NA	NA	NA	NA
WP_155080160.1\|1055220_1056447_+	MFS transporter	NA	NA	NA	NA
WP_155079445.1\|1056644_1057619_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
1056724:1056783	attL	NA	NA	NA	NA
WP_155079974.1\|1057831_1058197_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080161.1\|1058253_1058469_+	hypothetical protein	NA	NA	NA	NA
WP_155066848.1\|1058821_1059361_-	superoxide dismutase	Q9MC02	Salmonella_phage	2.4e-35	53.8
WP_155080162.1\|1059525_1060863_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1061327_1061714_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155589557.1\|1061697_1062216_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080163.1\|1063007_1063517_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|1064193_1065168_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155066852.1\|1066432_1066846_+	hypothetical protein	NA	NA	NA	NA
WP_155589558.1\|1067463_1068438_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.8e-28	32.3
WP_155080165.1\|1068624_1069092_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|1069153_1070039_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080166.1\|1070036_1071347_+	hypothetical protein	NA	NA	NA	NA
WP_155080167.1\|1071349_1072078_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.5e-43	42.2
WP_155068622.1\|1072269_1072722_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1072753_1073104_-\|transposase	transposase	NA	NA	NA	NA
WP_155067991.1\|1073187_1073604_-\|transposase	transposase	NA	NA	NA	NA
WP_155080168.1\|1074675_1075404_+	hypothetical protein	NA	NA	NA	NA
WP_155080169.1\|1076143_1076326_-	hypothetical protein	NA	NA	NA	NA
WP_155079487.1\|1076432_1077482_+\|transposase	transposase	NA	NA	NA	NA
WP_155080170.1\|1077625_1078285_+	hypothetical protein	NA	NA	NA	NA
WP_155079741.1\|1078790_1079765_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155067098.1\|1079898_1080219_+	hypothetical protein	NA	NA	NA	NA
WP_155080171.1\|1080164_1080740_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155068846.1\|1080803_1080965_+	hypothetical protein	NA	NA	NA	NA
WP_155068847.1\|1080974_1082429_+	hypothetical protein	NA	NA	NA	NA
WP_155080172.1\|1082529_1083504_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-28	31.0
WP_155080173.1\|1083703_1084288_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155066936.1\|1084362_1084713_+\|transposase	transposase	NA	NA	NA	NA
WP_155079958.1\|1084973_1085282_+	hypothetical protein	NA	NA	NA	NA
WP_155079959.1\|1085278_1085629_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155080463.1\|1085671_1087153_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	8.4e-70	32.7
WP_155079487.1\|1087523_1088573_+\|transposase	transposase	NA	NA	NA	NA
WP_155080174.1\|1088746_1089289_+	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|1089303_1090353_+\|transposase	transposase	NA	NA	NA	NA
WP_155080175.1\|1090394_1090772_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155080176.1\|1090937_1092425_+	sodium/solute symporter	NA	NA	NA	NA
WP_155079478.1\|1093334_1093892_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1093875_1094262_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079836.1\|1094627_1094834_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1095455_1095842_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
1094804:1095430	attR	NA	NA	NA	NA
WP_155079478.1\|1095825_1096383_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080177.1\|1096619_1097153_-	hypothetical protein	NA	NA	NA	NA
WP_155080178.1\|1097010_1097862_-	hypothetical protein	NA	NA	NA	NA
WP_155080179.1\|1098306_1099359_+	hypothetical protein	NA	NA	NA	NA
WP_155080180.1\|1101082_1101472_+	hypothetical protein	NA	NA	NA	NA
WP_155080181.1\|1101668_1102061_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_032126790.1\|1102065_1102971_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_155080161.1\|1103093_1103309_+	hypothetical protein	NA	NA	NA	NA
WP_155081500.1\|1103465_1103690_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1104212_1105442_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080182.1\|1105541_1105937_-\|transposase	transposase	NA	NA	NA	NA
WP_155080183.1\|1106056_1106200_+	hypothetical protein	NA	NA	NA	NA
WP_144420711.1\|1106283_1106709_+	hypothetical protein	NA	NA	NA	NA
WP_155080184.1\|1106865_1107795_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	4.8e-31	30.6
WP_155067789.1\|1108026_1108557_+	hypothetical protein	NA	NA	NA	NA
WP_155080185.1\|1109514_1109916_-	hypothetical protein	NA	NA	NA	NA
WP_155080186.1\|1111844_1112765_-	hypothetical protein	NA	NA	NA	NA
WP_155067783.1\|1112765_1113617_-	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	2.1e-12	28.4
WP_155080187.1\|1114038_1115085_+	glutathione synthase	NA	NA	NA	NA
WP_155080188.1\|1115068_1117066_+	flavohemoglobin expression-modulating QEGLA motif protein	NA	NA	NA	NA
WP_155067781.1\|1117244_1117550_+	DUF4325 domain-containing protein	NA	NA	NA	NA
WP_155080189.1\|1117779_1117986_+	hypothetical protein	NA	NA	NA	NA
WP_155080190.1\|1118247_1118949_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080191.1\|1118949_1119417_-	hypothetical protein	NA	NA	NA	NA
WP_155080192.1\|1119746_1120532_+\|transposase	IS3 family transposase	A0A0N7C035	Escherichia_phage	1.2e-14	34.2
WP_155067557.1\|1121747_1121981_+\|transposase	transposase	NA	NA	NA	NA
WP_155080193.1\|1122053_1122281_+\|transposase	IS3 family transposase	A4JX31	Burkholderia_virus	3.1e-08	45.5
WP_155080194.1\|1122498_1125252_+	hypothetical protein	NA	NA	NA	NA
WP_155080195.1\|1125487_1126780_+	hypothetical protein	NA	NA	NA	NA
WP_155066370.1\|1128496_1128778_-	hypothetical protein	NA	NA	NA	NA
WP_155067770.1\|1128998_1129271_-	metal-sensing transcriptional repressor	NA	NA	NA	NA
WP_155080196.1\|1131828_1132266_-	hypothetical protein	NA	NA	NA	NA
WP_155080197.1\|1132690_1133758_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080198.1\|1134242_1134395_-	hypothetical protein	NA	NA	NA	NA
WP_155080019.1\|1135142_1135328_-	hypothetical protein	NA	NA	NA	NA
WP_155081492.1\|1135254_1135644_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1135675_1136026_-\|transposase	transposase	NA	NA	NA	NA
WP_155085237.1\|1136483_1137767_-	hypothetical protein	NA	NA	NA	NA
WP_155080200.1\|1137776_1139315_-	VWA domain-containing protein	NA	NA	NA	NA
WP_155080201.1\|1139327_1140371_-	VWA domain-containing protein	NA	NA	NA	NA
WP_155080202.1\|1140866_1141034_-	phosphatase	NA	NA	NA	NA
WP_155080203.1\|1140994_1141880_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1142078_1142465_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1142448_1143006_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079887.1\|1143085_1143628_+	hypothetical protein	NA	NA	NA	NA
WP_155080204.1\|1143767_1144151_+	hypothetical protein	NA	NA	NA	NA
WP_155080205.1\|1144424_1144571_+	hypothetical protein	NA	NA	NA	NA
WP_155080206.1\|1145736_1146732_-	AAA domain-containing protein	NA	NA	NA	NA
WP_155067762.1\|1146901_1147864_-	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_155080207.1\|1148042_1148522_-	hypothetical protein	NA	NA	NA	NA
WP_155079883.1\|1148518_1149094_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080208.1\|1149039_1149405_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080209.1\|1149732_1149924_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|1149920_1150478_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1150461_1150848_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080210.1\|1150912_1151233_+	hypothetical protein	NA	NA	NA	NA
WP_155080211.1\|1151207_1151396_-	hypothetical protein	NA	NA	NA	NA
WP_155079868.1\|1151392_1152549_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080212.1\|1152599_1152899_-	hypothetical protein	NA	NA	NA	NA
WP_155080213.1\|1152986_1154468_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_155081502.1\|1154472_1154925_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067136.1\|1154956_1155307_-\|transposase	transposase	NA	NA	NA	NA
WP_155079974.1\|1155424_1155790_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080161.1\|1155846_1156062_+	hypothetical protein	NA	NA	NA	NA
WP_155080214.1\|1156158_1156419_+	hypothetical protein	NA	NA	NA	NA
WP_155080215.1\|1156478_1157453_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.3e-26	31.1
WP_155080216.1\|1157942_1159025_-\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.8e-144	72.7
WP_155080217.1\|1159106_1160212_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.9e-50	40.4
WP_155080218.1\|1160324_1160858_-\|transposase	transposase	NA	NA	NA	NA
WP_155066278.1\|1160874_1161924_-\|transposase	transposase	NA	NA	NA	NA
WP_155080220.1\|1161966_1162521_-	hypothetical protein	NA	NA	NA	NA
WP_155080221.1\|1162563_1163646_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|1163735_1164293_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079868.1\|1164454_1165611_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155589559.1\|1165576_1165897_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080222.1\|1166369_1167947_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-15	25.3
WP_155067751.1\|1168082_1168472_-	hypothetical protein	NA	NA	NA	NA
WP_155067750.1\|1168657_1169473_-	GTP cyclohydrolase I FolE2	NA	NA	NA	NA
WP_155080219.1\|1169792_1170842_+\|transposase	transposase	NA	NA	NA	NA
WP_155080223.1\|1170908_1171739_+\|transposase	transposase	NA	NA	NA	NA
WP_155079487.1\|1171753_1172803_+\|transposase	transposase	NA	NA	NA	NA
WP_155080224.1\|1172901_1173780_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	1.5e-26	35.8
WP_155079478.1\|1173787_1174345_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1174328_1174715_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080225.1\|1174711_1175341_-\|transposase	transposase	S5VLC8	Leptospira_phage	5.9e-33	41.1
WP_155080226.1\|1175383_1175542_-	hypothetical protein	NA	NA	NA	NA
WP_155080227.1\|1175558_1176170_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|1176211_1176664_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1176695_1177046_-\|transposase	transposase	NA	NA	NA	NA
WP_155080228.1\|1177107_1177341_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|1177348_1177906_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1177889_1178276_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155085229.1\|1178272_1178614_-	hypothetical protein	NA	NA	NA	NA
WP_155080230.1\|1178656_1178887_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.5e-07	44.4
WP_155079958.1\|1178883_1179192_-	hypothetical protein	NA	NA	NA	NA
WP_155080231.1\|1179247_1179496_+	hypothetical protein	NA	NA	NA	NA
WP_155080232.1\|1179528_1180434_-	polyprenyl synthetase	NA	NA	NA	NA
WP_016211119.1\|1180587_1181349_+	flagellar motor protein PomA	NA	NA	NA	NA
WP_155080233.1\|1181352_1182219_+	OmpA family protein	NA	NA	NA	NA
WP_155067747.1\|1182301_1182913_+	PilZ domain-containing protein	NA	NA	NA	NA
WP_155067746.1\|1183293_1184541_+	NADP-dependent isocitrate dehydrogenase	Q77Z09	Phage_21	2.5e-14	70.4
WP_155080234.1\|1184677_1185394_+	hypothetical protein	NA	NA	NA	NA
WP_155080235.1\|1185527_1186181_-	hypothetical protein	R4ZFK6	Choristoneura_rosaceana_entomopoxvirus	1.5e-07	27.2
WP_155080236.1\|1186728_1187823_+\|tRNA	tRNA 2-thiouridine(34) synthase MnmA	NA	NA	NA	NA
WP_027242998.1\|1187904_1188426_+	peptidylprolyl isomerase	A0A1V0SCU1	Indivirus	3.8e-25	53.4
WP_155080237.1\|1188477_1188954_-	hypothetical protein	NA	NA	NA	NA
WP_155067739.1\|1189009_1189312_-	hypothetical protein	NA	NA	NA	NA
WP_155080238.1\|1189376_1190084_-	flagellar basal body P-ring formation protein FlgA	NA	NA	NA	NA
WP_155067737.1\|1190449_1190848_+	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_027242993.1\|1190893_1191325_+	flagellar basal body rod protein FlgC	NA	NA	NA	NA
WP_027242992.1\|1191335_1192019_+	flagellar hook assembly protein FlgD	NA	NA	NA	NA
WP_016210285.1\|1192094_1194290_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_155080239.1\|1194393_1195131_+	flagellar hook-basal body complex protein	NA	NA	NA	NA
WP_064005418.1\|1195158_1195944_+	flagellar basal-body rod protein FlgG	NA	NA	NA	NA
WP_155068730.1\|1196012_1196717_+	flagellar basal body L-ring protein FlgH	NA	NA	NA	NA
WP_155080240.1\|1196704_1197874_+	flagellar basal body P-ring protein FlgI	NA	NA	NA	NA
WP_155067733.1\|1197928_1198756_+	hypothetical protein	NA	NA	NA	NA
WP_155080241.1\|1198825_1201813_+	flagellar hook-associated protein FlgK	NA	NA	NA	NA
WP_155080242.1\|1201854_1203246_+	flagellar hook-associated protein 3	NA	NA	NA	NA
WP_155067730.1\|1203259_1203976_-	hypothetical protein	NA	NA	NA	NA
WP_155080243.1\|1204668_1205211_-	hypothetical protein	NA	NA	NA	NA
WP_155079888.1\|1205186_1205333_+	hypothetical protein	NA	NA	NA	NA
WP_155079887.1\|1205307_1205850_-	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|1206404_1207454_+\|transposase	transposase	NA	NA	NA	NA
WP_155080244.1\|1207496_1208456_+	TAXI family TRAP transporter solute-binding subunit	NA	NA	NA	NA
WP_155067727.1\|1208510_1210523_+	TRAP transporter fused permease subunit	NA	NA	NA	NA
WP_155067726.1\|1210575_1210869_-	hypothetical protein	NA	NA	NA	NA
WP_155080245.1\|1211122_1212322_+	enoyl-[acyl-carrier-protein] reductase FabV	NA	NA	NA	NA
WP_155080246.1\|1212397_1213981_-	amino acid permease	NA	NA	NA	NA
WP_155079445.1\|1214081_1215056_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080247.1\|1215539_1215887_+	hypothetical protein	NA	NA	NA	NA
WP_155079487.1\|1215929_1216979_+\|transposase	transposase	NA	NA	NA	NA
WP_155080248.1\|1216995_1218078_+	hypothetical protein	NA	NA	NA	NA
WP_155080249.1\|1218720_1218885_-	hypothetical protein	NA	NA	NA	NA
WP_155080250.1\|1218969_1219389_+\|transposase	transposase	NA	NA	NA	NA
WP_155080251.1\|1219571_1219718_-	hypothetical protein	NA	NA	NA	NA
WP_155080208.1\|1219850_1220216_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066610.1\|1220161_1220737_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080252.1\|1220740_1221892_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080253.1\|1222045_1223827_+	hypothetical protein	NA	NA	NA	NA
WP_155080254.1\|1223939_1225178_-	phosphoglycerate dehydrogenase	A0A1V0SBV6	Catovirus	1.2e-93	47.3
WP_155067720.1\|1225167_1225830_-	HAD-IB family phosphatase	NA	NA	NA	NA
WP_155080255.1\|1226104_1227361_-	YihY family inner membrane protein	NA	NA	NA	NA
WP_155080256.1\|1227491_1228049_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_13

1234003 : 1357566

115

Leptospira_phage(21.74%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080262.1\|1234003_1234888_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	4.0e-27	37.0
WP_155080263.1\|1235032_1235773_-\|transposase	transposase	S5VLC8	Leptospira_phage	4.0e-36	42.2
WP_155079476.1\|1235939_1236326_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1236309_1236867_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080264.1\|1236863_1237124_-	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	3.8e-10	44.0
WP_155068622.1\|1237196_1237649_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1237680_1238031_-\|transposase	transposase	NA	NA	NA	NA
WP_155080265.1\|1238096_1238252_-	hypothetical protein	NA	NA	NA	NA
WP_155080266.1\|1238392_1239622_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080267.1\|1239721_1239877_-	hypothetical protein	NA	NA	NA	NA
WP_155080268.1\|1239932_1240745_+\|transposase	transposase	NA	NA	NA	NA
WP_155080269.1\|1240741_1241224_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_155080270.1\|1242280_1243528_-\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_155080271.1\|1244314_1245277_-	hypothetical protein	A0A160DHD3	Gordonia_phage	8.0e-13	26.5
WP_155079445.1\|1245300_1246275_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080272.1\|1246334_1247309_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.3e-26	31.1
WP_155080273.1\|1248196_1248409_+	hypothetical protein	NA	NA	NA	NA
WP_155081503.1\|1248647_1249175_+	shikimate kinase AroK	NA	NA	NA	NA
WP_155080274.1\|1249347_1249632_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1250724_1251111_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1251094_1251652_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067718.1\|1251667_1252327_+	NADPH-dependent oxidoreductase	NA	NA	NA	NA
WP_155067717.1\|1252401_1253103_+	cyclase family protein	NA	NA	NA	NA
WP_155067716.1\|1253126_1253933_-	SDR family NAD(P)-dependent oxidoreductase	W8CYX9	Bacillus_phage	7.7e-09	42.9
WP_155080276.1\|1254193_1254676_-	hypothetical protein	NA	NA	NA	NA
WP_155080277.1\|1254820_1255597_-	hypothetical protein	NA	NA	NA	NA
WP_155080278.1\|1255741_1256083_-	hypothetical protein	NA	NA	NA	NA
WP_155080279.1\|1256390_1256570_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|1256550_1257108_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1257091_1257478_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155068622.1\|1257592_1258045_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589560.1\|1259140_1259482_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|1259536_1259887_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|1259918_1260371_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067714.1\|1260950_1261100_-	hypothetical protein	NA	NA	NA	NA
WP_155067713.1\|1261452_1261821_-	cell division topological specificity factor MinE	NA	NA	NA	NA
WP_017376425.1\|1261817_1262636_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_155080281.1\|1262736_1263552_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_155081504.1\|1263835_1265896_+	hypothetical protein	NA	NA	NA	NA
WP_155067710.1\|1265895_1266318_+	hypothetical protein	NA	NA	NA	NA
WP_155068728.1\|1266503_1267997_-	neurotransmitter symporter family protein	NA	NA	NA	NA
WP_155080282.1\|1268129_1268945_-	exodeoxyribonuclease III	NA	NA	NA	NA
WP_155067708.1\|1269040_1269457_-	hypothetical protein	NA	NA	NA	NA
WP_155080283.1\|1269802_1270342_-	DUF2975 domain-containing protein	NA	NA	NA	NA
WP_155068727.1\|1271108_1272371_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.2e-25	29.3
WP_155080284.1\|1272846_1274670_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	1.3e-43	40.5
WP_016209821.1\|1274759_1275092_+	YbaB/EbfC family nucleoid-associated protein	NA	NA	NA	NA
WP_155067705.1\|1275122_1275719_+	recombination protein RecR	NA	NA	NA	NA
WP_155067704.1\|1275715_1276840_+	hydroxyacid dehydrogenase	NA	NA	NA	NA
WP_155067703.1\|1276975_1277623_+	methyltransferase	W8CYT3	Bacillus_phage	3.6e-09	31.5
WP_155080285.1\|1277671_1279585_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	2.6e-116	38.3
WP_155066936.1\|1280886_1281237_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|1281268_1281721_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080286.1\|1281715_1282246_-\|transposase	transposase	S5VTP8	Leptospira_phage	2.7e-23	37.1
WP_155080287.1\|1283210_1283597_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080288.1\|1283580_1283955_+	hypothetical protein	NA	NA	NA	NA
WP_155080289.1\|1283929_1284148_+	hypothetical protein	NA	NA	NA	NA
WP_155080290.1\|1284252_1284642_-\|transposase	transposase	NA	NA	NA	NA
WP_155080291.1\|1284912_1285560_-\|transposase	transposase	S5VLC8	Leptospira_phage	2.7e-33	41.2
WP_155079959.1\|1285602_1285953_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155079958.1\|1285949_1286258_-	hypothetical protein	NA	NA	NA	NA
WP_155080292.1\|1286398_1289701_-	hypothetical protein	NA	NA	NA	NA
WP_155080293.1\|1290401_1291370_-	hypothetical protein	NA	NA	NA	NA
WP_155080294.1\|1291478_1291967_-	hypothetical protein	NA	NA	NA	NA
WP_155080295.1\|1292408_1292825_+	response regulator	NA	NA	NA	NA
WP_155080296.1\|1292881_1293757_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155080297.1\|1294110_1295472_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079741.1\|1295978_1296953_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080298.1\|1296990_1297488_+	TSUP family transporter	NA	NA	NA	NA
WP_155080299.1\|1297517_1298843_-	ribonuclease HI	G3MB70	Bacillus_virus	1.7e-37	36.3
WP_155080300.1\|1298865_1299513_-	TetR family transcriptional regulator	NA	NA	NA	NA
WP_155080301.1\|1299706_1301653_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	4.7e-44	27.8
WP_155080302.1\|1301796_1304727_+	peptidase M16	NA	NA	NA	NA
WP_155080303.1\|1304980_1305556_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080304.1\|1305501_1305669_-	hypothetical protein	NA	NA	NA	NA
WP_155067991.1\|1305713_1306130_-\|transposase	transposase	NA	NA	NA	NA
WP_155080305.1\|1307031_1307187_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|1307113_1307464_-\|transposase	transposase	NA	NA	NA	NA
WP_155080306.1\|1307540_1307945_-	hypothetical protein	NA	NA	NA	NA
WP_155080307.1\|1308204_1309335_+	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|1309339_1309792_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1309823_1310174_-\|transposase	transposase	NA	NA	NA	NA
WP_155080308.1\|1310681_1311701_-	FUSC family protein	NA	NA	NA	NA
WP_155080309.1\|1311693_1312740_-	hypothetical protein	NA	NA	NA	NA
WP_155080310.1\|1313714_1313879_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1314486_1315716_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080311.1\|1316741_1317776_+\|transposase	transposase	NA	NA	NA	NA
WP_155079478.1\|1318180_1318738_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1318721_1319108_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155067684.1\|1319453_1321394_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.1e-73	33.0
WP_155080312.1\|1321531_1322185_+	glutaredoxin 2	NA	NA	NA	NA
WP_155080313.1\|1322353_1323529_+	formate-dependent phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_155067681.1\|1323897_1325223_+	fimbrial protein FimV	NA	NA	NA	NA
WP_155081505.1\|1325313_1326096_+\|tRNA	tRNA pseudouridine(38-40) synthase TruA	NA	NA	NA	NA
WP_155080314.1\|1326197_1327070_+	acetyl-CoA carboxylase carboxyltransferase subunit beta	NA	NA	NA	NA
WP_155080315.1\|1327256_1328519_+	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_155067678.1\|1328592_1329123_+	colicin V production family protein	NA	NA	NA	NA
WP_155080316.1\|1329144_1330650_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	4.5e-87	40.4
WP_155080317.1\|1330662_1331328_+\|tRNA	tRNA-(ms[2]io[6]A)-hydroxylase	NA	NA	NA	NA
WP_155080318.1\|1331421_1333182_+	gamma-glutamyltransferase	NA	NA	NA	NA
WP_155080319.1\|1333540_1333822_+	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|1334433_1335483_-\|transposase	transposase	NA	NA	NA	NA
WP_155080321.1\|1337882_1338932_+\|transposase	transposase	NA	NA	NA	NA
WP_155080322.1\|1338968_1341644_-	hypothetical protein	NA	NA	NA	NA
WP_155080323.1\|1343287_1344187_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.1e-23	31.3
WP_155080266.1\|1344300_1345530_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080324.1\|1346023_1346686_+	carbonic anhydrase	NA	NA	NA	NA
WP_155080325.1\|1346712_1347942_-	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_155080326.1\|1348098_1350870_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.3e-148	39.1
WP_017376400.1\|1350940_1351384_-	DNA polymerase III subunit chi	NA	NA	NA	NA
WP_155080327.1\|1351536_1353009_-	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	1.8e-43	30.4
WP_155067662.1\|1353120_1354182_+	LPS export ABC transporter permease LptF	NA	NA	NA	NA
WP_027242800.1\|1354178_1355213_+	LPS export ABC transporter permease LptG	NA	NA	NA	NA
WP_155080328.1\|1355215_1356256_+\|tRNA	tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA	NA	NA	NA	NA
WP_026063528.1\|1356450_1357566_+\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	2.2e-94	49.2

DBSCAN-SWA_14

1361294 : 1402904

Acinetobacter_phage(37.5%)

tRNA,integrase,transposase

attL 1377912:1377971|attR 1383232:1383329

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079612.1\|1361294_1362524_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_016209938.1\|1362756_1363395_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_155080329.1\|1363369_1364794_-	aminodeoxychorismate synthase component I	A0A0B5J984	Pandoravirus	3.5e-41	33.9
WP_155067657.1\|1364984_1365662_+	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_155067656.1\|1365782_1367057_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	8.8e-92	51.5
WP_155080330.1\|1367124_1367880_+	pilus assembly protein	NA	NA	NA	NA
WP_155080331.1\|1369248_1370139_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155081506.1\|1370278_1371661_-	MFS transporter	Q6JIH2	Burkholderia_virus	1.9e-39	27.4
WP_155080332.1\|1371860_1372049_+	Trm112 family protein	NA	NA	NA	NA
WP_122942662.1\|1372062_1373196_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_155080333.1\|1373394_1377240_+	tandem-95 repeat protein	NA	NA	NA	NA
WP_155080334.1\|1377277_1377937_-	hypothetical protein	NA	NA	NA	NA
1377912:1377971	attL	NA	NA	NA	NA
WP_155080335.1\|1379100_1379322_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|1379442_1379793_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|1379824_1380277_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080336.1\|1380271_1380595_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	Q716C2	Shigella_phage	9.8e-16	45.6
WP_155080337.1\|1380739_1381345_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.2e-26	38.2
WP_155080338.1\|1381404_1381692_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3
WP_155080339.1\|1381745_1382030_+	hypothetical protein	NA	NA	NA	NA
WP_155080340.1\|1382118_1383144_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.6e-25	31.0
WP_155068722.1\|1383370_1383724_-	hypothetical protein	NA	NA	NA	NA
1383232:1383329	attR	NA	NA	NA	NA
WP_107517381.1\|1383937_1384132_+	hypothetical protein	NA	NA	NA	NA
WP_155080341.1\|1384199_1384712_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155080342.1\|1384848_1385598_-	hypothetical protein	NA	NA	NA	NA
WP_155080343.1\|1385652_1386249_-	hypothetical protein	NA	NA	NA	NA
WP_155080344.1\|1386282_1387098_-	hypothetical protein	NA	NA	NA	NA
WP_155067640.1\|1387867_1388215_+	hypothetical protein	NA	NA	NA	NA
WP_155080345.1\|1388330_1389113_-	outer membrane protein assembly factor BamD	NA	NA	NA	NA
WP_155081507.1\|1389195_1390146_+	23S rRNA pseudouridine(1911/1915/1917) synthase RluD	NA	NA	NA	NA
WP_155080346.1\|1390684_1393534_+	hypothetical protein	NA	NA	NA	NA
WP_155080347.1\|1393551_1394133_-	hypothetical protein	NA	NA	NA	NA
WP_155080348.1\|1394252_1394981_+	peptidoglycan editing factor PgeF	NA	NA	NA	NA
WP_155080349.1\|1395345_1396449_-\|transposase	transposase	NA	NA	NA	NA
WP_155080350.1\|1396463_1397240_-	hypothetical protein	NA	NA	NA	NA
WP_155080351.1\|1398318_1399065_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155081508.1\|1399977_1400466_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080352.1\|1400615_1401695_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079864.1\|1401748_1402904_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-50	39.0

DBSCAN-SWA_15

1449157 : 1484679

unidentified_phage(22.22%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155067991.1\|1449157_1449574_-\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|1449743_1450196_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1450227_1450578_-\|transposase	transposase	NA	NA	NA	NA
WP_155080372.1\|1450715_1451945_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080182.1\|1452044_1452440_-\|transposase	transposase	NA	NA	NA	NA
WP_155067584.1\|1453133_1454480_+	DNA recombination protein RmuC	NA	NA	NA	NA
WP_155080373.1\|1454627_1455926_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-14	52.3
WP_155080374.1\|1456103_1456955_+	pyridoxal kinase PdxY	NA	NA	NA	NA
WP_155080375.1\|1456963_1457635_+	pyrimidine 5'-nucleotidase	NA	NA	NA	NA
WP_155081511.1\|1458044_1459319_+	endonuclease/exonuclease/phosphatase	NA	NA	NA	NA
WP_155080376.1\|1459383_1461306_+	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	9.2e-85	34.4
WP_155080377.1\|1461312_1462242_+\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_155589562.1\|1462338_1465071_-	hypothetical protein	NA	NA	NA	NA
WP_155067577.1\|1465605_1466082_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_155080379.1\|1466152_1467016_+	hypothetical protein	NA	NA	NA	NA
WP_155081512.1\|1467143_1467962_-	TSUP family transporter	NA	NA	NA	NA
WP_155067571.1\|1468068_1468530_-	YaiI/YqxD family protein	NA	NA	NA	NA
WP_155080380.1\|1468546_1469470_-	phosphatidylserine decarboxylase	NA	NA	NA	NA
WP_155080381.1\|1469493_1470555_-	small ribosomal subunit biogenesis GTPase RsgA	NA	NA	NA	NA
WP_155068713.1\|1470692_1471286_+	oligoribonuclease	A0A1B3B0T8	Gordonia_phage	8.1e-16	31.4
WP_155067568.1\|1471308_1471779_+\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE	NA	NA	NA	NA
WP_155080382.1\|1471867_1473139_+	AMIN domain-containing protein	A0A067ZJB6	Vibrio_phage	2.5e-14	27.4
WP_155067544.1\|1473255_1474419_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-25	31.0
WP_155080383.1\|1474462_1475437_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	32.7
WP_155080698.1\|1476119_1477073_+\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|1477132_1478107_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080697.1\|1478324_1478636_-	hypothetical protein	NA	NA	NA	NA
WP_155080696.1\|1478780_1479092_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1479153_1479540_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016211840.1\|1479880_1480345_+	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	4.7e-19	32.9
WP_155067563.1\|1480496_1481969_+	catalase	A0A2K9L572	Tupanvirus	3.8e-99	46.6
WP_155080695.1\|1482085_1482538_+	CBS domain-containing protein	NA	NA	NA	NA
WP_155080442.1\|1483551_1484679_-\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_16

1489767 : 1549358

Streptococcus_phage(22.22%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080693.1\|1489767_1490421_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.0e-35	43.9
WP_155080692.1\|1490635_1491184_-	transglycosylase SLT domain-containing protein	NA	NA	NA	NA
WP_155067552.1\|1491311_1492040_-	hypothetical protein	NA	NA	NA	NA
WP_155080691.1\|1492099_1495591_-	transcription-repair coupling factor	NA	NA	NA	NA
WP_155080690.1\|1495648_1496902_-	hypothetical protein	NA	NA	NA	NA
WP_155067549.1\|1497011_1497914_-	acyltransferase	M1HCD5	Acanthocystis_turfacea_Chlorella_virus	7.2e-56	41.0
WP_155080689.1\|1497967_1499005_-	agmatine deiminase	M1H3B1	Paramecium_bursaria_Chlorella_virus	8.3e-40	29.1
WP_155067547.1\|1499142_1500381_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_155067546.1\|1500373_1501099_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	2.9e-31	38.2
WP_155080688.1\|1501202_1502930_+	penicillin-binding protein 2	NA	NA	NA	NA
WP_155589563.1\|1503230_1503584_+	hypothetical protein	NA	NA	NA	NA
WP_016211833.1\|1504166_1504667_+	hypothetical protein	NA	NA	NA	NA
WP_155080687.1\|1504754_1505723_+\|transposase	transposase	NA	NA	NA	NA
WP_155080686.1\|1505686_1506262_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079974.1\|1506207_1506573_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080383.1\|1507047_1508022_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	32.7
WP_155080685.1\|1508045_1508273_+	hypothetical protein	NA	NA	NA	NA
WP_155079974.1\|1508308_1508674_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080684.1\|1508619_1509177_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079445.1\|1509173_1510148_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155589564.1\|1510327_1510927_+\|transposase	IS3 family transposase	A0A0N7C1X7	Escherichia_phage	2.8e-16	34.1
WP_155589565.1\|1511035_1511407_+\|transposase	transposase	NA	NA	NA	NA
WP_155080682.1\|1512184_1514551_+	3-hydroxyacyl-CoA dehydrogenase	NA	NA	NA	NA
WP_155080681.1\|1514598_1515795_+	acetyl-CoA C-acyltransferase	NA	NA	NA	NA
WP_155080680.1\|1515932_1516139_-	hypothetical protein	NA	NA	NA	NA
WP_155080679.1\|1516332_1518762_+	acyl-CoA dehydrogenase	NA	NA	NA	NA
WP_155080678.1\|1518854_1520357_-	hypothetical protein	NA	NA	NA	NA
WP_155080677.1\|1520465_1521038_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1522018_1522405_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1522388_1522946_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080675.1\|1523419_1523608_+	hypothetical protein	NA	NA	NA	NA
WP_155080674.1\|1523529_1524888_+	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_155079476.1\|1524991_1525378_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079881.1\|1525361_1525775_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|1525840_1526191_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|1526222_1526675_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080673.1\|1528031_1528805_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_155067540.1\|1528903_1529854_-	EamA family transporter	NA	NA	NA	NA
WP_155085323.1\|1529990_1531433_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	5.9e-20	24.2
WP_155067539.1\|1531648_1532833_+	aminoacetone oxidase family FAD-binding enzyme	NA	NA	NA	NA
WP_155067538.1\|1532956_1533643_+	7-cyano-7-deazaguanine synthase QueC	A0A2H4J8Q7	uncultured_Caudovirales_phage	1.6e-28	36.5
WP_155067537.1\|1533778_1534363_+	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_155067536.1\|1534452_1534797_-	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_017377969.1\|1535118_1535358_+	membrane protein insertion efficiency factor YidD	NA	NA	NA	NA
WP_155080671.1\|1535389_1535596_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1536833_1537220_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1537203_1537761_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080670.1\|1537741_1538125_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155067532.1\|1538845_1539898_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_155080669.1\|1539915_1543014_+	MMPL family transporter	NA	NA	NA	NA
WP_155080668.1\|1545774_1546743_+	hypothetical protein	NA	NA	NA	NA
WP_155080465.1\|1548272_1548593_-	hypothetical protein	NA	NA	NA	NA
WP_155081533.1\|1548619_1549072_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080581.1\|1549103_1549358_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_17

1553559 : 1666069

113

Acinetobacter_phage(15.38%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080663.1\|1553559_1554675_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155589566.1\|1554838_1555093_+	hypothetical protein	NA	NA	NA	NA
WP_155080660.1\|1555108_1556047_+	hypothetical protein	NA	NA	NA	NA
WP_155080659.1\|1556061_1556862_+\|transposase	transposase	NA	NA	NA	NA
WP_155079868.1\|1556912_1558068_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080658.1\|1558096_1558411_+	hypothetical protein	NA	NA	NA	NA
WP_155080657.1\|1558354_1558570_-	hypothetical protein	NA	NA	NA	NA
WP_155080656.1\|1558615_1558885_+	hypothetical protein	NA	NA	NA	NA
WP_155080655.1\|1558844_1559015_-	hypothetical protein	NA	NA	NA	NA
WP_155081532.1\|1560610_1561351_+	hypothetical protein	NA	NA	NA	NA
WP_155067510.1\|1561331_1561766_+	hypothetical protein	NA	NA	NA	NA
WP_155080654.1\|1561810_1562440_+	hypothetical protein	NA	NA	NA	NA
WP_155080653.1\|1562514_1563429_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_155080652.1\|1563459_1566762_-	hypothetical protein	NA	NA	NA	NA
WP_155080651.1\|1566758_1568582_-	BamA/TamA family outer membrane protein	NA	NA	NA	NA
WP_155067505.1\|1568621_1569020_-	hypothetical protein	NA	NA	NA	NA
WP_155080650.1\|1569142_1570147_-\|tRNA	tRNA dihydrouridine(20/20a) synthase DusA	NA	NA	NA	NA
WP_155080649.1\|1570579_1572028_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_155080648.1\|1572109_1575166_+	MMPL family transporter	NA	NA	NA	NA
WP_155080647.1\|1575162_1575336_-	hypothetical protein	NA	NA	NA	NA
WP_155067468.1\|1575867_1576014_-	hypothetical protein	NA	NA	NA	NA
WP_155080646.1\|1576097_1576391_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.2e-06	37.5
WP_155080645.1\|1576507_1577071_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.9e-35	46.5
WP_155080644.1\|1577095_1577251_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155080643.1\|1577243_1577942_-\|transposase	transposase	NA	NA	NA	NA
WP_155066936.1\|1578011_1578362_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|1578393_1578846_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080642.1\|1578840_1579080_-	hypothetical protein	NA	NA	NA	NA
WP_155080641.1\|1579445_1579859_-	hypothetical protein	NA	NA	NA	NA
WP_155080640.1\|1580135_1580600_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_155080639.1\|1580668_1582189_-	NOL1/NOP2/sun family putative RNA methylase	NA	NA	NA	NA
WP_155067496.1\|1582276_1582879_-	NAD(P)H:quinone oxidoreductase	NA	NA	NA	NA
WP_155067495.1\|1582875_1583223_-	arsenate reductase (glutaredoxin)	NA	NA	NA	NA
WP_155067494.1\|1583358_1584357_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	2.2e-34	32.7
WP_155079487.1\|1584381_1585431_-\|transposase	transposase	NA	NA	NA	NA
WP_155080638.1\|1585871_1586033_+	hypothetical protein	NA	NA	NA	NA
WP_155080637.1\|1586126_1587107_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_155081531.1\|1587380_1587605_-	hypothetical protein	A0A2P0VP61	Tetraselmis_virus	8.3e-06	45.8
WP_155080161.1\|1587761_1587977_-	hypothetical protein	NA	NA	NA	NA
WP_155067835.1\|1588033_1588201_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|1588233_1588686_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1588717_1589068_-\|transposase	transposase	NA	NA	NA	NA
WP_155080636.1\|1589129_1589315_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080635.1\|1589350_1590010_-	hypothetical protein	NA	NA	NA	NA
WP_155080634.1\|1590038_1590782_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.2e-18	32.9
WP_155066404.1\|1590977_1591864_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067487.1\|1592428_1593304_-	AAA family ATPase	NA	NA	NA	NA
WP_155081530.1\|1593469_1597384_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	6.1e-51	26.5
WP_155080630.1\|1599020_1599830_+	hypothetical protein	NA	NA	NA	NA
WP_155067484.1\|1599879_1600701_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_155080629.1\|1600904_1602131_-	response regulator	Q56AR1	Bacillus_thuringiensis_phage	4.4e-32	26.9
WP_155067482.1\|1602340_1603066_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_155080628.1\|1603108_1604647_+\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_155080627.1\|1604653_1606039_+\|tRNA	cysteine--tRNA ligase	A0A2K9L6B7	Tupanvirus	3.4e-49	29.8
WP_155080626.1\|1606458_1607433_+	hypothetical protein	NA	NA	NA	NA
WP_155080625.1\|1607416_1607974_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|1608018_1608993_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080624.1\|1609012_1609573_-	hypothetical protein	NA	NA	NA	NA
WP_155079958.1\|1609953_1610262_+	hypothetical protein	NA	NA	NA	NA
WP_155079959.1\|1610258_1610609_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155081529.1\|1610738_1611125_+	hypothetical protein	S5VLC8	Leptospira_phage	2.1e-09	37.2
WP_155080623.1\|1611269_1612421_+\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	5.2e-27	37.0
WP_155080622.1\|1612507_1612867_+	hypothetical protein	NA	NA	NA	NA
WP_155080621.1\|1613085_1613700_+	hypothetical protein	NA	NA	NA	NA
WP_155079888.1\|1613674_1613821_-	hypothetical protein	NA	NA	NA	NA
WP_155080620.1\|1613796_1614051_+	hypothetical protein	NA	NA	NA	NA
WP_155079906.1\|1614354_1614627_+	hypothetical protein	NA	NA	NA	NA
WP_155080618.1\|1614650_1615217_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1615686_1616073_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1616056_1616614_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081465.1\|1616830_1617283_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080617.1\|1617287_1618289_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080616.1\|1619296_1619560_+	hypothetical protein	NA	NA	NA	NA
WP_155080615.1\|1619674_1620403_-	single-stranded DNA-binding protein	A0A2I7QWB5	Vibrio_phage	6.2e-42	65.6
WP_155081528.1\|1620776_1623596_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	5.2e-312	55.1
WP_155068706.1\|1624145_1625279_+	MFS transporter	S4TR35	Salmonella_phage	1.6e-15	23.0
WP_155080614.1\|1625485_1627258_+\|tRNA	aspartate--tRNA ligase	A0A2K9L0E9	Tupanvirus	6.4e-08	39.5
WP_155080613.1\|1627390_1628434_+	quinolinate synthase NadA	NA	NA	NA	NA
WP_155080612.1\|1628447_1629191_+	YebC/PmpR family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_155080611.1\|1629268_1629625_+	hypothetical protein	NA	NA	NA	NA
WP_146619422.1\|1629686_1629866_+	hypothetical protein	NA	NA	NA	NA
WP_155080610.1\|1629940_1630642_-	hypothetical protein	NA	NA	NA	NA
WP_155080609.1\|1632155_1633544_+	protein kinase	NA	NA	NA	NA
WP_155067466.1\|1633599_1634424_-	DNA/RNA non-specific endonuclease	X2KR27	Campylobacter_phage	8.1e-06	28.3
WP_155079868.1\|1635675_1636831_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080608.1\|1638509_1638647_-	phosphatase	NA	NA	NA	NA
WP_155067541.1\|1638583_1639582_-\|transposase	transposase	NA	NA	NA	NA
WP_155080607.1\|1639706_1640513_-	hypothetical protein	NA	NA	NA	NA
WP_155080606.1\|1640768_1641596_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_155080605.1\|1641625_1642480_-	DUF481 domain-containing protein	NA	NA	NA	NA
WP_155080604.1\|1642993_1644187_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080603.1\|1645791_1646097_+	hypothetical protein	NA	NA	NA	NA
WP_054300641.1\|1646158_1646524_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080161.1\|1646580_1646796_+	hypothetical protein	NA	NA	NA	NA
WP_155080602.1\|1647912_1648746_+	DUF1561 family protein	NA	NA	NA	NA
WP_155068622.1\|1648740_1649193_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1649224_1649575_-\|transposase	transposase	NA	NA	NA	NA
WP_155080601.1\|1649651_1650227_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080600.1\|1650172_1650493_-	hypothetical protein	NA	NA	NA	NA
WP_155079741.1\|1650569_1651544_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080599.1\|1651968_1652265_+	hypothetical protein	NA	NA	NA	NA
WP_155080598.1\|1652547_1653906_-	AAA family ATPase	G3MBE0	Bacillus_virus	1.2e-70	37.1
WP_155067283.1\|1654187_1654547_-	aspartate 1-decarboxylase	NA	NA	NA	NA
WP_016210111.1\|1654948_1656583_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	9.7e-144	49.9
WP_155067284.1\|1656589_1657426_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	7.6e-52	41.3
WP_155080597.1\|1657447_1658725_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	3.3e-139	61.2
WP_155080596.1\|1658811_1659132_+	cell division protein FtsB	NA	NA	NA	NA
WP_155080595.1\|1659155_1660247_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_155080594.1\|1660445_1662035_+	amino acid permease	NA	NA	NA	NA
WP_155067289.1\|1662095_1662869_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-65	52.4
WP_155080593.1\|1663039_1664089_+	RNA polymerase sigma factor RpoS	M4SMP8	Cyanophage	1.0e-29	31.1
WP_155080592.1\|1664539_1664785_+	hypothetical protein	NA	NA	NA	NA
WP_155080591.1\|1664875_1666069_+\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_18

1686574 : 1738408

Adoxophyes_honmai_entomopoxvirus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080584.1\|1686574_1687804_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080583.1\|1687903_1688128_-	hypothetical protein	NA	NA	NA	NA
WP_155080582.1\|1688441_1688648_+	hypothetical protein	NA	NA	NA	NA
WP_155080581.1\|1688669_1688924_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|1688955_1689408_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079731.1\|1690203_1690452_+	hypothetical protein	NA	NA	NA	NA
WP_155080580.1\|1690435_1690993_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081527.1\|1691495_1691876_+	cell envelope biogenesis protein OmpA	NA	NA	NA	NA
WP_155080579.1\|1692021_1692798_-	methyltransferase domain-containing protein	R4ZD91	Adoxophyes_honmai_entomopoxvirus	1.5e-14	25.5
WP_155080578.1\|1693201_1693768_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|1694347_1694800_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1694831_1695182_-\|transposase	transposase	NA	NA	NA	NA
WP_155080577.1\|1695919_1696498_+	nucleoside deaminase	S4VYT2	Pandoravirus	1.5e-14	34.7
WP_155067314.1\|1696525_1696921_-	hypothetical protein	NA	NA	NA	NA
WP_155080576.1\|1697026_1698484_-	hypothetical protein	A0A1C3NFI8	Phage_NCTB	4.3e-10	24.8
WP_155080575.1\|1698545_1700033_-	type VI secretion system-associated FHA domain protein TagH	NA	NA	NA	NA
WP_155079906.1\|1701315_1701588_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|1702071_1702524_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1702555_1702906_-\|transposase	transposase	NA	NA	NA	NA
WP_155080042.1\|1703149_1703500_-\|transposase	transposase	NA	NA	NA	NA
WP_155080574.1\|1703561_1704329_-\|transposase	transposase	NA	NA	NA	NA
WP_017377201.1\|1704872_1705343_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1707570_1708128_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1708111_1708498_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079487.1\|1710665_1711715_-\|transposase	transposase	NA	NA	NA	NA
WP_155067321.1\|1712972_1714778_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.8e-57	34.9
WP_017378301.1\|1715246_1716044_-	hypothetical protein	NA	NA	NA	NA
WP_155067322.1\|1716213_1716675_+	hypothetical protein	NA	NA	NA	NA
WP_155080573.1\|1717033_1718395_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155589568.1\|1718923_1719325_+\|transposase	transposase	NA	NA	NA	NA
WP_155080572.1\|1719284_1719629_-	hypothetical protein	NA	NA	NA	NA
WP_155081526.1\|1719773_1719926_-	phosphatase	NA	NA	NA	NA
WP_054300641.1\|1720093_1720459_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080571.1\|1720704_1721229_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	5.3e-19	33.5
WP_155080570.1\|1721232_1722315_-\|transposase	transposase	NA	NA	NA	NA
WP_155079826.1\|1722311_1723198_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1723440_1723827_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080569.1\|1723810_1724275_+	hypothetical protein	NA	NA	NA	NA
WP_155080568.1\|1724317_1725292_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.7e-26	31.1
WP_155068678.1\|1725547_1725667_+	hypothetical protein	NA	NA	NA	NA
WP_155080567.1\|1725905_1726925_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079588.1\|1726986_1727352_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079586.1\|1727297_1727873_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080566.1\|1727869_1728094_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1728396_1729626_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155067325.1\|1729789_1731745_-	transglycosylase SLT domain-containing protein	K4NWI2	Pseudomonas_phage	9.2e-16	39.7
WP_155079612.1\|1732050_1733280_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155067326.1\|1733643_1733829_+	hypothetical protein	NA	NA	NA	NA
WP_155067327.1\|1734165_1735155_+	rhodanese-related sulfurtransferase	NA	NA	NA	NA
WP_155080565.1\|1737130_1737529_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|1737573_1738026_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1738057_1738408_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_19

1743820 : 1792479

unidentified_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080558.1\|1743820_1744369_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080557.1\|1745026_1745365_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1745348_1745906_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080556.1\|1746035_1746584_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080555.1\|1746903_1747197_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|1747376_1748351_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080554.1\|1748481_1749060_+	protein kinase	A0A2R8FF19	Brazilian_cedratvirus	1.3e-05	35.5
WP_155080553.1\|1749345_1749600_+	hypothetical protein	NA	NA	NA	NA
WP_155080552.1\|1749686_1750505_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|1750508_1751395_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080551.1\|1751458_1751887_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1752017_1752404_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|1752387_1752945_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080550.1\|1753107_1754259_-	amino acid permease	NA	NA	NA	NA
WP_155080549.1\|1754370_1754835_-	amino acid permease	NA	NA	NA	NA
WP_155067332.1\|1754970_1755798_-	thioredoxin domain-containing protein	NA	NA	NA	NA
WP_155067333.1\|1756165_1756777_+	hypothetical protein	NA	NA	NA	NA
WP_155080548.1\|1756887_1757862_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.9e-26	30.8
WP_144420684.1\|1758066_1758315_+	hypothetical protein	NA	NA	NA	NA
WP_155081525.1\|1758483_1759437_+	response regulator	NA	NA	NA	NA
WP_155080547.1\|1759879_1760176_+	hypothetical protein	NA	NA	NA	NA
WP_155080546.1\|1760205_1760934_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	41.8
WP_155080545.1\|1760902_1762021_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1762036_1762423_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080544.1\|1762406_1762964_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080543.1\|1763093_1763300_-	hypothetical protein	NA	NA	NA	NA
WP_155067435.1\|1763419_1763518_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155067434.1\|1763753_1764383_+	MotA/TolQ/ExbB proton channel family protein	NA	NA	NA	NA
WP_155067433.1\|1764366_1764789_+	biopolymer transporter ExbD	NA	NA	NA	NA
WP_155080542.1\|1764795_1766535_+	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	7.6e-54	31.0
WP_155080541.1\|1766535_1767600_+	tetraacyldisaccharide 4'-kinase	NA	NA	NA	NA
WP_155080540.1\|1767603_1767957_-	hypothetical protein	NA	NA	NA	NA
WP_155080539.1\|1768079_1769048_+	ferrochelatase	NA	NA	NA	NA
WP_155080538.1\|1769057_1769369_+	hypothetical protein	NA	NA	NA	NA
WP_155080537.1\|1769384_1769954_+\|protease	ATP-dependent Clp protease proteolytic subunit	A0A223W000	Agrobacterium_phage	1.4e-28	38.4
WP_155080536.1\|1770217_1771546_+	amino acid carrier protein	NA	NA	NA	NA
WP_155080535.1\|1772030_1772381_+	hypothetical protein	NA	NA	NA	NA
WP_155080534.1\|1772382_1772958_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1773057_1774287_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155067343.1\|1774666_1775605_+	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_027242821.1\|1775668_1777663_+	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_032127067.1\|1777659_1778262_+	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_155080533.1\|1778258_1778597_+	cytochrome o ubiquinol oxidase subunit IV	NA	NA	NA	NA
WP_155080532.1\|1778672_1779905_-	hypothetical protein	NA	NA	NA	NA
WP_155080531.1\|1780616_1781231_+	hypothetical protein	NA	NA	NA	NA
WP_155080530.1\|1781652_1782057_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1782040_1782427_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079487.1\|1782529_1783579_+\|transposase	transposase	NA	NA	NA	NA
WP_155081523.1\|1783607_1783967_+	hypothetical protein	NA	NA	NA	NA
WP_155080529.1\|1784111_1784528_+	hypothetical protein	NA	NA	NA	NA
WP_016211856.1\|1785674_1785860_+	(2Fe-2S)-binding protein	NA	NA	NA	NA
WP_017377178.1\|1785987_1786455_+	bacterioferritin	NA	NA	NA	NA
WP_017377177.1\|1786451_1787330_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_155081522.1\|1787581_1788889_+	MFS transporter	NA	NA	NA	NA
WP_155085186.1\|1789179_1790673_+	IraAB	NA	NA	NA	NA
WP_155080527.1\|1790658_1791633_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.1e-25	30.8
WP_155080526.1\|1791709_1792132_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	4.1e-14	35.3
WP_155080338.1\|1792191_1792479_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3

DBSCAN-SWA_20

1801395 : 1825586

Hokovirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081465.1\|1801395_1801848_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1801879_1802230_-\|transposase	transposase	NA	NA	NA	NA
WP_155080521.1\|1802291_1802978_-	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|1803015_1803901_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080520.1\|1803865_1804447_-	hypothetical protein	NA	NA	NA	NA
WP_155067361.1\|1805525_1805732_-	hypothetical protein	NA	NA	NA	NA
WP_155080519.1\|1805899_1806814_-	EamA family transporter	NA	NA	NA	NA
WP_155080518.1\|1806993_1808442_+	dihydrolipoyl dehydrogenase	NA	NA	NA	NA
WP_155079612.1\|1808831_1810061_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155067364.1\|1811029_1811704_-	peptidoglycan DD-metalloendopeptidase family protein	NA	NA	NA	NA
WP_155079478.1\|1811806_1812364_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080516.1\|1812569_1812734_-	hypothetical protein	NA	NA	NA	NA
WP_155589569.1\|1812730_1812994_-	hypothetical protein	NA	NA	NA	NA
WP_155080516.1\|1813210_1813375_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|1813580_1814138_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080515.1\|1814138_1814468_-	hypothetical protein	NA	NA	NA	NA
WP_155080514.1\|1814608_1815061_-	hypothetical protein	NA	NA	NA	NA
WP_155081521.1\|1815832_1816384_+	hypoxanthine-guanine phosphoribosyltransferase	A0A1V0SEQ1	Hokovirus	8.4e-07	26.3
WP_155080513.1\|1816680_1817865_+	MFS transporter	NA	NA	NA	NA
WP_155080512.1\|1818031_1819630_+	ABC-F family ATPase	A0A2K9L0W2	Tupanvirus	3.3e-56	28.5
WP_155080511.1\|1820239_1820407_-	phosphatase	NA	NA	NA	NA
WP_155080510.1\|1820367_1820703_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080509.1\|1820847_1821021_+	hypothetical protein	NA	NA	NA	NA
WP_155080508.1\|1820966_1821632_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080507.1\|1821800_1822424_+	hypothetical protein	NA	NA	NA	NA
WP_155067370.1\|1822469_1824413_-	LysM peptidoglycan-binding domain-containing protein	A0A223LD43	Bacillus_phage	1.7e-14	34.0
WP_155079445.1\|1824611_1825586_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3

DBSCAN-SWA_21

1851520 : 1905194

unidentified_phage(45.45%)

integrase,transposase

attL 1862239:1862298|attR 1910707:1911151

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079586.1\|1851520_1852096_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080102.1\|1852223_1852676_+\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_155080498.1\|1852721_1853252_+	hypothetical protein	NA	NA	NA	NA
WP_155080497.1\|1853543_1854095_-	hypothetical protein	NA	NA	NA	NA
WP_155080496.1\|1854105_1855293_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.4e-21	31.1
WP_017376484.1\|1855442_1856069_+	uridine kinase	A0A1V0SAA3	Catovirus	1.2e-33	41.3
WP_155080495.1\|1856114_1857344_+	nucleoside:proton symporter	B2YG43	Musca_hytrovirus	3.4e-08	22.1
WP_155080494.1\|1857538_1858102_-	hypothetical protein	NA	NA	NA	NA
WP_155067392.1\|1858176_1859535_+	dNTP triphosphohydrolase	NA	NA	NA	NA
WP_155080493.1\|1859988_1860696_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155080492.1\|1860742_1861705_+\|transposase	transposase	NA	NA	NA	NA
WP_155079996.1\|1861841_1862255_+	hypothetical protein	NA	NA	NA	NA
1862239:1862298	attL	NA	NA	NA	NA
WP_155079612.1\|1862824_1864054_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155589570.1\|1864825_1865710_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155067991.1\|1865935_1866352_+\|transposase	transposase	NA	NA	NA	NA
WP_155080491.1\|1866644_1867265_+	thioredoxin fold domain-containing protein	NA	NA	NA	NA
WP_155067398.1\|1867338_1868622_-	homogentisate 1,2-dioxygenase	NA	NA	NA	NA
WP_155079741.1\|1870118_1871093_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080490.1\|1871664_1873041_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_155079655.1\|1873169_1874144_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	9.8e-27	30.7
WP_155080489.1\|1874341_1875442_-	carbohydrate kinase family protein	NA	NA	NA	NA
WP_155067413.1\|1875610_1876912_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	8.2e-29	37.3
WP_155067412.1\|1876988_1877492_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|1877605_1877956_+\|transposase	transposase	NA	NA	NA	NA
WP_155081519.1\|1877987_1878413_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079655.1\|1878409_1879384_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	9.8e-27	30.7
WP_155079487.1\|1879693_1880743_+\|transposase	transposase	NA	NA	NA	NA
WP_155080488.1\|1880796_1881714_-	sel1 repeat family protein	NA	NA	NA	NA
WP_155080487.1\|1881779_1882244_-	hypothetical protein	NA	NA	NA	NA
WP_155067409.1\|1882727_1882916_-	hypothetical protein	NA	NA	NA	NA
WP_155080486.1\|1883240_1884137_+	hypothetical protein	NA	NA	NA	NA
WP_155067407.1\|1884260_1885334_+	flagellar motor switch protein FliM	NA	NA	NA	NA
WP_155085173.1\|1885563_1886289_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_054300641.1\|1886352_1886718_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079612.1\|1886930_1888160_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080485.1\|1888306_1888771_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080484.1\|1888774_1889284_-	hypothetical protein	NA	NA	NA	NA
WP_155067405.1\|1889432_1890146_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	1.0e-36	38.5
WP_155081518.1\|1890333_1891746_+	MFS transporter	NA	NA	NA	NA
WP_155080483.1\|1891951_1892920_+	threonine/serine dehydratase	NA	NA	NA	NA
WP_155080482.1\|1892956_1893508_-\|transposase	transposase	NA	NA	NA	NA
WP_155079868.1\|1893574_1894730_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080481.1\|1894658_1894979_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|1895023_1895998_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080480.1\|1896017_1896347_-	hypothetical protein	NA	NA	NA	NA
WP_155080442.1\|1896571_1897699_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080478.1\|1899958_1900960_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	5.4e-28	31.2
WP_155067415.1\|1901247_1901490_+	hypothetical protein	NA	NA	NA	NA
WP_155067416.1\|1901483_1901801_-	hypothetical protein	NA	NA	NA	NA
WP_155080477.1\|1901911_1902790_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155080476.1\|1902905_1904123_+	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_155068701.1\|1904414_1905194_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
1910707:1911151	attR	NA	NA	NA	NA

DBSCAN-SWA_22

1916537 : 1963156

unidentified_phage(36.36%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080470.1\|1916537_1917404_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080469.1\|1917515_1917899_-	hypothetical protein	NA	NA	NA	NA
WP_155080468.1\|1918295_1919084_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155080467.1\|1919752_1920905_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.8e-59	44.5
WP_155080466.1\|1920914_1921121_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1921183_1921570_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081465.1\|1921731_1922184_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|1922215_1922566_-\|transposase	transposase	NA	NA	NA	NA
WP_155079478.1\|1922704_1923262_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1923245_1923632_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080465.1\|1923664_1923985_+	hypothetical protein	NA	NA	NA	NA
WP_155067341.1\|1924637_1925078_+	universal stress family protein	NA	NA	NA	NA
WP_155080251.1\|1925294_1925441_-	hypothetical protein	NA	NA	NA	NA
WP_155079958.1\|1925527_1925836_+	hypothetical protein	NA	NA	NA	NA
WP_155080464.1\|1925832_1926183_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	5.8e-14	39.2
WP_155080463.1\|1926225_1927707_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	8.4e-70	32.7
WP_155080462.1\|1927711_1927942_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|1928042_1929017_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_047927692.1\|1929139_1929328_+\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|1929347_1930322_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080461.1\|1930366_1931542_+\|transposase	IS3 family transposase	Q6H9S3	Enterobacteria_phage	1.6e-18	27.0
WP_155080460.1\|1931591_1931774_-	hypothetical protein	NA	NA	NA	NA
WP_155080459.1\|1932059_1933832_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.1e-27	30.6
WP_155080458.1\|1934061_1934469_-\|transposase	IS1 family transposase	A0A0U2RK18	Escherichia_phage	4.2e-32	56.0
WP_155080457.1\|1934521_1934722_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1934862_1936092_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080456.1\|1936191_1936332_-	hypothetical protein	NA	NA	NA	NA
WP_155067337.1\|1936880_1937852_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_155067336.1\|1937833_1938805_+	glycine/betaine ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_155079445.1\|1938954_1939929_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080455.1\|1940025_1940832_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155080219.1\|1940923_1941973_-\|transposase	transposase	NA	NA	NA	NA
WP_155067334.1\|1942362_1942563_+	hypothetical protein	NA	NA	NA	NA
WP_155080408.1\|1942878_1944108_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080454.1\|1944252_1945227_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.1e-28	31.5
WP_155068704.1\|1945571_1946252_+	hypothetical protein	NA	NA	NA	NA
WP_144420790.1\|1946338_1946554_+	hypothetical protein	NA	NA	NA	NA
WP_155081516.1\|1946650_1947772_-	alanine dehydrogenase	NA	NA	NA	NA
WP_036771628.1\|1949563_1950685_+	calcium:proton antiporter	NA	NA	NA	NA
WP_155066936.1\|1951296_1951647_+\|transposase	transposase	NA	NA	NA	NA
WP_155081492.1\|1951678_1952068_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080019.1\|1951994_1952180_+	hypothetical protein	NA	NA	NA	NA
WP_155080452.1\|1952427_1952841_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|1952824_1953211_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080451.1\|1956155_1956719_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1956832_1958062_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080450.1\|1958158_1958413_+	hypothetical protein	NA	NA	NA	NA
WP_155080372.1\|1958512_1959742_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080449.1\|1959907_1960168_+	hypothetical protein	NA	NA	NA	NA
WP_155067446.1\|1960956_1961340_+	hypothetical protein	NA	NA	NA	NA
WP_155080448.1\|1961355_1962246_-	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_155079439.1\|1962269_1963156_-\|transposase	IS630 family transposase	A0A2P0VP61	Tetraselmis_virus	1.7e-09	28.8

DBSCAN-SWA_23

1966367 : 2004573

Leptospira_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|1966367_1966925_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1966908_1967295_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080447.1\|1967313_1967670_-	DUF4131 domain-containing protein	NA	NA	NA	NA
WP_155080446.1\|1967687_1968224_+	DUF2062 domain-containing protein	NA	NA	NA	NA
WP_155067454.1\|1968265_1968451_-	hypothetical protein	NA	NA	NA	NA
WP_155080445.1\|1968680_1969586_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155079612.1\|1969858_1971088_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080444.1\|1971968_1973450_-\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	8.4e-70	32.9
WP_155079959.1\|1973492_1973843_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155079958.1\|1973839_1974148_-	hypothetical protein	NA	NA	NA	NA
WP_155080443.1\|1974992_1976042_-\|transposase	transposase	NA	NA	NA	NA
WP_155080442.1\|1976766_1977894_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080441.1\|1978074_1978923_+	hypothetical protein	NA	NA	NA	NA
WP_155080440.1\|1979193_1979592_+	hypothetical protein	NA	NA	NA	NA
WP_155080439.1\|1979814_1981128_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.0e-50	32.0
WP_155080438.1\|1981361_1982507_+	hypothetical protein	NA	NA	NA	NA
WP_155080437.1\|1982581_1982758_+	DUF1508 domain-containing protein	NA	NA	NA	NA
WP_155080436.1\|1982793_1983426_-	NAAT family transporter	NA	NA	NA	NA
WP_155080435.1\|1983537_1984266_+	hypothetical protein	NA	NA	NA	NA
WP_155080434.1\|1984254_1986540_-	hypothetical protein	NA	NA	NA	NA
WP_155067468.1\|1986713_1986860_-	hypothetical protein	NA	NA	NA	NA
WP_155080433.1\|1986910_1987381_-	hypothetical protein	NA	NA	NA	NA
WP_155080432.1\|1987546_1987828_+	hypothetical protein	NA	NA	NA	NA
WP_155080431.1\|1987915_1988299_+	hypothetical protein	NA	NA	NA	NA
WP_155080430.1\|1988443_1988962_+	hypothetical protein	NA	NA	NA	NA
WP_155080429.1\|1989096_1989243_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|1989559_1990789_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079653.1\|1991048_1991519_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079588.1\|1991582_1991948_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066610.1\|1991893_1992469_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|1992548_1992935_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080428.1\|1993117_1993390_-	hypothetical protein	A0A1B0Z0G5	Vibrio_phage	2.5e-12	53.4
WP_155067266.1\|1993501_1993849_-	50S ribosomal protein L19	NA	NA	NA	NA
WP_155067265.1\|1993866_1994646_-\|tRNA	tRNA (guanosine(37)-N1)-methyltransferase TrmD	NA	NA	NA	NA
WP_017377443.1\|1994645_1995155_-	ribosome maturation factor RimM	NA	NA	NA	NA
WP_016211283.1\|1995190_1995439_-	30S ribosomal protein S16	NA	NA	NA	NA
WP_155067264.1\|1995750_1996086_+	DUF3470 domain-containing protein	NA	NA	NA	NA
WP_155067263.1\|1996377_1997628_+	MFS transporter	NA	NA	NA	NA
WP_155080427.1\|1997710_1999738_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_155067259.1\|2000285_2000504_+	DUF2158 domain-containing protein	NA	NA	NA	NA
WP_155067258.1\|2000674_2001055_+	hypothetical protein	NA	NA	NA	NA
WP_155080426.1\|2001360_2001675_+	hypothetical protein	NA	NA	NA	NA
WP_155081514.1\|2002116_2002278_+	phosphatase	NA	NA	NA	NA
WP_155080425.1\|2002522_2003408_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080424.1\|2003405_2003744_+	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|2003738_2004191_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2004222_2004573_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_24

2022566 : 2254558

229

unidentified_phage(15.38%)

tRNA,integrase,protease,transposase

attL 2097188:2097247|attR 2129332:2130291

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081513.1\|2022566_2023046_-\|transposase	transposase	NA	NA	NA	NA
WP_155080412.1\|2024139_2024433_+	hypothetical protein	NA	NA	NA	NA
WP_155080411.1\|2024641_2025175_-	hypothetical protein	NA	NA	NA	NA
WP_155080410.1\|2026527_2027334_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.3e-12	29.3
WP_155080409.1\|2027491_2027731_+	hypothetical protein	NA	NA	NA	NA
WP_155080408.1\|2027844_2029074_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080402.1\|2029218_2030193_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.6e-27	31.2
WP_155080407.1\|2030353_2031169_+\|transposase	transposase	NA	NA	NA	NA
WP_155080406.1\|2031364_2031625_+	hypothetical protein	NA	NA	NA	NA
WP_155080405.1\|2031621_2031738_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|2031738_2032296_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2032279_2032666_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080404.1\|2032681_2032930_+	IS66 family insertion sequence element accessory protein TnpB	S5VXZ8	Leptospira_phage	5.8e-08	37.3
WP_155080403.1\|2032972_2034070_+\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	4.9e-51	38.1
WP_155589573.1\|2034195_2035170_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	1.7e-26	31.0
WP_155079476.1\|2035239_2035626_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2035609_2036167_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080401.1\|2036272_2036749_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|2036749_2037307_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2037290_2037677_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080400.1\|2037692_2038460_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080399.1\|2038656_2038962_+\|transposase	transposase	NA	NA	NA	NA
WP_155080398.1\|2039224_2039458_+	hypothetical protein	NA	NA	NA	NA
WP_155067241.1\|2040191_2040950_-	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_155085161.1\|2040946_2043346_-	ribonuclease R	Q0GXV6	Lactococcus_phage	1.0e-69	33.5
WP_155080396.1\|2043359_2044637_-	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	3.4e-51	32.9
WP_155067239.1\|2044725_2046024_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	3.2e-65	33.8
WP_155067238.1\|2046221_2047115_-\|protease	protease modulator HflC	NA	NA	NA	NA
WP_155080395.1\|2047114_2048329_-\|protease	FtsH protease activity modulator HflK	NA	NA	NA	NA
WP_155067236.1\|2048348_2049635_-	GTPase HflX	NA	NA	NA	NA
WP_026063533.1\|2049650_2049905_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_155080394.1\|2050130_2051498_-	glycerol-3-phosphate transporter	NA	NA	NA	NA
WP_155080393.1\|2051828_2052851_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_155067233.1\|2052943_2053138_-	hypothetical protein	NA	NA	NA	NA
WP_155080392.1\|2053373_2054849_+	amino acid permease	NA	NA	NA	NA
WP_155080391.1\|2055059_2055518_+	hypothetical protein	NA	NA	NA	NA
WP_155080390.1\|2055698_2056577_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081465.1\|2056757_2057210_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080389.1\|2057577_2057880_-	hypothetical protein	NA	NA	NA	NA
WP_155080388.1\|2058070_2059633_+	peptide-binding protein	NA	NA	NA	NA
WP_155589574.1\|2059710_2059917_-	hypothetical protein	NA	NA	NA	NA
WP_155589575.1\|2060124_2060448_+	DUF3865 domain-containing protein	NA	NA	NA	NA
WP_155079826.1\|2060509_2061395_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2061427_2061814_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079612.1\|2062113_2063343_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080385.1\|2063488_2063887_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|2063963_2064314_+\|transposase	transposase	NA	NA	NA	NA
WP_155080338.1\|2064691_2064979_+\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3
WP_155068622.1\|2065127_2065580_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2065611_2065962_-\|transposase	transposase	NA	NA	NA	NA
WP_155080384.1\|2066029_2066764_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-44	41.4
WP_155079487.1\|2067105_2068155_-\|transposase	transposase	NA	NA	NA	NA
WP_155080699.1\|2068231_2068486_+	DUF3865 domain-containing protein	NA	NA	NA	NA
WP_155080700.1\|2068764_2069028_-	carbon storage regulator CsrA	A0A2I7RT00	Vibrio_phage	4.1e-12	68.6
WP_155080701.1\|2069334_2071929_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.8e-88	41.3
WP_155080702.1\|2071925_2072408_-	regulatory protein RecX	NA	NA	NA	NA
WP_122941088.1\|2072385_2073426_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	5.8e-118	66.3
WP_155080703.1\|2073597_2074083_-	nicotinamide-nucleotide amidohydrolase family protein	B5TK85	Pseudomonas_phage	8.9e-37	55.6
WP_155067220.1\|2074190_2076761_+	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	3.5e-31	22.8
WP_155080704.1\|2076833_2077295_+	hypothetical protein	NA	NA	NA	NA
WP_155067218.1\|2077453_2077609_-	hypothetical protein	NA	NA	NA	NA
WP_155080705.1\|2077622_2078093_-\|transposase	transposase	S5WIU1	Leptospira_phage	5.8e-33	47.5
WP_155080706.1\|2078318_2078480_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|2078583_2079558_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155079868.1\|2080149_2081305_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080443.1\|2081840_2082890_+\|transposase	transposase	NA	NA	NA	NA
WP_155067214.1\|2083341_2084826_-	glycerol kinase GlpK	NA	NA	NA	NA
WP_155080707.1\|2084950_2086486_+	glycerol-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_155080708.1\|2086508_2086949_+	hypothetical protein	NA	NA	NA	NA
WP_155080709.1\|2086965_2087826_-	methylisocitrate lyase	NA	NA	NA	NA
WP_155080710.1\|2088291_2088477_+	hypothetical protein	NA	NA	NA	NA
WP_155589576.1\|2089066_2089738_-	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	7.8e-07	28.8
WP_155067210.1\|2089765_2089987_-	hypothetical protein	NA	NA	NA	NA
WP_155081534.1\|2089979_2090963_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	2.8e-53	38.4
WP_155067209.1\|2091058_2091985_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155080712.1\|2092151_2093834_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.5e-26	31.7
WP_155080713.1\|2093841_2094870_-	YHYH protein	NA	NA	NA	NA
WP_155080714.1\|2095038_2095737_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|2095758_2096644_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080715.1\|2096798_2096996_+	hypothetical protein	NA	NA	NA	NA
2097188:2097247	attL	NA	NA	NA	NA
WP_155079478.1\|2097192_2097750_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2097733_2098120_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080716.1\|2098187_2099369_+\|transposase	transposase	NA	NA	NA	NA
WP_155080717.1\|2099552_2100869_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080718.1\|2101608_2101893_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|2102255_2103141_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079478.1\|2103201_2103759_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080557.1\|2103742_2104081_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080719.1\|2104180_2104660_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	A0A0N7C035	Escherichia_phage	1.2e-12	33.1
WP_155080720.1\|2104695_2105670_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.7e-29	32.3
WP_155080721.1\|2105706_2105946_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155066936.1\|2106000_2106351_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2106382_2106835_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080722.1\|2107556_2109032_-	thiamine phosphate synthase	NA	NA	NA	NA
WP_155080723.1\|2109038_2109245_-	sulfur carrier protein ThiS	NA	NA	NA	NA
WP_155080724.1\|2109302_2110373_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_155080725.1\|2110570_2112541_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.5e-77	36.2
WP_155080726.1\|2112893_2114453_+	amino acid permease	NA	NA	NA	NA
WP_155080727.1\|2114750_2115017_-	hypothetical protein	NA	NA	NA	NA
WP_155080728.1\|2115368_2115659_-	hypothetical protein	NA	NA	NA	NA
WP_155080729.1\|2116178_2116838_+	response regulator	NA	NA	NA	NA
WP_155081535.1\|2116933_2118295_+	histidine kinase	NA	NA	NA	NA
WP_155066936.1\|2119620_2119971_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2120002_2120455_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080730.1\|2120459_2120819_-	hypothetical protein	NA	NA	NA	NA
WP_155080731.1\|2120861_2121080_-	hypothetical protein	NA	NA	NA	NA
WP_155080732.1\|2121233_2121617_+	hypothetical protein	NA	NA	NA	NA
WP_155080733.1\|2121943_2122300_-	hypothetical protein	NA	NA	NA	NA
WP_155079958.1\|2122429_2122738_+	hypothetical protein	NA	NA	NA	NA
WP_155079959.1\|2122734_2123085_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	7.6e-14	38.2
WP_155589577.1\|2123127_2124690_+\|transposase	IS66 family transposase	S5VTD3	Leptospira_phage	2.6e-69	32.5
WP_155080735.1\|2124888_2125554_-	hypothetical protein	NA	NA	NA	NA
WP_155080736.1\|2125619_2126207_+	hypothetical protein	NA	NA	NA	NA
WP_155080737.1\|2127878_2128232_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2128458_2128845_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2128828_2129386_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066918.1\|2129506_2130334_+\|transposase	transposase	NA	NA	NA	NA
2129332:2130291	attR	NA	NA	NA	NA
WP_155079476.1\|2130548_2130935_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2130918_2131476_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589578.1\|2131456_2131684_-	hypothetical protein	NA	NA	NA	NA
WP_155067185.1\|2131964_2132318_+	ArsC family reductase	NA	NA	NA	NA
WP_155081536.1\|2132310_2133456_+	succinyl-diaminopimelate desuccinylase	NA	NA	NA	NA
WP_155080739.1\|2133864_2135112_+	hypothetical protein	NA	NA	NA	NA
WP_155067183.1\|2135397_2135781_-	holo-ACP synthase	NA	NA	NA	NA
WP_155081537.1\|2135777_2136509_-	pyridoxine 5'-phosphate synthase	NA	NA	NA	NA
WP_155067182.1\|2136511_2137255_-	DNA repair protein RecO	NA	NA	NA	NA
WP_155081538.1\|2137268_2138168_-	GTPase Era	NA	NA	NA	NA
WP_155067181.1\|2138173_2138848_-	ribonuclease III	E5EQH1	Micromonas_sp._RCC1109_virus	1.5e-26	34.1
WP_155080740.1\|2138962_2139754_-	signal peptidase I	NA	NA	NA	NA
WP_155067179.1\|2139820_2140762_-	signal peptidase I	NA	NA	NA	NA
WP_155067178.1\|2140758_2142561_-	elongation factor 4	E4ZFJ7	Streptococcus_phage	5.1e-21	25.1
WP_155068681.1\|2142861_2143431_-	RNA polymerase sigma factor RpoE	NA	NA	NA	NA
WP_155067177.1\|2143585_2145160_+	L-aspartate oxidase	NA	NA	NA	NA
WP_155589579.1\|2145167_2145602_-	hypothetical protein	NA	NA	NA	NA
WP_016209486.1\|2145606_2145858_-	succinate dehydrogenase assembly factor 2	NA	NA	NA	NA
WP_155080742.1\|2145899_2146937_+	hypothetical protein	NA	NA	NA	NA
WP_155067174.1\|2147083_2147410_+	hypothetical protein	NA	NA	NA	NA
WP_155067173.1\|2147566_2147977_-	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|2148032_2149082_-\|transposase	transposase	NA	NA	NA	NA
WP_155080743.1\|2149266_2149584_-	QacE family quaternary ammonium compound efflux SMR transporter	NA	NA	NA	NA
WP_155080744.1\|2150283_2150643_+	hypothetical protein	NA	NA	NA	NA
WP_155080745.1\|2150594_2151260_+	hypothetical protein	NA	NA	NA	NA
WP_155080746.1\|2152188_2153907_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2153903_2154290_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2154273_2154831_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080747.1\|2155609_2156242_-	hypothetical protein	NA	NA	NA	NA
WP_155080309.1\|2156234_2157281_-	hypothetical protein	NA	NA	NA	NA
WP_155080748.1\|2157709_2158705_+	glycosyl hydrolase family 17	NA	NA	NA	NA
WP_155081539.1\|2159031_2159205_+	phosphatase	NA	NA	NA	NA
WP_155080749.1\|2160897_2161851_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155080750.1\|2161873_2163892_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_155080751.1\|2163980_2164304_-	YqcC family protein	NA	NA	NA	NA
WP_155080752.1\|2165647_2165887_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016209463.1\|2166155_2166539_-	DNA-binding protein	NA	NA	NA	NA
WP_155068680.1\|2166895_2167369_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_155080753.1\|2167486_2168857_-	DNA repair protein RadA	NA	NA	NA	NA
WP_155080754.1\|2168972_2169704_+	hypothetical protein	M1IDP9	Pelagibacter_phage	3.4e-08	35.0
WP_155080755.1\|2169728_2170826_-	alanine racemase	NA	NA	NA	NA
WP_155068679.1\|2170858_2172280_-	replicative DNA helicase	A0A077SK18	Escherichia_phage	1.3e-152	62.1
WP_155067160.1\|2172489_2172942_-	50S ribosomal protein L9	NA	NA	NA	NA
WP_016209480.1\|2172953_2173181_-	30S ribosomal protein S18	NA	NA	NA	NA
WP_027242778.1\|2173230_2173557_-	30S ribosomal protein S6	NA	NA	NA	NA
WP_155080756.1\|2174396_2175005_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155067154.1\|2175153_2175642_+	GAF domain-containing protein	NA	NA	NA	NA
WP_155080757.1\|2175682_2176786_-	3-dehydroquinate synthase	NA	NA	NA	NA
WP_155080758.1\|2176828_2177911_-	chorismate synthase	A0A291AU41	Pandoravirus	3.5e-73	42.4
WP_155067151.1\|2177900_2178467_-	shikimate kinase	NA	NA	NA	NA
WP_155067150.1\|2178457_2179762_-	3-phosphoshikimate 1-carboxyvinyltransferase	NA	NA	NA	NA
WP_155080759.1\|2179815_2180844_-	chorismate mutase	NA	NA	NA	NA
WP_155079826.1\|2180951_2181837_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079826.1\|2182449_2183336_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589580.1\|2183397_2183796_-	hypothetical protein	NA	NA	NA	NA
WP_155080760.1\|2183964_2184120_-	hypothetical protein	NA	NA	NA	NA
WP_155080761.1\|2184229_2186302_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|2186525_2187755_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080762.1\|2187819_2188464_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2188618_2189005_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2188988_2189546_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079741.1\|2190688_2191663_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080716.1\|2191715_2192897_+\|transposase	transposase	NA	NA	NA	NA
WP_155085150.1\|2193229_2193604_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2193626_2194013_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2193996_2194554_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080764.1\|2194685_2195129_+	hypothetical protein	NA	NA	NA	NA
WP_155080765.1\|2195507_2195702_-	hypothetical protein	NA	NA	NA	NA
WP_155080766.1\|2195906_2196263_-	hypothetical protein	NA	NA	NA	NA
WP_054300641.1\|2196319_2196685_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079868.1\|2197101_2198257_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080767.1\|2198214_2199813_-	dolichyl-phosphate-mannose-protein mannosyltransferase	NA	NA	NA	NA
WP_155080768.1\|2200107_2200863_+	zinc transporter	NA	NA	NA	NA
WP_155080769.1\|2201516_2202670_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-58	46.0
WP_155067135.1\|2202924_2203596_-	AT hook motif family protein	NA	NA	NA	NA
WP_155079487.1\|2205076_2206126_-\|transposase	transposase	NA	NA	NA	NA
WP_155080161.1\|2206375_2206591_-	hypothetical protein	NA	NA	NA	NA
WP_054300641.1\|2206647_2207013_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080770.1\|2207263_2210665_-	AAA family ATPase	S5M596	Bacillus_phage	1.0e-09	23.1
WP_155067131.1\|2210661_2213355_-	DNA repair protein	NA	NA	NA	NA
WP_155080771.1\|2213658_2215131_+	sugar porter family MFS transporter	O13311	Aichi_virus	2.4e-32	27.8
WP_155080772.1\|2215790_2216612_-	DUF1338 family protein	NA	NA	NA	NA
WP_155080773.1\|2216683_2218216_-	hypothetical protein	NA	NA	NA	NA
WP_155080774.1\|2218485_2220660_+	hypothetical protein	NA	NA	NA	NA
WP_155067125.1\|2220682_2221363_-	glycosyl transferase family 2	NA	NA	NA	NA
WP_155080775.1\|2221679_2223668_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155067123.1\|2223682_2224024_-	hypothetical protein	NA	NA	NA	NA
WP_155067122.1\|2224028_2224466_-	flagellar export chaperone FliS	NA	NA	NA	NA
WP_155080776.1\|2224491_2225877_-	flagellar filament capping protein FliD	NA	NA	NA	NA
WP_155080777.1\|2225996_2226428_-	flaG family protein	NA	NA	NA	NA
WP_155067119.1\|2226533_2228111_-	B-type flagellin	NA	NA	NA	NA
WP_155589581.1\|2228088_2228391_+	hypothetical protein	NA	NA	NA	NA
WP_155080778.1\|2228335_2229928_-	B-type flagellin	NA	NA	NA	NA
WP_155080779.1\|2230128_2232330_+	hypothetical protein	NA	NA	NA	NA
WP_155080780.1\|2232423_2233857_-	hypothetical protein	NA	NA	NA	NA
WP_155080781.1\|2233899_2234415_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155080782.1\|2234414_2235362_-	hypothetical protein	NA	NA	NA	NA
WP_155080783.1\|2235345_2236020_-	hypothetical protein	NA	NA	NA	NA
WP_155080784.1\|2236007_2236736_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155067107.1\|2236725_2237472_-	hypothetical protein	NA	NA	NA	NA
WP_155080785.1\|2237455_2238520_-	hypothetical protein	NA	NA	NA	NA
WP_155067105.1\|2238724_2239921_+	Bcr/CflA family efflux MFS transporter	NA	NA	NA	NA
WP_155067104.1\|2239971_2241093_-	moeZ/MoeB domain protein	A0A1V0SIK8	Klosneuvirus	3.0e-11	27.8
WP_155080786.1\|2241612_2243361_+	PLD-like domain protein	NA	NA	NA	NA
WP_155067102.1\|2243412_2244672_-	threonine synthase	NA	NA	NA	NA
WP_155068677.1\|2244658_2245627_-	homoserine kinase	NA	NA	NA	NA
WP_155081540.1\|2245640_2248109_-	bifunctional aspartate kinase/homoserine dehydrogenase I	NA	NA	NA	NA
WP_155080787.1\|2248530_2249052_+	hypothetical protein	NA	NA	NA	NA
WP_155079868.1\|2249008_2250165_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080788.1\|2250701_2251415_-	hypothetical protein	NA	NA	NA	NA
WP_155080789.1\|2253327_2253519_-	hypothetical protein	NA	NA	NA	NA
WP_155080790.1\|2253583_2254558_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3

DBSCAN-SWA_25

2274582 : 2322469

unidentified_phage(50.0%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081541.1\|2274582_2274999_+\|transposase	transposase	NA	NA	NA	NA
WP_155080806.1\|2275838_2277209_-	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_155080807.1\|2277824_2278016_-	hypothetical protein	NA	NA	NA	NA
WP_155079975.1\|2279324_2279900_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079974.1\|2279845_2280211_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080808.1\|2280355_2280790_-\|transposase	transposase	NA	NA	NA	NA
WP_155080809.1\|2281095_2281674_+	hypothetical protein	NA	NA	NA	NA
WP_155080810.1\|2282867_2283137_+	hypothetical protein	NA	NA	NA	NA
WP_155080811.1\|2283164_2284318_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.8e-59	44.5
WP_155080812.1\|2285091_2286480_+	hypothetical protein	NA	NA	NA	NA
WP_155068675.1\|2286647_2286941_-	hypothetical protein	NA	NA	NA	NA
WP_155067075.1\|2287016_2287400_-	histidine phosphotransferase	NA	NA	NA	NA
WP_032126790.1\|2289677_2290583_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_155080813.1\|2290633_2291164_-	exsB family protein	NA	NA	NA	NA
WP_155080814.1\|2291174_2292227_-\|protease	protease SohB	NA	NA	NA	NA
WP_155080815.1\|2292242_2294282_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	7.1e-128	41.2
WP_155080816.1\|2294268_2295099_-	cell division protein FtsZ	NA	NA	NA	NA
WP_155080817.1\|2295166_2298706_-	chromosome segregation protein SMC	NA	NA	NA	NA
WP_155079445.1\|2299051_2300026_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080818.1\|2303804_2303954_+	hypothetical protein	NA	NA	NA	NA
WP_155080819.1\|2304154_2305438_+	hypothetical protein	NA	NA	NA	NA
WP_155080820.1\|2305864_2307493_+	hypothetical protein	NA	NA	NA	NA
WP_155080821.1\|2307874_2308729_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080822.1\|2308747_2308969_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|2309030_2309381_+\|transposase	transposase	NA	NA	NA	NA
WP_155081541.1\|2309448_2309865_+\|transposase	transposase	NA	NA	NA	NA
WP_155067991.1\|2309877_2310294_+\|transposase	transposase	NA	NA	NA	NA
WP_155080823.1\|2310968_2312447_+	hypothetical protein	NA	NA	NA	NA
WP_155080824.1\|2312884_2314201_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2314279_2314666_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2314649_2315207_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080825.1\|2315273_2315969_+	hypothetical protein	NA	NA	NA	NA
WP_155079741.1\|2316011_2316986_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080826.1\|2317073_2317511_+	hypothetical protein	NA	NA	NA	NA
WP_155080608.1\|2317447_2317585_+	phosphatase	NA	NA	NA	NA
WP_155080827.1\|2319310_2321020_+\|tRNA	proline--tRNA ligase	NA	NA	NA	NA
WP_155067055.1\|2321192_2321555_+	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|2321634_2322087_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2322118_2322469_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_26

2337007 : 2389675

unidentified_phage(21.43%)

tRNA,protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155067038.1\|2337007_2338429_-\|tRNA	glutamate--tRNA ligase	NA	NA	NA	NA
WP_155080832.1\|2338518_2340117_-	glutamate--cysteine ligase	NA	NA	NA	NA
WP_155067036.1\|2340273_2340900_-	phosphatase PAP2 family protein	NA	NA	NA	NA
WP_155080833.1\|2340981_2343654_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_155080834.1\|2344137_2345094_+	23S rRNA pseudouridine(955/2504/2580) synthase RluC	NA	NA	NA	NA
WP_016209435.1\|2345194_2345566_+	response regulator	W8CYM9	Bacillus_phage	1.1e-05	29.4
WP_155067033.1\|2345591_2346455_+	hypothetical protein	NA	NA	NA	NA
WP_155080835.1\|2346444_2347233_-	DNA-binding protein	NA	NA	NA	NA
WP_155067031.1\|2347520_2348006_-	DUF2802 domain-containing protein	NA	NA	NA	NA
WP_017375750.1\|2348082_2348604_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_155080836.1\|2348649_2349543_-	chemotaxis protein CheW	NA	NA	NA	NA
WP_027242840.1\|2349539_2350361_-	ParA family protein	H7BUL8	unidentified_phage	3.9e-16	33.0
WP_016209408.1\|2350673_2350844_+	hypothetical protein	NA	NA	NA	NA
WP_155067028.1\|2350996_2352400_-	ribosome biogenesis GTPase Der	NA	NA	NA	NA
WP_155080837.1\|2352509_2353817_-	outer membrane protein assembly factor BamB	NA	NA	NA	NA
WP_155080838.1\|2353840_2354815_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.6e-27	31.7
WP_155080839.1\|2354874_2355576_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_155067025.1\|2355587_2356865_-\|tRNA	histidine--tRNA ligase	A0A2I2L577	Orpheovirus	4.8e-21	24.8
WP_017376087.1\|2356964_2357339_-	hypothetical protein	NA	NA	NA	NA
WP_155080840.1\|2357423_2358311_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080841.1\|2358367_2359096_-	type IV pilus biogenesis/stability protein PilW	NA	NA	NA	NA
WP_155081542.1\|2359092_2360202_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_155067022.1\|2360353_2360782_-	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	4.0e-17	39.4
WP_155067021.1\|2360877_2361237_-	hypothetical protein	NA	NA	NA	NA
WP_155080842.1\|2361226_2362438_-	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7C038	Faustovirus	6.1e-34	31.1
WP_155067019.1\|2362434_2363223_-\|tRNA	tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ	NA	NA	NA	NA
WP_122940639.1\|2363385_2364180_+	inositol monophosphatase	NA	NA	NA	NA
WP_155080843.1\|2364655_2365396_-	outer membrane lipocarrier LolA family protein	NA	NA	NA	NA
WP_155080844.1\|2365399_2367931_-	cell division protein FtsK	A0A218M9A2	Mycobacterium_phage	2.2e-86	43.1
WP_155080845.1\|2368198_2369155_+	thioredoxin-disulfide reductase	A0A2I2L5E1	Orpheovirus	3.5e-61	43.3
WP_155081543.1\|2369138_2369894_+\|tRNA	leucyl/phenylalanyl-tRNA--protein transferase	NA	NA	NA	NA
WP_016211259.1\|2369983_2370229_+	translation initiation factor IF-1	NA	NA	NA	NA
WP_155067011.1\|2370288_2372562_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpA	A0A223W0B1	Agrobacterium_phage	2.3e-167	42.0
WP_122940630.1\|2372616_2372970_-\|protease	ATP-dependent Clp protease adapter ClpS	A0A218MMY6	uncultured_virus	6.7e-10	40.0
WP_016211261.1\|2373159_2373453_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	5.8e-15	61.5
WP_155589583.1\|2373623_2373803_-	hypothetical protein	NA	NA	NA	NA
WP_155068670.1\|2373878_2374454_-	DedA family protein	NA	NA	NA	NA
WP_155080846.1\|2374736_2376053_+	MFS transporter	NA	NA	NA	NA
WP_016211263.1\|2376063_2376432_-	thioredoxin family protein	NA	NA	NA	NA
WP_155067009.1\|2376462_2377125_-	adenylate kinase	NA	NA	NA	NA
WP_155079476.1\|2377260_2377647_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2377630_2378188_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080847.1\|2378352_2379072_+	TIGR00730 family Rossman fold protein	A0A1D8KUT5	Synechococcus_phage	1.1e-19	34.8
WP_155080848.1\|2379051_2379870_-	nucleoside triphosphate pyrophosphohydrolase	NA	NA	NA	NA
WP_155081544.1\|2379882_2382060_-	GTP diphosphokinase	NA	NA	NA	NA
WP_155067006.1\|2382163_2383513_-	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	E4ZFI6	Streptococcus_phage	1.3e-32	26.9
WP_155080849.1\|2383586_2384276_-	hypothetical protein	NA	NA	NA	NA
WP_155080850.1\|2384408_2385596_+	MFS transporter	NA	NA	NA	NA
WP_155080851.1\|2385826_2387005_+	hypothetical protein	NA	NA	NA	NA
WP_155080852.1\|2387274_2387619_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2387599_2388157_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2388140_2388527_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|2388700_2389675_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3

DBSCAN-SWA_27

2404407 : 2444832

unidentified_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080857.1\|2404407_2405382_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	3.4e-27	31.3
WP_155080858.1\|2405964_2407692_+	glycoside hydrolase family 32 protein	NA	NA	NA	NA
WP_155066993.1\|2407681_2408890_+	MFS transporter	NA	NA	NA	NA
WP_155080859.1\|2408978_2409980_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_155080860.1\|2410208_2411420_-	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_155080861.1\|2411731_2412361_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_155080862.1\|2412409_2413426_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	1.6e-99	53.9
WP_016211035.1\|2413673_2413889_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_155066988.1\|2413941_2414391_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	5.4e-20	44.2
WP_155080863.1\|2414470_2416216_+	DNA primase	A0A1S5RGL3	Helicobacter_phage	3.8e-45	36.7
WP_155080864.1\|2416307_2418179_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	7.2e-34	31.1
WP_155080102.1\|2418367_2418820_-\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_155589585.1\|2419478_2420519_-\|transposase	transposase	NA	NA	NA	NA
WP_054300641.1\|2420968_2421334_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079413.1\|2421891_2423061_+\|transposase	transposase	NA	NA	NA	NA
WP_155080866.1\|2424892_2426007_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.0e-44	37.4
WP_155080867.1\|2426353_2426617_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080868.1\|2426658_2427018_+\|transposase	transposase	NA	NA	NA	NA
WP_155080869.1\|2427721_2428291_-	hypothetical protein	NA	NA	NA	NA
WP_122942521.1\|2428283_2428580_-	hypothetical protein	NA	NA	NA	NA
WP_155080870.1\|2428576_2429185_-	hypothetical protein	NA	NA	NA	NA
WP_155080871.1\|2429458_2429659_-	hypothetical protein	NA	NA	NA	NA
WP_155081546.1\|2429670_2430006_-	type II toxin-antitoxin system PemK/MazF family toxin	NA	NA	NA	NA
WP_016211873.1\|2429999_2430257_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_155067063.1\|2430516_2431467_-\|transposase	transposase	NA	NA	NA	NA
WP_155079476.1\|2431482_2431869_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2431852_2432410_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080174.1\|2432538_2433081_-	hypothetical protein	NA	NA	NA	NA
WP_155080872.1\|2433612_2434098_-	RepB family plasmid replication initiator protein	NA	NA	NA	NA
WP_155589586.1\|2434198_2435351_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.8e-59	44.5
WP_155080873.1\|2435360_2435618_-	hypothetical protein	NA	NA	NA	NA
WP_155080874.1\|2435843_2436665_-	hypothetical protein	NA	NA	NA	NA
WP_155080875.1\|2437052_2437328_-	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|2438201_2439087_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080876.1\|2439047_2439626_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|2439728_2440079_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|2440110_2440563_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080877.1\|2440557_2441136_-	hypothetical protein	NA	NA	NA	NA
WP_155079906.1\|2441183_2441456_-	hypothetical protein	NA	NA	NA	NA
WP_155080878.1\|2441433_2441577_+	phosphatase	NA	NA	NA	NA
WP_155079741.1\|2442236_2443211_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155079971.1\|2443555_2443726_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|2443652_2444003_-\|transposase	transposase	NA	NA	NA	NA
WP_155080879.1\|2444064_2444832_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_28

2453451 : 2503801

Acinetobacter_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080885.1\|2453451_2454045_-\|transposase	transposase	NA	NA	NA	NA
WP_155080886.1\|2454327_2454792_-	hypothetical protein	NA	NA	NA	NA
WP_155079868.1\|2455013_2456170_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155080887.1\|2456412_2456715_-	hypothetical protein	NA	NA	NA	NA
WP_155080888.1\|2457124_2457451_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2457482_2457935_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066610.1\|2458388_2458964_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079588.1\|2458909_2459275_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080889.1\|2459662_2460268_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2460227_2460614_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2460597_2461155_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2461161_2461548_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080890.1\|2461667_2462306_+	queuosine precursor transporter	NA	NA	NA	NA
WP_155080891.1\|2462330_2462897_+	hypothetical protein	NA	NA	NA	NA
WP_155080892.1\|2462905_2464138_+	ATP-grasp domain-containing protein	NA	NA	NA	NA
WP_155066960.1\|2464225_2465662_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155066956.1\|2465886_2467134_-	LbtU family siderophore porin	NA	NA	NA	NA
WP_036773927.1\|2467569_2468205_-	peroxiredoxin C	NA	NA	NA	NA
WP_155080893.1\|2468757_2470260_+	sodium/proline symporter PutP	NA	NA	NA	NA
WP_155080894.1\|2470246_2474083_+	bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase PutA	NA	NA	NA	NA
WP_155080895.1\|2474231_2475410_+	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	1.2e-50	31.9
WP_016210416.1\|2475482_2476013_-	prokaryotic cytochrome b561 family protein	NA	NA	NA	NA
WP_155079476.1\|2476289_2476676_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080896.1\|2476737_2476980_+	hypothetical protein	NA	NA	NA	NA
WP_155080897.1\|2477160_2477361_+	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|2477369_2477822_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2477853_2478204_-\|transposase	transposase	NA	NA	NA	NA
WP_155080898.1\|2478728_2479250_-	hypothetical protein	NA	NA	NA	NA
WP_155079487.1\|2479636_2480686_-\|transposase	transposase	NA	NA	NA	NA
WP_155080899.1\|2480700_2481021_-	hypothetical protein	NA	NA	NA	NA
WP_155066949.1\|2481651_2482788_+	competence/damage-inducible protein A	NA	NA	NA	NA
WP_155080900.1\|2482806_2484762_-	HAD-IC family P-type ATPase	M1HK51	Paramecium_bursaria_Chlorella_virus	2.7e-55	29.4
WP_155079476.1\|2484777_2485164_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2485147_2485705_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066948.1\|2486664_2487840_-	outer membrane transport family protein	NA	NA	NA	NA
WP_155080901.1\|2488177_2489434_-	hypothetical protein	NA	NA	NA	NA
WP_155080902.1\|2489511_2490753_-	hypothetical protein	NA	NA	NA	NA
WP_155080903.1\|2490849_2491347_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066610.1\|2491292_2491868_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080904.1\|2491871_2492594_-	hypothetical protein	NA	NA	NA	NA
WP_155080905.1\|2492974_2493949_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155080906.1\|2493972_2494470_+	hypothetical protein	NA	NA	NA	NA
WP_155080907.1\|2494650_2495130_+	hypothetical protein	NA	NA	NA	NA
WP_155080908.1\|2495400_2495736_+	hypothetical protein	NA	NA	NA	NA
WP_155080909.1\|2495811_2496279_-	hypothetical protein	NA	NA	NA	NA
WP_155080910.1\|2496254_2496431_+	hypothetical protein	NA	NA	NA	NA
WP_155068662.1\|2497115_2497184_-	hypothetical protein	NA	NA	NA	NA
WP_155079627.1\|2497339_2498377_+\|transposase	transposase	NA	NA	NA	NA
WP_155080912.1\|2498657_2500100_-	MFS transporter	NA	NA	NA	NA
WP_155068661.1\|2500613_2502035_+	sodium:proton antiporter	NA	NA	NA	NA
WP_155080913.1\|2502521_2502968_+	hypothetical protein	NA	NA	NA	NA
WP_155080914.1\|2503144_2503801_-\|transposase	IS1595 family transposase	NA	NA	NA	NA

DBSCAN-SWA_29

2525844 : 2568666

unidentified_phage(16.67%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080927.1\|2525844_2526585_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.2e-22	35.1
WP_155589588.1\|2526758_2527703_+	hypothetical protein	NA	NA	NA	NA
WP_155080929.1\|2529584_2530463_+\|transposase	transposase	NA	NA	NA	NA
WP_054300641.1\|2530484_2530850_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080930.1\|2530906_2531221_+	hypothetical protein	NA	NA	NA	NA
WP_155080931.1\|2531401_2531659_+	hypothetical protein	NA	NA	NA	NA
WP_155080932.1\|2531837_2532323_+	hypothetical protein	NA	NA	NA	NA
WP_155080933.1\|2532434_2533949_-	D-alanyl-D-alanine carboxypeptidase	NA	NA	NA	NA
WP_155080934.1\|2534075_2535104_+	UDP-glucose--hexose-1-phosphate uridylyltransferase	NA	NA	NA	NA
WP_155081551.1\|2535160_2536303_+	galactokinase	NA	NA	NA	NA
WP_155080935.1\|2536436_2538140_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.3e-21	25.0
WP_155080936.1\|2538136_2540257_+	ATP-binding cassette domain-containing protein	F2Y1V5	Organic_Lake_phycodnavirus	2.0e-16	27.0
WP_155080937.1\|2540253_2541603_+	HlyD family type I secretion periplasmic adaptor subunit	NA	NA	NA	NA
WP_155080938.1\|2541574_2543722_-	EAL domain-containing protein	G3MA91	Bacillus_virus	2.4e-25	36.2
WP_155080939.1\|2544126_2544279_-	hypothetical protein	NA	NA	NA	NA
WP_155080940.1\|2544309_2544852_-	hypothetical protein	NA	NA	NA	NA
WP_155080941.1\|2544827_2544974_+	hypothetical protein	NA	NA	NA	NA
WP_155079887.1\|2544948_2545491_-	hypothetical protein	NA	NA	NA	NA
WP_155066469.1\|2545576_2545849_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|2546191_2546542_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2546573_2547026_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080942.1\|2547221_2547617_+	CrcB family protein	NA	NA	NA	NA
WP_155080943.1\|2547625_2548510_-	lipid A biosynthesis acyltransferase	A0A1W6JP29	Morganella_phage	2.2e-41	36.0
WP_155080944.1\|2548542_2550441_-	peptidyl-prolyl cis-trans isomerase SurA	NA	NA	NA	NA
WP_016209655.1\|2550523_2550796_-	HU family DNA-binding protein	A4JWM7	Burkholderia_virus	2.0e-22	62.9
WP_155066897.1\|2550899_2553332_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	1.6e-219	52.7
WP_016209663.1\|2553399_2554701_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.5e-134	57.3
WP_016209647.1\|2554782_2555388_-	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	8.4e-61	59.8
WP_155066896.1\|2555500_2556805_-	trigger factor	NA	NA	NA	NA
WP_155080945.1\|2557406_2558282_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	6.8e-35	39.4
WP_155080946.1\|2558396_2558897_-	DUF45 domain-containing protein	NA	NA	NA	NA
WP_155066936.1\|2558978_2559329_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2559360_2559813_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081552.1\|2559807_2560020_-	DUF45 domain-containing protein	NA	NA	NA	NA
WP_155080947.1\|2560073_2560232_+	phosphatase	NA	NA	NA	NA
WP_155080948.1\|2560450_2561806_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_155080949.1\|2561926_2562664_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_155080950.1\|2562741_2563455_-	aldolase	NA	NA	NA	NA
WP_155080951.1\|2564106_2565381_+	MFS transporter	NA	NA	NA	NA
WP_155080952.1\|2565411_2565987_+	bleomycin resistance protein	NA	NA	NA	NA
WP_155080953.1\|2566032_2566998_-	aldo/keto reductase	A0A2H4PQR8	Staphylococcus_phage	1.1e-43	37.8
WP_155079445.1\|2567691_2568666_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3

DBSCAN-SWA_30

2594753 : 2625136

Burkholderia_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|2594753_2595311_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589589.1\|2595307_2595919_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2595878_2596265_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2596248_2596806_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2596986_2597373_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2597356_2597914_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080967.1\|2597910_2598309_-	hypothetical protein	NA	NA	NA	NA
WP_155080968.1\|2598657_2598954_-	hypothetical protein	NA	NA	NA	NA
WP_155080969.1\|2599193_2599406_+	hypothetical protein	NA	NA	NA	NA
WP_155080161.1\|2599326_2599542_-	hypothetical protein	NA	NA	NA	NA
WP_155067835.1\|2599598_2599766_-	hypothetical protein	NA	NA	NA	NA
WP_155080970.1\|2599690_2599981_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066863.1\|2600197_2600653_+	hypothetical protein	NA	NA	NA	NA
WP_155080971.1\|2600727_2601639_+\|transposase	transposase	NA	NA	NA	NA
WP_155079826.1\|2601674_2602560_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080205.1\|2602589_2602736_+	hypothetical protein	NA	NA	NA	NA
WP_016210741.1\|2602830_2603154_+	late competence development ComFB family protein	NA	NA	NA	NA
WP_155066862.1\|2603160_2607057_-	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	2.0e-118	54.4
WP_155589590.1\|2607102_2607657_-\|tRNA	tRNA adenosine(34) deaminase TadA	NA	NA	NA	NA
WP_155080973.1\|2607697_2609278_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	8.8e-17	26.8
WP_155066859.1\|2609346_2610804_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	6.5e-99	42.3
WP_155081556.1\|2611248_2613207_-	hypothetical protein	NA	NA	NA	NA
WP_155066857.1\|2613525_2614146_-	DUF2272 domain-containing protein	NA	NA	NA	NA
WP_155080974.1\|2614312_2614537_-	hypothetical protein	NA	NA	NA	NA
WP_155080975.1\|2615094_2615343_-	hypothetical protein	NA	NA	NA	NA
WP_155080976.1\|2615263_2616070_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	3.1e-10	30.0
WP_155079487.1\|2616589_2617639_-\|transposase	transposase	NA	NA	NA	NA
WP_155080977.1\|2618069_2619119_-\|transposase	transposase	NA	NA	NA	NA
WP_155068734.1\|2619189_2619759_-	hypothetical protein	NA	NA	NA	NA
WP_155080978.1\|2619989_2620394_+	SufE family protein	NA	NA	NA	NA
WP_017377024.1\|2620406_2620547_-	hypothetical protein	NA	NA	NA	NA
WP_051929560.1\|2620641_2621841_+	site-specific DNA-methyltransferase	A0A2L1IZ21	Streptomyces_phage	2.7e-42	33.2
WP_155080979.1\|2621861_2622473_+	trimeric intracellular cation channel family protein	NA	NA	NA	NA
WP_155080980.1\|2622674_2623436_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155079612.1\|2623906_2625136_+\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_31

2633977 : 2744200

113

unidentified_phage(21.74%)

tRNA,integrase,transposase

attL 2694180:2694239|attR 2731399:2732504

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079461.1\|2633977_2634952_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	7.5e-27	31.3
WP_155081560.1\|2635082_2636177_-	FUSC family protein	NA	NA	NA	NA
WP_155067817.1\|2636301_2637618_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	9.4e-65	39.6
WP_155080988.1\|2637672_2642559_-	NAD-glutamate dehydrogenase	NA	NA	NA	NA
WP_155081561.1\|2642651_2642954_-	DUF2835 family protein	NA	NA	NA	NA
WP_155067819.1\|2643064_2644987_+	PrkA family serine protein kinase	NA	NA	NA	NA
WP_155067820.1\|2645008_2646304_+	DUF444 family protein	A0A219UQP6	Bacillus_phage	1.2e-06	32.8
WP_155080989.1\|2646300_2647923_+	SpoVR family protein	NA	NA	NA	NA
WP_155080990.1\|2648029_2648296_-	hypothetical protein	NA	NA	NA	NA
WP_155067925.1\|2648395_2649091_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	5.5e-40	43.9
WP_155081562.1\|2649244_2649943_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex dimerization subunit type 1 TsaB	NA	NA	NA	NA
WP_155080991.1\|2650089_2650659_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_155080992.1\|2650942_2651569_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_155079974.1\|2652308_2652674_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079975.1\|2652619_2653195_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080993.1\|2653269_2654145_-\|transposase	IS982 family transposase	NA	NA	NA	NA
WP_155080994.1\|2654233_2654947_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	7.9e-42	40.8
WP_155080995.1\|2654943_2655210_-\|transposase	transposase	NA	NA	NA	NA
WP_155081563.1\|2655244_2655505_+\|transposase	transposase	NA	NA	NA	NA
WP_155080996.1\|2655527_2655830_-	hypothetical protein	NA	NA	NA	NA
WP_155068097.1\|2655756_2656107_-\|transposase	transposase	NA	NA	NA	NA
WP_155067839.1\|2657663_2658503_-	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	I6XGV6	Vibriophage	1.8e-32	34.9
WP_016210463.1\|2658553_2658901_-	cupin domain-containing protein	A0A1V0SH58	Hokovirus	9.2e-20	42.1
WP_155080997.1\|2659091_2659979_+	ROK family protein	NA	NA	NA	NA
WP_155080998.1\|2660093_2660696_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_155080999.1\|2660692_2661412_-	TIGR00266 family protein	NA	NA	NA	NA
WP_080963631.1\|2661480_2663193_-	ABC transporter ATP-binding protein/permease	NA	NA	NA	NA
WP_155079478.1\|2664639_2665197_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2665180_2665567_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081564.1\|2666256_2667306_+	A/G-specific adenine glycosylase	NA	NA	NA	NA
WP_155067844.1\|2667305_2667581_+	oxidative damage protection protein	NA	NA	NA	NA
WP_155081000.1\|2668639_2671231_-	bifunctional acetaldehyde-CoA/alcohol dehydrogenase	NA	NA	NA	NA
WP_155066936.1\|2671554_2671905_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|2671936_2672389_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081002.1\|2672671_2673214_-	hypothetical protein	NA	NA	NA	NA
WP_155079888.1\|2673189_2673336_+	hypothetical protein	NA	NA	NA	NA
WP_155080210.1\|2673310_2673631_-	hypothetical protein	NA	NA	NA	NA
WP_155081003.1\|2673709_2673853_-	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|2673922_2674808_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081005.1\|2676028_2677054_-	hypothetical protein	NA	NA	NA	NA
WP_155081006.1\|2677309_2677579_-	hypothetical protein	NA	NA	NA	NA
WP_155081007.1\|2677853_2678777_+	hypothetical protein	NA	NA	NA	NA
WP_155067849.1\|2678790_2679714_+	PAS domain-containing protein	NA	NA	NA	NA
WP_155081008.1\|2679661_2680279_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|2681792_2682350_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2682333_2682720_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081009.1\|2682752_2682896_+	hypothetical protein	NA	NA	NA	NA
WP_155081010.1\|2684501_2685329_+	class II glutamine amidotransferase	NA	NA	NA	NA
WP_155081011.1\|2685480_2685852_+	hypothetical protein	NA	NA	NA	NA
WP_155068743.1\|2686080_2687577_+	nuclease	NA	NA	NA	NA
WP_155081012.1\|2687639_2688977_-	N-succinylarginine dihydrolase	NA	NA	NA	NA
WP_155081013.1\|2689119_2690586_-	succinylglutamate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_155081014.1\|2690582_2691632_-	arginine N-succinyltransferase	NA	NA	NA	NA
WP_155080516.1\|2693582_2693747_+	hypothetical protein	NA	NA	NA	NA
WP_155081015.1\|2694030_2694219_+	hypothetical protein	NA	NA	NA	NA
2694180:2694239	attL	NA	NA	NA	NA
WP_155079445.1\|2694215_2695190_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155080465.1\|2695296_2695617_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2695907_2696294_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2696277_2696835_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081016.1\|2696875_2697052_+	hypothetical protein	NA	NA	NA	NA
WP_016210305.1\|2697181_2697586_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_016210308.1\|2697646_2698372_-	ribonuclease PH	NA	NA	NA	NA
WP_155081017.1\|2698457_2699351_+	YicC family protein	NA	NA	NA	NA
WP_155067858.1\|2699391_2700012_+	guanylate kinase	A0A143DIC6	Abalone_herpesvirus	4.8e-19	35.1
WP_016210310.1\|2700072_2700279_+	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_155081018.1\|2700300_2702445_+	RelA/SpoT family protein	A0A2I2L310	Orpheovirus	1.0e-12	37.1
WP_155081019.1\|2702462_2702600_-	hypothetical protein	NA	NA	NA	NA
WP_155079741.1\|2702856_2703831_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155081020.1\|2703907_2704111_-	hypothetical protein	NA	NA	NA	NA
WP_155081021.1\|2705191_2705551_+	hypothetical protein	NA	NA	NA	NA
WP_155080546.1\|2705632_2706361_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.1e-43	41.8
WP_155081022.1\|2706403_2706679_-	hypothetical protein	NA	NA	NA	NA
WP_155081023.1\|2706987_2708229_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|2709443_2710001_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2709984_2710371_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2711155_2711713_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2711696_2712083_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081024.1\|2712554_2713478_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.2e-23	39.9
WP_155081025.1\|2713678_2713864_+	hypothetical protein	NA	NA	NA	NA
WP_155081026.1\|2713947_2714760_+\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155079476.1\|2714756_2715143_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2715126_2715684_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081027.1\|2715691_2716069_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155081565.1\|2716200_2716683_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081533.1\|2717096_2717549_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080581.1\|2717580_2717835_-\|transposase	transposase	NA	NA	NA	NA
WP_155080582.1\|2717856_2718063_-	hypothetical protein	NA	NA	NA	NA
WP_155080172.1\|2718355_2719330_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-28	31.0
WP_155067098.1\|2719388_2719709_+	hypothetical protein	NA	NA	NA	NA
WP_155066610.1\|2719654_2720230_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067869.1\|2720726_2721746_-	thiamine-phosphate kinase	NA	NA	NA	NA
WP_017376520.1\|2721732_2722155_-	transcription antitermination factor NusB	NA	NA	NA	NA
WP_155067870.1\|2722156_2722630_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.1e-27	43.4
WP_155081028.1\|2722737_2723361_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	1.0e-40	45.1
WP_155081029.1\|2723391_2724066_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	2.3e-30	37.7
WP_155067873.1\|2724071_2725220_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	6.8e-43	35.4
WP_155067874.1\|2725216_2725678_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_155081030.1\|2725775_2727026_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A219Y950	Aeromonas_phage	4.1e-102	54.4
WP_155081031.1\|2727152_2728832_+	energy-dependent translational throttle protein EttA	A0A2K9L3Z8	Tupanvirus	1.3e-37	26.5
WP_155081032.1\|2728942_2729824_-	hypothetical protein	NA	NA	NA	NA
WP_155081033.1\|2730016_2730337_-	hypothetical protein	NA	NA	NA	NA
WP_155081034.1\|2730364_2731108_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|2731434_2732409_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155081035.1\|2732503_2733214_+	methyltransferase domain-containing protein	NA	NA	NA	NA
2731399:2732504	attR	NA	NA	NA	NA
WP_155081036.1\|2733849_2734161_+	hypothetical protein	NA	NA	NA	NA
WP_155081037.1\|2734140_2734539_-	VOC family protein	NA	NA	NA	NA
WP_155067882.1\|2734715_2735021_-	competence protein ComEA	NA	NA	NA	NA
WP_155067883.1\|2735098_2735353_-	DUF1049 domain-containing protein	NA	NA	NA	NA
WP_155081038.1\|2735505_2737167_-	30S ribosomal protein S1	NA	NA	NA	NA
WP_155067885.1\|2737227_2737911_-	(d)CMP kinase	NA	NA	NA	NA
WP_155067886.1\|2737910_2738999_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	9.8e-76	43.6
WP_155081039.1\|2739037_2741674_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	3.4e-98	32.5
WP_155081040.1\|2743314_2744200_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_32

2749388 : 2797869

Halovirus(16.67%)

tRNA,integrase,transposase

attL 2795506:2795565|attR 2796512:2796904

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155066936.1\|2749388_2749739_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2749770_2750223_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067895.1\|2750272_2750617_-	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_155079476.1\|2751929_2752316_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2752299_2752857_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081046.1\|2753430_2754462_+	hypothetical protein	NA	NA	NA	NA
WP_155067902.1\|2754662_2754929_-	hypothetical protein	NA	NA	NA	NA
WP_155067903.1\|2754985_2755333_-	hypothetical protein	NA	NA	NA	NA
WP_155067904.1\|2755367_2756030_-	PAS fold family protein	NA	NA	NA	NA
WP_155081566.1\|2756073_2756676_-	hypothetical protein	NA	NA	NA	NA
WP_122941797.1\|2756905_2757961_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.0e-49	34.7
WP_155067906.1\|2757964_2761150_+	carbamoyl-phosphate synthase (glutamine-hydrolyzing) large subunit	NA	NA	NA	NA
WP_155081047.1\|2761227_2762184_+	aspartate carbamoyltransferase	M1HWF9	Paramecium_bursaria_Chlorella_virus	1.4e-49	39.9
WP_155081048.1\|2762232_2762769_+	orotate phosphoribosyltransferase	NA	NA	NA	NA
WP_155067909.1\|2762765_2763527_+	orotidine-5'-phosphate decarboxylase	NA	NA	NA	NA
WP_155081049.1\|2763629_2766218_-	ATP-dependent chaperone ClpB	K4FB40	Cronobacter_phage	8.8e-123	37.2
WP_155081567.1\|2766934_2767585_-	DUF1669 domain-containing protein	NA	NA	NA	NA
WP_155081050.1\|2767936_2768812_+	hypothetical protein	NA	NA	NA	NA
WP_155067916.1\|2769047_2769449_+	cytidine deaminase	NA	NA	NA	NA
WP_155081051.1\|2769465_2770014_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2770165_2770552_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2770535_2771093_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081052.1\|2771283_2771661_+	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|2772363_2772816_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2772847_2773198_-\|transposase	transposase	NA	NA	NA	NA
WP_155079478.1\|2773400_2773958_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2773941_2774328_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081053.1\|2774324_2774960_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155081054.1\|2775213_2775405_+	hypothetical protein	NA	NA	NA	NA
WP_155081055.1\|2775405_2777616_-	hypothetical protein	NA	NA	NA	NA
WP_155080005.1\|2777723_2778610_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2779665_2780052_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081056.1\|2780035_2780593_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081568.1\|2780595_2780856_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2780850_2781303_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|2781334_2781685_-\|transposase	transposase	NA	NA	NA	NA
WP_155081057.1\|2783110_2783584_-	hypothetical protein	NA	NA	NA	NA
WP_155081058.1\|2784116_2785064_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081059.1\|2785244_2785634_+	hypothetical protein	NA	NA	NA	NA
WP_155081060.1\|2785819_2787112_-	MFS transporter	NA	NA	NA	NA
WP_155081061.1\|2787438_2789502_+\|tRNA	methionine--tRNA ligase	A0A1V0S905	Catovirus	5.5e-35	26.2
WP_155081062.1\|2789504_2790152_+	RnfABCDGE type electron transport complex subunit B	NA	NA	NA	NA
WP_017376743.1\|2790167_2790800_+	endonuclease III	NA	NA	NA	NA
WP_155067929.1\|2790868_2791306_+	DUF1841 family protein	NA	NA	NA	NA
WP_155079889.1\|2791547_2792090_-	hypothetical protein	NA	NA	NA	NA
WP_155079888.1\|2792065_2792212_+	hypothetical protein	NA	NA	NA	NA
WP_155081063.1\|2792186_2792729_-	hypothetical protein	NA	NA	NA	NA
WP_155081569.1\|2793129_2793285_+	phosphatase	NA	NA	NA	NA
WP_155079445.1\|2793653_2794628_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155085113.1\|2794708_2795500_+\|transposase	IS982 family transposase	NA	NA	NA	NA
2795506:2795565	attL	NA	NA	NA	NA
WP_155067931.1\|2795558_2795825_+\|transposase	transposase	NA	NA	NA	NA
WP_155081064.1\|2795899_2796511_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	S5WIU1	Leptospira_phage	1.1e-36	42.3
WP_155081065.1\|2797680_2797869_+\|transposase	transposase	NA	NA	NA	NA
2796512:2796904	attR	NA	NA	NA	NA

DBSCAN-SWA_33

2810550 : 2852742

Planktothrix_phage(25.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079741.1\|2810550_2811525_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155067948.1\|2811721_2812501_-	FKBP-type peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_155081073.1\|2817990_2818191_-	hypothetical protein	NA	NA	NA	NA
WP_155081074.1\|2818416_2819334_-\|transposase	transposase	NA	NA	NA	NA
WP_155066800.1\|2819678_2820365_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066799.1\|2820429_2821716_-	na+ dependent nucleoside transporter family protein	NA	NA	NA	NA
WP_155066739.1\|2821872_2822223_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|2822254_2822707_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_017376633.1\|2822940_2823210_-	RNA-binding protein	NA	NA	NA	NA
WP_155081075.1\|2823394_2824372_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.7e-15	31.0
WP_155066797.1\|2824432_2825407_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.3e-14	31.8
WP_155066796.1\|2825506_2826583_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_155081076.1\|2826663_2827650_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_155066795.1\|2827660_2829463_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_155066794.1\|2829477_2830779_-	aspartate kinase	NA	NA	NA	NA
WP_155066793.1\|2830794_2832078_-	diaminopimelate decarboxylase	NA	NA	NA	NA
WP_155081077.1\|2832210_2832600_+	RidA family protein	NA	NA	NA	NA
WP_155081078.1\|2832704_2833886_-	hypothetical protein	NA	NA	NA	NA
WP_155066790.1\|2834074_2835091_-	bifunctional UDP-4-keto-pentose/UDP-xylose synthase	D5GW02	Campylobacter_virus	3.2e-12	26.1
WP_155066789.1\|2835093_2836101_-	glycosyltransferase	B9UDL7	Salmonella_phage	1.1e-36	34.2
WP_155081570.1\|2836104_2837259_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A2K9L0G1	Tupanvirus	8.6e-38	32.1
WP_016209558.1\|2837273_2837636_-	small Multidrug Resistance family protein	NA	NA	NA	NA
WP_155081079.1\|2837632_2839348_-	hypothetical protein	NA	NA	NA	NA
WP_155081080.1\|2839411_2840122_+\|tRNA	tRNA (guanosine(18)-2'-O)-methyltransferase TrmH	NA	NA	NA	NA
WP_017376619.1\|2840150_2840555_+	RidA family protein	NA	NA	NA	NA
WP_155081571.1\|2841959_2843141_-	MFS transporter	NA	NA	NA	NA
WP_155080465.1\|2843202_2843523_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|2843541_2844099_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|2844082_2844469_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080667.1\|2844487_2844640_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2844701_2845088_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081081.1\|2845825_2846836_+	DUF475 domain-containing protein	A0A172Q0Y5	Acinetobacter_phage	6.6e-58	41.6
WP_155079612.1\|2847864_2849094_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081082.1\|2849290_2849584_-\|transposase	transposase	NA	NA	NA	NA
WP_155080320.1\|2849649_2850705_+\|transposase	transposase	NA	NA	NA	NA
WP_155079868.1\|2851586_2852742_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4

DBSCAN-SWA_34

2868165 : 2924588

Bacillus_virus(14.29%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081058.1\|2868165_2869113_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081092.1\|2869293_2869683_+	hypothetical protein	NA	NA	NA	NA
WP_155081093.1\|2870334_2870664_-	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_155081575.1\|2870897_2871602_+	purine-nucleoside phosphorylase	NA	NA	NA	NA
WP_155081094.1\|2871582_2873811_-	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	3.4e-83	35.2
WP_155066766.1\|2873975_2874989_-	quinone-dependent dihydroorotate dehydrogenase	NA	NA	NA	NA
WP_155066765.1\|2875096_2875318_-	hypothetical protein	NA	NA	NA	NA
WP_155066764.1\|2875322_2876960_-	NAD+ synthase	A0A2L0UZF5	Agrobacterium_phage	4.4e-88	37.8
WP_155066763.1\|2877098_2877632_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_155081095.1\|2877752_2878871_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_155081096.1\|2878863_2880186_+	hypothetical protein	NA	NA	NA	NA
WP_155066756.1\|2880172_2881309_+	hypothetical protein	NA	NA	NA	NA
WP_155066755.1\|2881539_2881965_+	hypothetical protein	NA	NA	NA	NA
WP_155080389.1\|2884250_2884553_+	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|2884920_2885373_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066753.1\|2885677_2886031_-	hypothetical protein	NA	NA	NA	NA
WP_155068648.1\|2886094_2886499_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_155081097.1\|2886646_2887822_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_155081576.1\|2888370_2888874_-	peptide deformylase	A0A1D8KUY1	Synechococcus_phage	6.2e-09	32.8
WP_155081098.1\|2888913_2890398_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.5e-45	28.0
WP_155066747.1\|2890620_2891574_+	response regulator	Q56AR1	Bacillus_thuringiensis_phage	3.8e-31	27.9
WP_155066746.1\|2891554_2892646_-	AI-2E family transporter	NA	NA	NA	NA
WP_155081099.1\|2892733_2892976_-	response regulator SirA	NA	NA	NA	NA
WP_155068647.1\|2893592_2893931_-	hypothetical protein	NA	NA	NA	NA
WP_155081100.1\|2893927_2894503_-	hypothetical protein	NA	NA	NA	NA
WP_155081101.1\|2895075_2895348_+	hypothetical protein	NA	NA	NA	NA
WP_155068646.1\|2895501_2895756_-	DUF493 family protein	NA	NA	NA	NA
WP_155081102.1\|2895870_2897274_-	hypothetical protein	NA	NA	NA	NA
WP_155081103.1\|2897401_2897626_-	hypothetical protein	NA	NA	NA	NA
WP_155081577.1\|2897690_2898191_-	hypothetical protein	NA	NA	NA	NA
WP_155081104.1\|2898756_2900574_+	hypothetical protein	NA	NA	NA	NA
WP_155081105.1\|2900643_2901693_-\|transposase	transposase	NA	NA	NA	NA
WP_155081106.1\|2901779_2902382_-	hypothetical protein	NA	NA	NA	NA
WP_064006185.1\|2903933_2904650_+	hypothetical protein	NA	NA	NA	NA
WP_155081107.1\|2905383_2905623_-	hypothetical protein	NA	NA	NA	NA
WP_155066739.1\|2905549_2905900_-\|transposase	transposase	NA	NA	NA	NA
WP_155081108.1\|2907262_2907871_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155081109.1\|2909038_2911027_-	hypothetical protein	NA	NA	NA	NA
WP_155081110.1\|2912296_2913100_-	hypothetical protein	NA	NA	NA	NA
WP_155081111.1\|2913268_2914708_-	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|2915054_2916104_+\|transposase	transposase	NA	NA	NA	NA
WP_155081112.1\|2916604_2917570_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_155066693.1\|2917523_2918219_-	ATP-binding cassette domain-containing protein	W5SAS9	Pithovirus	3.5e-10	27.4
WP_155079476.1\|2918827_2919214_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2919197_2919755_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081113.1\|2919813_2920188_+	hypothetical protein	NA	NA	NA	NA
WP_155066695.1\|2920281_2920839_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155079815.1\|2921566_2922541_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.0e-28	31.2
WP_155081114.1\|2922587_2922866_+	hypothetical protein	NA	NA	NA	NA
WP_155081115.1\|2923164_2923386_+	hypothetical protein	NA	NA	NA	NA
WP_155081116.1\|2923414_2923555_+	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|2923538_2924588_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_35

2930258 : 3039640

118

unidentified_phage(35.71%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079741.1\|2930258_2931233_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.0e-27	31.3
WP_155081122.1\|2931327_2931642_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|2932024_2932411_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2932394_2932952_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081123.1\|2933629_2934061_+	hypothetical protein	NA	NA	NA	NA
WP_155081124.1\|2934138_2934423_-	copper chaperone PCu(A)C	NA	NA	NA	NA
WP_155081125.1\|2934455_2935505_-\|transposase	transposase	NA	NA	NA	NA
WP_155068639.1\|2938521_2938923_+	hypothetical protein	NA	NA	NA	NA
WP_155066706.1\|2938915_2939929_+	ATP-binding cassette domain-containing protein	A0A2H4PQG7	Staphylococcus_phage	1.4e-15	28.4
WP_155066707.1\|2939915_2940704_+	ABC transporter permease	NA	NA	NA	NA
WP_155081126.1\|2940897_2941869_+	DUF481 domain-containing protein	NA	NA	NA	NA
WP_155081127.1\|2941881_2942349_-	CBS domain-containing protein	NA	NA	NA	NA
WP_155066936.1\|2942613_2942964_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|2942995_2943448_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081128.1\|2943627_2944998_-	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	2.9e-109	44.8
WP_155081129.1\|2945301_2945772_+	Hsp20 family protein	A0A1B1IW69	uncultured_Mediterranean_phage	1.6e-22	37.3
WP_155079490.1\|2945987_2946962_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.3e-28	31.5
WP_155081578.1\|2947748_2948699_+	hypothetical protein	NA	NA	NA	NA
WP_155081130.1\|2948973_2951139_+	hypothetical protein	NA	NA	NA	NA
WP_155081131.1\|2951586_2952561_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-28	31.0
WP_155081132.1\|2952606_2952801_+	hypothetical protein	NA	NA	NA	NA
WP_155079974.1\|2953313_2953679_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080686.1\|2953624_2954200_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080208.1\|2954686_2955052_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081133.1\|2955108_2955348_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|2955409_2956295_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081134.1\|2956307_2956622_+	hypothetical protein	NA	NA	NA	NA
WP_155080716.1\|2956709_2957891_+\|transposase	transposase	NA	NA	NA	NA
WP_155081137.1\|2958076_2958226_+	phosphatase	NA	NA	NA	NA
WP_155085104.1\|2959327_2960557_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081139.1\|2961145_2963833_+	aconitate hydratase AcnA	NA	NA	NA	NA
WP_155066714.1\|2963937_2964363_-	hypothetical protein	NA	NA	NA	NA
WP_155066716.1\|2965007_2965847_+	hypothetical protein	NA	NA	NA	NA
WP_155081140.1\|2965849_2967043_+	conjugal transfer protein TrbI	NA	NA	NA	NA
WP_155081141.1\|2967048_2968029_+	hypothetical protein	NA	NA	NA	NA
WP_155081142.1\|2968044_2969082_+	hypothetical protein	NA	NA	NA	NA
WP_155081143.1\|2969096_2969519_+	hypothetical protein	NA	NA	NA	NA
WP_155066721.1\|2969571_2970075_+	DotD/TraH family lipoprotein	NA	NA	NA	NA
WP_155066722.1\|2970067_2970814_+	type IV secretion system protein DotC	NA	NA	NA	NA
WP_155066723.1\|2970806_2971913_+	ATPase	NA	NA	NA	NA
WP_027242627.1\|2971933_2972173_+	hypothetical protein	NA	NA	NA	NA
WP_155081579.1\|2972201_2974505_+	TraM recognition domain-containing protein	NA	NA	NA	NA
WP_155081144.1\|2974513_2974987_+	hypothetical protein	NA	NA	NA	NA
WP_155066725.1\|2974995_2976039_+	type IVB secretion system coupling complex protein DotM/IcmP	NA	NA	NA	NA
WP_027242623.1\|2976038_2976620_+	hypothetical protein	NA	NA	NA	NA
WP_155081145.1\|2976651_2977077_+	hypothetical protein	NA	NA	NA	NA
WP_155081146.1\|2977079_2980088_+	AAA family ATPase	NA	NA	NA	NA
WP_155081147.1\|2980089_2980911_+	hypothetical protein	NA	NA	NA	NA
WP_155081148.1\|2980950_2984166_+	DotA/TraY family protein	NA	NA	NA	NA
WP_155081149.1\|2984210_2984717_+	hypothetical protein	NA	NA	NA	NA
WP_027242618.1\|2985036_2985687_+	hypothetical protein	NA	NA	NA	NA
WP_016209685.1\|2985688_2986024_+	hypothetical protein	NA	NA	NA	NA
WP_155081150.1\|2986028_2986439_+	hypothetical protein	NA	NA	NA	NA
WP_155081580.1\|2986429_2987383_+	PAP2 family protein	NA	NA	NA	NA
WP_155066732.1\|2987452_2987680_+	hypothetical protein	NA	NA	NA	NA
WP_155081151.1\|2987828_2989244_-	hypothetical protein	NA	NA	NA	NA
WP_155081152.1\|2989490_2990075_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-35	46.8
WP_155081153.1\|2990261_2990627_-\|transposase	IS3 family transposase	NA	NA	NA	NA
WP_155079476.1\|2990642_2991029_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2991012_2991570_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080338.1\|2991605_2991893_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3
WP_155081154.1\|2992023_2992743_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155080205.1\|2994304_2994451_-	hypothetical protein	NA	NA	NA	NA
WP_155081155.1\|2994565_2994934_+	hypothetical protein	NA	NA	NA	NA
WP_155081156.1\|2995078_2995774_+\|transposase	transposase	NA	NA	NA	NA
WP_155081157.1\|2995766_2996926_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	6.8e-59	44.5
WP_155079476.1\|2996921_2997308_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|2997291_2997849_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155067468.1\|2997961_2998108_+	hypothetical protein	NA	NA	NA	NA
WP_155081158.1\|2998104_2998302_-	hypothetical protein	NA	NA	NA	NA
WP_155081159.1\|2998611_2999283_-	hypothetical protein	NA	NA	NA	NA
WP_155081160.1\|2999902_3000307_+	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|3000383_3001358_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155081161.1\|3001381_3001597_+	hypothetical protein	NA	NA	NA	NA
WP_155080323.1\|3001710_3002610_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.1e-23	31.3
WP_155081162.1\|3003194_3004688_-	amino acid permease	NA	NA	NA	NA
WP_155081163.1\|3005138_3006530_-	class II fumarate hydratase	NA	NA	NA	NA
WP_155081164.1\|3006958_3007153_+	hypothetical protein	NA	NA	NA	NA
WP_155081165.1\|3007195_3007591_+	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|3007595_3008048_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3008079_3008430_-\|transposase	transposase	NA	NA	NA	NA
WP_155079644.1\|3008570_3009161_+\|transposase	transposase	NA	NA	NA	NA
WP_155066687.1\|3009395_3009824_+	DUF4402 domain-containing protein	NA	NA	NA	NA
WP_155589591.1\|3010879_3011419_-	hypothetical protein	NA	NA	NA	NA
WP_155081166.1\|3011615_3012008_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|3012033_3012591_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3012574_3012961_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081167.1\|3012990_3013212_+	hypothetical protein	NA	NA	NA	NA
WP_155081168.1\|3013839_3014481_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155589592.1\|3015098_3016550_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|3016636_3017023_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|3017006_3017564_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081170.1\|3017544_3017763_-	hypothetical protein	NA	NA	NA	NA
WP_155589593.1\|3017816_3017963_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|3018091_3018442_+\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|3018473_3018926_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589594.1\|3018930_3019572_-	hypothetical protein	NA	NA	NA	NA
WP_155081171.1\|3020094_3020955_+	hypothetical protein	NA	NA	NA	NA
WP_155079868.1\|3020882_3022039_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155081172.1\|3022102_3022558_+	hypothetical protein	NA	NA	NA	NA
WP_155080029.1\|3022873_3024001_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081173.1\|3024459_3024705_+	hypothetical protein	NA	NA	NA	NA
WP_155081174.1\|3024849_3025020_+	hypothetical protein	NA	NA	NA	NA
WP_155081175.1\|3025095_3026550_-	hypothetical protein	NA	NA	NA	NA
WP_155081176.1\|3027290_3027989_-	hypothetical protein	NA	NA	NA	NA
WP_155081177.1\|3028081_3028318_-	hypothetical protein	NA	NA	NA	NA
WP_155081178.1\|3028517_3029543_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	2.3e-18	78.8
WP_155081179.1\|3029650_3030856_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	6.4e-36	26.6
WP_155079487.1\|3031062_3032112_-\|transposase	transposase	NA	NA	NA	NA
WP_155068622.1\|3032163_3032616_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3032647_3032998_-\|transposase	transposase	NA	NA	NA	NA
WP_155081180.1\|3033177_3033591_+	hypothetical protein	NA	NA	NA	NA
WP_155081181.1\|3033719_3034289_-	hypothetical protein	NA	NA	NA	NA
WP_155081182.1\|3034292_3034625_-	hypothetical protein	NA	NA	NA	NA
WP_155081183.1\|3034728_3035061_-	hypothetical protein	NA	NA	NA	NA
WP_155081184.1\|3035053_3035707_-	hypothetical protein	NA	NA	NA	NA
WP_155081185.1\|3036345_3037791_-	hypothetical protein	NA	NA	NA	NA
WP_155081186.1\|3038410_3039640_+\|transposase	IS91 family transposase	NA	NA	NA	NA

DBSCAN-SWA_36

3060799 : 3106210

Acinetobacter_phage(23.08%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081198.1\|3060799_3061093_+\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	2.6e-07	39.6
WP_155081199.1\|3061209_3061656_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.0e-22	44.5
WP_155066936.1\|3061721_3062072_+\|transposase	transposase	NA	NA	NA	NA
WP_155081582.1\|3062103_3062571_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079487.1\|3062554_3063604_-\|transposase	transposase	NA	NA	NA	NA
WP_155081200.1\|3063690_3064017_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	6.6e-20	49.5
WP_155081201.1\|3064324_3064621_+	hypothetical protein	NA	NA	NA	NA
WP_155068636.1\|3065196_3065745_-	DUF2058 family protein	NA	NA	NA	NA
WP_155081583.1\|3065848_3066421_-	DNA-3-methyladenine glycosylase I	NA	NA	NA	NA
WP_155081202.1\|3066629_3067388_+	ferredoxin--NADP reductase	NA	NA	NA	NA
WP_155081203.1\|3067947_3068793_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|3068867_3070097_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081204.1\|3070346_3071114_+	hypothetical protein	NA	NA	NA	NA
WP_155081205.1\|3071258_3071531_+	hypothetical protein	NA	NA	NA	NA
WP_155081206.1\|3071741_3073319_+	FMN-binding glutamate synthase family protein	NA	NA	NA	NA
WP_155068634.1\|3073452_3074394_+	hypothetical protein	A0A068C8G6	Acinetobacter_phage	2.3e-20	26.5
WP_155081207.1\|3074395_3075169_+	hypothetical protein	NA	NA	NA	NA
WP_155081208.1\|3075210_3075921_-	acid phosphatase AphA	NA	NA	NA	NA
WP_155081209.1\|3076133_3076337_-	hypothetical protein	NA	NA	NA	NA
WP_155081210.1\|3076605_3076890_+	hypothetical protein	NA	NA	NA	NA
WP_155081211.1\|3076831_3077656_+\|transposase	transposase	NA	NA	NA	NA
WP_155081212.1\|3077764_3078121_+\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|3078106_3079081_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155081213.1\|3079180_3079897_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.6e-24	33.2
WP_155081214.1\|3079941_3080238_-\|transposase	transposase	A0A1P8CWP5	Bacillus_phage	4.5e-07	38.5
WP_155081215.1\|3080206_3080401_-	hypothetical protein	NA	NA	NA	NA
WP_155066611.1\|3080663_3081194_+	YbhB/YbcL family Raf kinase inhibitor-like protein	NA	NA	NA	NA
WP_155068600.1\|3081409_3081634_-	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|3081826_3082279_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3082310_3082661_-\|transposase	transposase	NA	NA	NA	NA
WP_155081216.1\|3082715_3082922_-	hypothetical protein	NA	NA	NA	NA
WP_155067835.1\|3082978_3083146_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|3083178_3083631_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3083662_3084013_-\|transposase	transposase	NA	NA	NA	NA
WP_155080636.1\|3084074_3084260_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_016211707.1\|3084383_3084671_-	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	3.0e-08	33.7
WP_155081217.1\|3084676_3087058_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_017378383.1\|3087070_3088066_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2I2L4E3	Orpheovirus	3.2e-33	36.5
WP_155081218.1\|3088197_3088557_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_016210493.1\|3088599_3088794_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_075273353.1\|3088828_3089359_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.7e-15	33.9
WP_155081219.1\|3089363_3091295_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	7.5e-119	36.3
WP_155081220.1\|3091702_3092437_-\|transposase	transposase	NA	NA	NA	NA
WP_155081221.1\|3092510_3093110_+	hypothetical protein	NA	NA	NA	NA
WP_155081222.1\|3093187_3094168_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	2.6e-27	31.6
WP_155081223.1\|3094191_3094674_+	hypothetical protein	NA	NA	NA	NA
WP_155081224.1\|3094853_3095531_-\|transposase	transposase	NA	NA	NA	NA
WP_155081225.1\|3095538_3095841_-	hypothetical protein	NA	NA	NA	NA
WP_155081226.1\|3095964_3096750_+	hypothetical protein	A0A1V0SBR2	Catovirus	1.1e-07	28.3
WP_155079478.1\|3097774_3098332_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3098315_3098702_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079612.1\|3098998_3100228_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079476.1\|3100844_3101231_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079476.1\|3101259_3101646_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|3101629_3102187_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080171.1\|3102330_3102906_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080011.1\|3102851_3103019_-	hypothetical protein	NA	NA	NA	NA
WP_155081227.1\|3103398_3103539_+	phosphatase	NA	NA	NA	NA
WP_155081228.1\|3103814_3104783_-\|transposase	transposase	NA	NA	NA	NA
WP_155081229.1\|3104903_3105401_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081230.1\|3105709_3106210_+\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_37

3181284 : 3215277

unidentified_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079487.1\|3181284_3182334_+\|transposase	transposase	NA	NA	NA	NA
WP_155081269.1\|3182384_3185054_+	aminopeptidase N	A0A0P0IY26	Acinetobacter_phage	7.9e-18	23.9
WP_155081270.1\|3185353_3186499_+	hypothetical protein	NA	NA	NA	NA
WP_155081271.1\|3186659_3187202_-	hypothetical protein	NA	NA	NA	NA
WP_155081586.1\|3187385_3187610_-	hypothetical protein	NA	NA	NA	NA
WP_155080161.1\|3187766_3187982_-	hypothetical protein	NA	NA	NA	NA
WP_054300641.1\|3188038_3188404_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081272.1\|3189133_3190375_-	hypothetical protein	NA	NA	NA	NA
WP_155085077.1\|3190920_3191709_+	hypothetical protein	NA	NA	NA	NA
WP_155080029.1\|3191905_3193033_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081274.1\|3193225_3193417_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079445.1\|3193476_3194451_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155589597.1\|3194530_3194830_+	hypothetical protein	NA	NA	NA	NA
WP_155066610.1\|3194775_3195351_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081276.1\|3195383_3195554_+	hypothetical protein	NA	NA	NA	NA
WP_155081277.1\|3195760_3197284_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155081278.1\|3197420_3201905_-	autotransporter domain-containing protein	NA	NA	NA	NA
WP_155081279.1\|3202633_3204211_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_155066543.1\|3204438_3204807_+	hypothetical protein	NA	NA	NA	NA
WP_155066542.1\|3205498_3206284_-	hypothetical protein	NA	NA	NA	NA
WP_155081280.1\|3206587_3207532_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_155081281.1\|3207550_3208735_-	acyl-CoA desaturase	NA	NA	NA	NA
WP_155081282.1\|3208850_3209684_+	bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase	A0A127AWE5	Bacillus_phage	3.5e-17	29.7
WP_155066936.1\|3210008_3210359_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|3210390_3210843_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081283.1\|3211246_3211447_-	hypothetical protein	NA	NA	NA	NA
WP_155081284.1\|3211527_3212577_-\|transposase	transposase	NA	NA	NA	NA
WP_155081285.1\|3212619_3212910_-	hypothetical protein	NA	NA	NA	NA
WP_155080172.1\|3213221_3214196_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	8.9e-28	31.0
WP_155081286.1\|3214192_3214681_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|3214719_3215277_-\|transposase	IS630 family transposase	NA	NA	NA	NA

DBSCAN-SWA_38

3221621 : 3429655

219

unidentified_phage(23.08%)

tRNA,protease,transposase,tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081293.1\|3221621_3222575_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.7e-28	31.8
WP_155081294.1\|3222591_3223080_-	amino acid permease	NA	NA	NA	NA
WP_155066529.1\|3223795_3224050_-	hypothetical protein	NA	NA	NA	NA
WP_155081295.1\|3224773_3225970_+	hypothetical protein	NA	NA	NA	NA
WP_155079784.1\|3226044_3226821_+	hypothetical protein	NA	NA	NA	NA
WP_155081296.1\|3227001_3227385_+	hypothetical protein	NA	NA	NA	NA
WP_155080219.1\|3227388_3228438_-\|transposase	transposase	NA	NA	NA	NA
WP_155081297.1\|3228503_3228710_+	hypothetical protein	NA	NA	NA	NA
WP_155081298.1\|3228965_3229673_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|3229738_3230089_+\|transposase	transposase	NA	NA	NA	NA
WP_155081299.1\|3230015_3230231_+	hypothetical protein	NA	NA	NA	NA
WP_155081300.1\|3230847_3231606_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|3231827_3232385_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3232368_3232755_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081301.1\|3232751_3232892_-	hypothetical protein	NA	NA	NA	NA
WP_155066521.1\|3233008_3234307_+	MFS transporter	NA	NA	NA	NA
WP_155081302.1\|3234526_3235078_+	hypothetical protein	NA	NA	NA	NA
WP_155081303.1\|3235058_3235364_+	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|3235372_3235825_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3235856_3236207_-\|transposase	transposase	NA	NA	NA	NA
WP_155081304.1\|3236274_3236724_+	hypothetical protein	NA	NA	NA	NA
WP_155081305.1\|3236757_3238056_+	MFS transporter	NA	NA	NA	NA
WP_155081306.1\|3238145_3239384_-	cysteine desulfurase-like protein	NA	NA	NA	NA
WP_155066517.1\|3239622_3239970_+	DUF4286 family protein	NA	NA	NA	NA
WP_155066516.1\|3239970_3241743_-	single-stranded-DNA-specific exonuclease RecJ	A0A1P8CX07	Bacillus_phage	2.1e-14	25.6
WP_155081307.1\|3241732_3242707_-	hypothetical protein	NA	NA	NA	NA
WP_155066515.1\|3243332_3244025_+	hypothetical protein	NA	NA	NA	NA
WP_155589598.1\|3244882_3245362_+	hypothetical protein	NA	NA	NA	NA
WP_155081309.1\|3245377_3245602_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|3245891_3246866_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155589599.1\|3247235_3248429_+	hypothetical protein	NA	NA	NA	NA
WP_155081310.1\|3248789_3249608_+	hypothetical protein	NA	NA	NA	NA
WP_155081311.1\|3249642_3251070_-	amino acid permease	NA	NA	NA	NA
WP_155081589.1\|3251779_3254149_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.4e-159	35.2
WP_016210132.1\|3254224_3255043_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_155081312.1\|3255505_3256282_+	hypothetical protein	NA	NA	NA	NA
WP_155079487.1\|3256475_3257525_+\|transposase	transposase	NA	NA	NA	NA
WP_155081313.1\|3257521_3257710_-	hypothetical protein	NA	NA	NA	NA
WP_155081531.1\|3257706_3257931_-	hypothetical protein	A0A2P0VP61	Tetraselmis_virus	8.3e-06	45.8
WP_155080161.1\|3258087_3258303_-	hypothetical protein	NA	NA	NA	NA
WP_054300641.1\|3258359_3258725_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081314.1\|3258786_3259554_-\|transposase	transposase	NA	NA	NA	NA
WP_155081315.1\|3259774_3260089_+	hypothetical protein	NA	NA	NA	NA
WP_155081316.1\|3260475_3261363_-	N-acetylneuraminate lyase	NA	NA	NA	NA
WP_155081590.1\|3261519_3262992_-	sodium/solute symporter	A0A219Y9P9	Aeromonas_phage	3.9e-19	23.9
WP_155081317.1\|3263090_3263972_-	ROK family protein	NA	NA	NA	NA
WP_155081318.1\|3263968_3264691_-	putative N-acetylmannosamine-6-phosphate 2-epimerase	NA	NA	NA	NA
WP_155081319.1\|3265165_3266077_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	6.6e-25	31.5
WP_155079784.1\|3266350_3267127_+	hypothetical protein	NA	NA	NA	NA
WP_155081296.1\|3267307_3267691_+	hypothetical protein	NA	NA	NA	NA
WP_155080219.1\|3267694_3268744_-\|transposase	transposase	NA	NA	NA	NA
WP_155081320.1\|3268809_3269016_+	hypothetical protein	NA	NA	NA	NA
WP_155081321.1\|3269339_3269729_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|3269655_3270006_-\|transposase	transposase	NA	NA	NA	NA
WP_155081322.1\|3270304_3271096_-	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_017376546.1\|3271273_3271570_-	hypothetical protein	NA	NA	NA	NA
WP_155081323.1\|3271613_3271901_+	hypothetical protein	NA	NA	NA	NA
WP_155081324.1\|3271930_3272710_-	YchF/TatD family DNA exonuclease	NA	NA	NA	NA
WP_155081591.1\|3272735_3273041_-	pilus assembly protein PilZ	NA	NA	NA	NA
WP_155081325.1\|3273037_3274003_-	DNA polymerase III subunit delta'	S5WKH4	Pseudomonas_phage	9.5e-14	33.1
WP_016210864.1\|3274256_3275555_+	MFS transporter	NA	NA	NA	NA
WP_155081326.1\|3276006_3276867_+	hypothetical protein	NA	NA	NA	NA
WP_155081327.1\|3277011_3277248_+	hypothetical protein	NA	NA	NA	NA
WP_155081328.1\|3277569_3278772_+	hypothetical protein	NA	NA	NA	NA
WP_155081329.1\|3279295_3280939_+	hypothetical protein	NA	NA	NA	NA
WP_016211029.1\|3281015_3281378_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	7.6e-25	50.5
WP_155081330.1\|3281591_3282023_+	protoporphyrinogen oxidase HemJ	NA	NA	NA	NA
WP_016211034.1\|3282034_3282214_-	rubredoxin	NA	NA	NA	NA
WP_155081331.1\|3283110_3283443_-	hypothetical protein	NA	NA	NA	NA
WP_155081332.1\|3283623_3284913_+	glutamate-1-semialdehyde 2,1-aminomutase	NA	NA	NA	NA
WP_155068622.1\|3285112_3285565_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080389.1\|3285932_3286235_-	hypothetical protein	NA	NA	NA	NA
WP_155081333.1\|3287163_3287436_-	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|3287479_3287866_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066936.1\|3287937_3288288_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|3288319_3288772_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080275.1\|3288819_3289323_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080879.1\|3289319_3290087_-\|transposase	transposase	NA	NA	NA	NA
WP_155081334.1\|3291373_3291727_-	hypothetical protein	NA	NA	NA	NA
WP_155081592.1\|3292003_3292780_+	SpoIIE family protein phosphatase	NA	NA	NA	NA
WP_155081335.1\|3292788_3294840_+	protein kinase	A0A2H4UVE2	Bodo_saltans_virus	3.9e-17	28.0
WP_155081336.1\|3294873_3295173_-	hypothetical protein	NA	NA	NA	NA
WP_155079620.1\|3295217_3296192_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155081337.1\|3296188_3296914_-\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155081338.1\|3297013_3297421_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_155081339.1\|3297448_3297979_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_155081340.1\|3298181_3298415_+	hypothetical protein	NA	NA	NA	NA
WP_155081341.1\|3298622_3298898_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081593.1\|3299928_3302106_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.5e-141	45.7
WP_016211609.1\|3302138_3302447_-	double zinc ribbon family protein	NA	NA	NA	NA
WP_155589600.1\|3303461_3303911_+	hypothetical protein	NA	NA	NA	NA
WP_155081343.1\|3304085_3304430_+	hypothetical protein	NA	NA	NA	NA
WP_155068097.1\|3304767_3305118_+\|transposase	transposase	NA	NA	NA	NA
WP_155081491.1\|3305149_3305602_+\|transposase	transposase	NA	NA	NA	NA
WP_155081594.1\|3305759_3306242_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081345.1\|3306256_3306820_+	hypothetical protein	NA	NA	NA	NA
WP_155066464.1\|3306902_3307634_-\|tRNA	tRNA threonylcarbamoyladenosine dehydratase	NA	NA	NA	NA
WP_155068620.1\|3307630_3308167_-	hypothetical protein	NA	NA	NA	NA
WP_155066463.1\|3308220_3308985_-	TatD family deoxyribonuclease	NA	NA	NA	NA
WP_155081346.1\|3308988_3310566_-	peptide chain release factor 3	A0A2K9L6L3	Tupanvirus	3.6e-10	31.4
WP_155066461.1\|3310572_3311049_-	ribosomal-protein-alanine N-acetyltransferase	NA	NA	NA	NA
WP_155068619.1\|3311024_3311429_-	hypothetical protein	NA	NA	NA	NA
WP_155066460.1\|3311461_3312217_-	CDP-diacylglycerol--serine O-phosphatidyltransferase	NA	NA	NA	NA
WP_016210632.1\|3312391_3312679_+	DUF3579 domain-containing protein	NA	NA	NA	NA
WP_155081347.1\|3313100_3313313_-	hypothetical protein	NA	NA	NA	NA
WP_155081348.1\|3313329_3314298_-\|transposase	transposase	NA	NA	NA	NA
WP_155081349.1\|3315224_3316388_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081350.1\|3316422_3317400_-	hypothetical protein	NA	NA	NA	NA
WP_155066456.1\|3317393_3318080_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_155066455.1\|3318018_3319134_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|3319398_3320373_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_155081351.1\|3320824_3321796_-\|transposase	transposase	NA	NA	NA	NA
WP_155081352.1\|3321940_3322147_-	hypothetical protein	A0A0U2RK18	Escherichia_phage	5.7e-09	71.1
WP_155081353.1\|3322062_3322347_-\|transposase	IS1 family transposase	NA	NA	NA	NA
WP_155081354.1\|3322648_3322966_-	hypothetical protein	NA	NA	NA	NA
WP_155066454.1\|3323140_3323413_-	hypothetical protein	NA	NA	NA	NA
WP_155066453.1\|3323668_3324196_-	hypothetical protein	NA	NA	NA	NA
WP_155081103.1\|3324307_3324532_-	hypothetical protein	NA	NA	NA	NA
WP_155589601.1\|3324940_3326158_-	YbfB/YjiJ family MFS transporter	NA	NA	NA	NA
WP_155081356.1\|3326390_3326828_-	hypothetical protein	NA	NA	NA	NA
WP_155589607.1\|3327485_3328892_+	signal recognition particle-docking protein FtsY	NA	NA	NA	NA
WP_155081358.1\|3329155_3330880_-	hypothetical protein	NA	NA	NA	NA
WP_155081359.1\|3330881_3331088_-	hypothetical protein	NA	NA	NA	NA
WP_155081107.1\|3332262_3332502_-	hypothetical protein	NA	NA	NA	NA
WP_155066739.1\|3332428_3332779_-\|transposase	transposase	NA	NA	NA	NA
WP_155081360.1\|3332833_3333859_-	hypothetical protein	NA	NA	NA	NA
WP_155081361.1\|3334480_3336448_+	hypothetical protein	NA	NA	NA	NA
WP_155066438.1\|3336545_3337655_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.0e-35	30.1
WP_155081362.1\|3337710_3339192_-	MFS transporter	A0A0P0IY73	Acinetobacter_phage	3.7e-49	27.6
WP_155066436.1\|3339619_3340066_+	DUF1499 domain-containing protein	NA	NA	NA	NA
WP_016211800.1\|3340379_3341165_-	type III pantothenate kinase	NA	NA	NA	NA
WP_155081363.1\|3341161_3342145_-	biotin--[acetyl-CoA-carboxylase] ligase	NA	NA	NA	NA
WP_155081364.1\|3342201_3343473_-	cation:dicarboxylase symporter family transporter	NA	NA	NA	NA
WP_155081365.1\|3348848_3349454_-	paraquat-inducible protein A	NA	NA	NA	NA
WP_155081595.1\|3349516_3350878_-	signal recognition particle protein	NA	NA	NA	NA
WP_155066432.1\|3351151_3352432_+	DUF21 domain-containing protein	NA	NA	NA	NA
WP_155081366.1\|3352449_3353106_+	DedA family protein	NA	NA	NA	NA
WP_155081367.1\|3353858_3354143_+	hypothetical protein	NA	NA	NA	NA
WP_155081368.1\|3354618_3355473_+	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_155081369.1\|3355771_3356584_+	trfA family protein	NA	NA	NA	NA
WP_016210080.1\|3356690_3356984_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_155067136.1\|3357104_3357455_+\|transposase	transposase	NA	NA	NA	NA
WP_155081370.1\|3357381_3357807_+	hypothetical protein	NA	NA	NA	NA
WP_155079593.1\|3357822_3358029_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|3358059_3358617_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3358600_3358987_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081371.1\|3359562_3360417_-	D-methionine-binding lipoprotein metQ	NA	NA	NA	NA
WP_017377631.1\|3360406_3361084_-	ABC transporter permease	NA	NA	NA	NA
WP_155081372.1\|3361052_3362108_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	5.1e-29	34.7
WP_155081373.1\|3362429_3363860_-	exodeoxyribonuclease I	NA	NA	NA	NA
WP_155081374.1\|3363846_3364473_-	DUF938 domain-containing protein	NA	NA	NA	NA
WP_155081375.1\|3364478_3364751_-	DUF615 domain-containing protein	NA	NA	NA	NA
WP_155081376.1\|3364837_3366631_-	M24 family metallopeptidase	A0A0P0I8D7	Acinetobacter_phage	7.7e-118	40.9
WP_155081596.1\|3366956_3368519_+	amino acid permease	NA	NA	NA	NA
WP_155066421.1\|3368620_3369319_+	response regulator	NA	NA	NA	NA
WP_155066420.1\|3369486_3369984_+	hypothetical protein	NA	NA	NA	NA
WP_155080716.1\|3371768_3372950_+\|transposase	transposase	NA	NA	NA	NA
WP_155081377.1\|3374406_3375801_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_155081378.1\|3375842_3377129_-	phosphoribosylamine--glycine ligase	NA	NA	NA	NA
WP_155081379.1\|3377175_3378720_-	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	2.5e-64	47.2
WP_016209851.1\|3378842_3379085_-	Fis family transcriptional regulator	NA	NA	NA	NA
WP_155081380.1\|3379077_3380064_-\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_155081381.1\|3380125_3381031_-	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_155081382.1\|3381030_3382377_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_155081383.1\|3382470_3382935_-	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_155081597.1\|3382999_3383455_-	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_016209850.1\|3383680_3383971_+	co-chaperone GroES	A0A221S322	uncultured_virus	3.3e-15	42.6
WP_155081384.1\|3384043_3385705_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	3.5e-181	64.5
WP_155081385.1\|3385868_3386090_+	hypothetical protein	NA	NA	NA	NA
WP_155081386.1\|3387292_3387478_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|3387539_3387890_+\|transposase	transposase	NA	NA	NA	NA
WP_155081387.1\|3387816_3388263_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|3388259_3388646_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|3388629_3389187_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066936.1\|3389411_3389762_+\|transposase	transposase	NA	NA	NA	NA
WP_155081465.1\|3389793_3390246_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081391.1\|3391552_3392527_-	phospholipase	NA	NA	NA	NA
WP_155068614.1\|3392671_3394093_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.4e-45	28.1
WP_155081392.1\|3394262_3396179_-	dihydrolipoyllysine-residue acetyltransferase	NA	NA	NA	NA
WP_155081393.1\|3396202_3398872_-	pyruvate dehydrogenase (acetyl-transferring), homodimeric type	NA	NA	NA	NA
WP_016209869.1\|3399138_3400482_-	phosphoglucosamine mutase	NA	NA	NA	NA
WP_155069770.1\|3400691_3402674_-\|protease	ATP-dependent zinc metalloprotease FtsH	G9E4U6	Ostreococcus_lucimarinus_virus	1.8e-115	41.1
WP_155066407.1\|3402751_3403378_-	23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE	NA	NA	NA	NA
WP_155066406.1\|3403355_3403613_-	hypothetical protein	NA	NA	NA	NA
WP_155081394.1\|3403667_3404111_+	CRS1 / YhbY domain protein	NA	NA	NA	NA
WP_155081395.1\|3404355_3405405_-\|transposase	transposase	NA	NA	NA	NA
WP_155079476.1\|3405472_3405859_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|3405842_3406400_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081396.1\|3406380_3406797_-	hypothetical protein	NA	NA	NA	NA
WP_155081397.1\|3406902_3407130_-	hypothetical protein	NA	NA	NA	NA
WP_155589602.1\|3407186_3407435_-	hypothetical protein	NA	NA	NA	NA
WP_155589603.1\|3407579_3407840_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079815.1\|3408034_3409009_+\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.0e-28	31.2
WP_155589604.1\|3409032_3409350_+	hypothetical protein	NA	NA	NA	NA
WP_155066610.1\|3409295_3409871_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081399.1\|3409860_3410091_-\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_155079478.1\|3410246_3410804_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081400.1\|3410787_3411174_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155085165.1\|3411329_3412217_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081402.1\|3412467_3412659_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|3412691_3413078_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|3413061_3413619_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081403.1\|3413896_3415129_+	hypothetical protein	NA	NA	NA	NA
WP_155081404.1\|3415304_3415466_-	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|3415519_3416569_+\|transposase	transposase	NA	NA	NA	NA
WP_155081405.1\|3417062_3417224_+	hypothetical protein	NA	NA	NA	NA
WP_155081406.1\|3417265_3418663_-\|tRNA	asparagine--tRNA ligase	A0A2K9KZD3	Tupanvirus	1.3e-77	36.2
WP_155068509.1\|3418783_3419731_-	P-type conjugative transfer ATPase TrbB	NA	NA	NA	NA
WP_155068510.1\|3419727_3420243_-	signal peptidase, peptidase S26 family protein	NA	NA	NA	NA
WP_155068511.1\|3420229_3421429_-	conjugal transfer protein TrbL	NA	NA	NA	NA
WP_155081407.1\|3421425_3421755_-	hypothetical protein	NA	NA	NA	NA
WP_155068792.1\|3421756_3422986_-	conjugal transfer protein TrbI	NA	NA	NA	NA
WP_155068513.1\|3422985_3424029_-	conjugal transfer protein	NA	NA	NA	NA
WP_155081408.1\|3424028_3424724_-	hypothetical protein	NA	NA	NA	NA
WP_155081409.1\|3424708_3427198_-	conjugal transfer protein TrbE	NA	NA	NA	NA
WP_017377396.1\|3427214_3427469_-	hypothetical protein	NA	NA	NA	NA
WP_016209715.1\|3427469_3427826_-	trbC/VIRB2 family protein	NA	NA	NA	NA
WP_155046733.1\|3428582_3428720_-	hypothetical protein	NA	NA	NA	NA
WP_155067541.1\|3428656_3429655_-\|transposase	transposase	NA	NA	NA	NA

DBSCAN-SWA_39

3451920 : 3504132

Acinetobacter_phage(20.0%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079478.1\|3451920_3452478_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3452461_3452848_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081419.1\|3452863_3453598_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_054300641.1\|3453849_3454215_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081420.1\|3454271_3454472_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|3454477_3455035_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|3455018_3455405_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081421.1\|3455472_3455919_+	hypothetical protein	NA	NA	NA	NA
WP_155068015.1\|3455927_3457081_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.4e-58	44.2
WP_017378398.1\|3457657_3458056_-	DUF3135 domain-containing protein	NA	NA	NA	NA
WP_017378399.1\|3458921_3459872_+\|tRNA	glycine--tRNA ligase subunit alpha	NA	NA	NA	NA
WP_155081422.1\|3459871_3461950_+\|tRNA	glycine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_155081423.1\|3462097_3462613_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_155081424.1\|3462621_3463185_+	D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase	NA	NA	NA	NA
WP_155068540.1\|3463165_3463912_+	1-acyl-sn-glycerol-3-phosphate acyltransferase	NA	NA	NA	NA
WP_155081425.1\|3464050_3464503_+	hypothetical protein	NA	NA	NA	NA
WP_155081426.1\|3464638_3465475_+	sterol desaturase family protein	NA	NA	NA	NA
WP_155068543.1\|3465471_3466368_+	EamA family transporter	NA	NA	NA	NA
WP_122941163.1\|3466400_3467468_+	4-oxalomesaconate tautomerase	NA	NA	NA	NA
WP_155068544.1\|3467492_3467861_-	diacylglycerol kinase	NA	NA	NA	NA
WP_155081427.1\|3467886_3469338_-	potassium transporter	NA	NA	NA	NA
WP_155068546.1\|3469344_3470724_-	Trk system potassium transporter TrkA	NA	NA	NA	NA
WP_155081598.1\|3470764_3472078_-	16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB	NA	NA	NA	NA
WP_155068548.1\|3472067_3473042_-\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	2.2e-10	35.9
WP_155081599.1\|3473135_3473639_-	peptide deformylase	E3SLL2	Synechococcus_phage	1.4e-13	37.1
WP_155081428.1\|3473773_3474925_+	DNA-protecting protein DprA	NA	NA	NA	NA
WP_016210342.1\|3474921_3475401_+	DUF494 domain-containing protein	NA	NA	NA	NA
WP_155068550.1\|3475547_3477869_+	type I DNA topoisomerase	A0A1V0SCS0	Indivirus	6.7e-98	35.5
WP_155068551.1\|3477813_3478440_+\|tRNA	tRNA threonylcarbamoyladenosine biosynthesis protein RimN	NA	NA	NA	NA
WP_155068552.1\|3478444_3479344_+	oxygen-dependent coproporphyrinogen oxidase	NA	NA	NA	NA
WP_155068793.1\|3479440_3479995_+	DUF4823 domain-containing protein	NA	NA	NA	NA
WP_155081429.1\|3480277_3481402_+	hypothetical protein	NA	NA	NA	NA
WP_155081430.1\|3481758_3482532_+	SDR family NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_155081431.1\|3483986_3484277_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|3484349_3484736_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080821.1\|3484904_3485759_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155066610.1\|3486548_3487124_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_016210338.1\|3487158_3487296_+\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|3490058_3491033_-\|transposase	IS30 family transposase	H7BVY4	unidentified_phage	4.4e-27	31.3
WP_032126718.1\|3491316_3491697_+	hypothetical protein	NA	NA	NA	NA
WP_155081432.1\|3491860_3492556_+	TVP38/TMEM64 family protein	NA	NA	NA	NA
WP_155081433.1\|3492552_3493980_+	dihydrolipoamide dehydrogenase	NA	NA	NA	NA
WP_155079826.1\|3494061_3494948_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081434.1\|3494908_3495499_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_155068568.1\|3495495_3496332_-	protoheme IX farnesyltransferase	NA	NA	NA	NA
WP_155068569.1\|3496332_3496674_-	cytochrome C oxidase subunit IV	NA	NA	NA	NA
WP_155081435.1\|3496675_3497281_-	cytochrome o ubiquinol oxidase subunit III	NA	NA	NA	NA
WP_155068570.1\|3497277_3499272_-	cytochrome o ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_155068571.1\|3499291_3500233_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_155081436.1\|3500460_3501879_+	MFS transporter	NA	NA	NA	NA
WP_155081437.1\|3502033_3503185_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080005.1\|3503246_3504132_+\|transposase	IS630 family transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP039230

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3613 : 43804

unidentified_phage(25.0%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080408.1\|3613_4843_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081838.1\|4979_5129_-	hypothetical protein	NA	NA	NA	NA
WP_155081873.1\|5358_6231_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155081839.1\|6497_6638_-	hypothetical protein	NA	NA	NA	NA
WP_122943008.1\|6637_7435_+	sulfite exporter TauE/SafE family protein	NA	NA	NA	NA
WP_155081840.1\|9116_9983_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080469.1\|10094_10478_-	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|10892_11942_-\|transposase	transposase	NA	NA	NA	NA
WP_155079445.1\|12537_13512_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081161.1\|13535_13751_+	hypothetical protein	NA	NA	NA	NA
WP_155081841.1\|13918_14386_-	hypothetical protein	NA	NA	NA	NA
WP_155081842.1\|14564_14879_-	universal stress family protein	NA	NA	NA	NA
WP_155081843.1\|16159_16456_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081844.1\|16683_17910_+	hypothetical protein	NA	NA	NA	NA
WP_155081845.1\|18159_18732_-	hypothetical protein	A0A1P8DTK0	Proteus_phage	2.5e-30	51.0
WP_155079476.1\|18967_19354_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|19337_19895_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589632.1\|19953_20781_-\|transposase	transposase	NA	NA	NA	NA
WP_155589633.1\|20843_21002_-	hypothetical protein	NA	NA	NA	NA
WP_155085410.1\|21016_21154_-	hypothetical protein	NA	NA	NA	NA
WP_155081847.1\|21364_21811_-	hypothetical protein	NA	NA	NA	NA
WP_155081848.1\|21956_22976_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079478.1\|23455_24013_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080557.1\|23996_24335_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155589634.1\|24377_25097_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	1.4e-06	33.5
WP_155066936.1\|25164_25515_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081465.1\|25546_25999_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155081850.1\|26087_26297_-	hypothetical protein	NA	NA	NA	NA
WP_155081851.1\|26433_27249_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|27419_28394_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_080963620.1\|28580_28937_-	type II toxin-antitoxin system HicB family antitoxin	K7PJX6	Enterobacterial_phage	1.7e-16	36.4
WP_027242953.1\|28920_29175_-	addiction module toxin, HicA family	NA	NA	NA	NA
WP_155079478.1\|29760_30318_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|30301_30688_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081739.1\|30814_31549_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155081852.1\|32246_33038_+	AAA family ATPase	K7PHD1	Enterobacteria_phage	2.9e-77	55.6
WP_155080444.1\|33029_34511_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	6.7e-27	37.0
WP_155079959.1\|34553_34904_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.5e-14	39.2
WP_155079958.1\|34900_35209_-	hypothetical protein	NA	NA	NA	NA
WP_155589635.1\|35330_35879_+	hypothetical protein	K7PK19	Enterobacteria_phage	1.2e-32	40.8
WP_155079445.1\|35898_36873_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081874.1\|37202_37532_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|37624_38182_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|38165_38552_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081854.1\|38570_38864_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_155081855.1\|38960_39326_-\|integrase	tyrosine-type recombinase/integrase	K4K327	Caulobacter_virus	4.2e-07	33.0
WP_155079476.1\|39479_39866_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|39849_40407_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081856.1\|40524_41238_+	hypothetical protein	NA	NA	NA	NA
WP_155079826.1\|41259_42145_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	9.0e-11	22.4
WP_155079445.1\|42829_43804_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP039229

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1560 : 50364

Streptococcus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155068622.1\|1560_2013_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155066936.1\|2044_2395_-\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155085363.1\|2480_3839_+	hypothetical protein	A0A1X9I6W8	Streptococcus_phage	3.7e-40	29.7
WP_155081791.1\|3835_4036_+	hypothetical protein	NA	NA	NA	NA
WP_155081790.1\|4916_5345_-	hypothetical protein	NA	NA	NA	NA
WP_155081789.1\|5475_6204_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.1e-09	30.3
WP_155079478.1\|6184_6742_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|6725_7112_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081788.1\|7404_8109_-	hypothetical protein	NA	NA	NA	NA
WP_155081787.1\|8724_9420_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.2e-46	47.2
WP_155081786.1\|9512_10217_+	hypothetical protein	NA	NA	NA	NA
WP_155080320.1\|10290_11346_+\|transposase	transposase	NA	NA	NA	NA
WP_155079476.1\|12654_13041_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081739.1\|13153_13888_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_016211671.1\|15084_15822_+	ParA family protein	E5FFJ3	Burkholderia_phage	1.7e-10	25.8
WP_122942012.1\|15814_16180_+	hypothetical protein	NA	NA	NA	NA
WP_155081783.1\|16197_16392_-	hypothetical protein	NA	NA	NA	NA
WP_155081784.1\|16520_17330_+	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|17521_18751_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_080664873.1\|19256_19571_-	hypothetical protein	NA	NA	NA	NA
WP_155081764.1\|19942_21193_-	MFS transporter	NA	NA	NA	NA
WP_155081763.1\|21280_21529_-	hypothetical protein	NA	NA	NA	NA
WP_155081762.1\|22876_23542_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	3.6e-36	43.6
WP_155081761.1\|23968_25705_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.1e-24	43.2
WP_155081760.1\|26220_27243_+	hypothetical protein	NA	NA	NA	NA
WP_155081759.1\|27367_27538_+\|transposase	transposase	NA	NA	NA	NA
WP_155081739.1\|27665_28400_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155589621.1\|28399_28573_-	hypothetical protein	NA	NA	NA	NA
WP_155081779.1\|28919_30203_-	hypothetical protein	NA	NA	NA	NA
WP_155589622.1\|30592_31459_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081777.1\|31570_31888_-	hypothetical protein	NA	NA	NA	NA
WP_155081739.1\|31845_32580_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_017377658.1\|32940_33627_+	Fic family protein	NA	NA	NA	NA
WP_054300664.1\|33630_34197_+	recombinase family protein	I1ZBD6	Salisaeta_icosahedral_phage	1.4e-20	35.0
WP_155081832.1\|34286_35645_+	DEAD/DEAH box helicase	D2J050	Enterococcus_phage	1.4e-127	50.5
WP_155081776.1\|35721_36378_+	hypothetical protein	NA	NA	NA	NA
WP_155081775.1\|36377_37088_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.9e-27	35.7
WP_155081774.1\|37894_38230_-	transcriptional regulator	NA	NA	NA	NA
WP_155081773.1\|38266_38587_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	1.5e-11	40.7
WP_155081772.1\|38725_39388_+	DEAD/DEAH box helicase	NA	NA	NA	NA
WP_155081739.1\|39968_40703_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155081771.1\|40775_41015_+	hypothetical protein	NA	NA	NA	NA
WP_155081770.1\|42151_42505_+	hypothetical protein	NA	NA	NA	NA
WP_016211674.1\|42706_42988_+	hypothetical protein	NA	NA	NA	NA
WP_155081769.1\|42977_43256_+	antitoxin	NA	NA	NA	NA
WP_155079478.1\|44109_44667_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080557.1\|44650_44989_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081739.1\|45041_45776_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155081758.1\|45807_46827_-	hypothetical protein	NA	NA	NA	NA
WP_155081739.1\|47070_47805_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155079730.1\|47944_48106_+	hypothetical protein	NA	NA	NA	NA
WP_155079731.1\|48370_48619_+	hypothetical protein	NA	NA	NA	NA
WP_155080256.1\|48602_49160_+\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.9e-05	23.2
WP_155085373.1\|49140_49575_-	hypothetical protein	NA	NA	NA	NA
WP_155081739.1\|49629_50364_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7

DBSCAN-SWA_2

54569 : 108561

Streptococcus_phage(30.43%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080567.1\|54569_55589_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155066610.1\|55592_56168_-\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	1.6e-08	26.2
WP_155081755.1\|56233_56401_+	phosphatase	NA	NA	NA	NA
WP_155080251.1\|57187_57334_+	hypothetical protein	NA	NA	NA	NA
WP_155081830.1\|57500_57827_-	mRNA-degrading endonuclease	A9D9Y1	Lactobacillus_prophage	1.9e-11	36.6
WP_122943070.1\|57828_58071_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_155066936.1\|58473_58824_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155068622.1\|58855_59308_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155081754.1\|59365_60097_+\|transposase	IS30 family transposase	H7BW61	unidentified_phage	1.0e-07	31.1
WP_155079476.1\|60939_61326_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|61309_61867_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079612.1\|62484_63714_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155079487.1\|64185_65235_+\|transposase	transposase	NA	NA	NA	NA
WP_155079487.1\|65505_66555_-\|transposase	transposase	NA	NA	NA	NA
WP_155081753.1\|66627_67290_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	8.2e-25	36.1
WP_155081752.1\|67941_69666_-	PLD-like domain protein	NA	NA	NA	NA
WP_080664873.1\|71365_71680_+	hypothetical protein	NA	NA	NA	NA
WP_155081751.1\|71682_71883_+	hypothetical protein	NA	NA	NA	NA
WP_155081750.1\|72003_72369_-\|transposase	transposase	S5WIU1	Leptospira_phage	7.2e-23	47.1
WP_155081611.1\|72574_73804_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081749.1\|74040_75015_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	7.1e-25	30.7
WP_155081748.1\|75011_75404_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	5.0e-14	38.5
WP_155081747.1\|75766_76033_-\|transposase	transposase	NA	NA	NA	NA
WP_155079478.1\|76080_76638_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|76621_77008_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081746.1\|77155_77299_+	phosphatase	NA	NA	NA	NA
WP_155080821.1\|77802_78657_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	3.1e-08	22.0
WP_155081465.1\|81907_82360_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155066936.1\|82391_82742_-\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155068802.1\|83236_83617_+	hypothetical protein	NA	NA	NA	NA
WP_032126138.1\|83864_84128_-	RNA-binding protein	NA	NA	NA	NA
WP_155081745.1\|84447_85422_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	9.2e-25	31.0
WP_155081744.1\|85498_86143_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.4e-37	43.9
WP_155081743.1\|86189_86384_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|87387_88362_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081701.1\|88995_89685_+	hypothetical protein	NA	NA	NA	NA
WP_036775032.1\|89732_90548_+	hypothetical protein	NA	NA	NA	NA
WP_155081829.1\|90769_91084_+	hypothetical protein	NA	NA	NA	NA
WP_155081742.1\|91495_92230_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.5e-27	35.7
WP_155081741.1\|92282_92705_+	hypothetical protein	NA	NA	NA	NA
WP_155589623.1\|92602_93982_+	hypothetical protein	A0A1X9I6W8	Streptococcus_phage	1.7e-40	30.0
WP_155079476.1\|93978_94365_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|94348_94906_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155589624.1\|95938_96526_+\|transposase	IS6 family transposase	A0A1X9I6E7	Streptococcus_phage	2.5e-25	40.1
WP_155081739.1\|97718_98453_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155081738.1\|98465_98624_-	hypothetical protein	NA	NA	NA	NA
WP_155589625.1\|98741_99437_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|99582_100812_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081828.1\|100948_101125_-	hypothetical protein	NA	NA	NA	NA
WP_148037451.1\|101117_101318_-	hypothetical protein	NA	NA	NA	NA
WP_155068622.1\|102999_103452_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155066936.1\|103483_103834_-\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081835.1\|104394_104709_-	hypothetical protein	NA	NA	NA	NA
WP_155081827.1\|105299_107486_-	ATP-dependent RecD-like DNA helicase	A0A0K2FLP8	Brevibacillus_phage	4.6e-72	29.9
WP_155081739.1\|107826_108561_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7

DBSCAN-SWA_3

112097 : 162375

Indivirus(19.05%)

integrase,transposase

attL 129375:129434|attR 159485:160477

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155080821.1\|112097_112953_-\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	3.1e-08	22.0
WP_155081824.1\|113276_113459_-	hypothetical protein	NA	NA	NA	NA
WP_155081823.1\|113587_114202_+	hypothetical protein	NA	NA	NA	NA
WP_155081739.1\|114198_114933_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	2.0e-27	35.7
WP_155085386.1\|115031_115262_-	hypothetical protein	NA	NA	NA	NA
WP_155085385.1\|115211_115409_+	hypothetical protein	A0A023NGQ0	Nitrincola_phage	6.6e-07	42.9
WP_155079476.1\|115405_115792_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|115775_116333_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155085384.1\|116355_116760_+	hypothetical protein	NA	NA	NA	NA
WP_155085383.1\|116913_117204_+	hypothetical protein	NA	NA	NA	NA
WP_155085031.1\|117200_117455_+	hypothetical protein	NA	NA	NA	NA
WP_155589627.1\|117984_118455_+	hypothetical protein	NA	NA	NA	NA
WP_155589628.1\|118578_118725_-	phosphatase	NA	NA	NA	NA
WP_155079868.1\|119182_120338_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155589629.1\|120266_120983_-	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|121108_121459_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081465.1\|121490_121943_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155080182.1\|122142_122538_-\|transposase	transposase	A0A218MNC9	uncultured_virus	6.4e-09	37.6
WP_155085029.1\|122909_123257_+	hypothetical protein	NA	NA	NA	NA
WP_155085028.1\|123261_123600_+	hypothetical protein	NA	NA	NA	NA
WP_155589630.1\|123853_124678_-	DUF45 domain-containing protein	NA	NA	NA	NA
WP_155081465.1\|125272_125725_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155066936.1\|125756_126107_-\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155079826.1\|127117_128003_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	9.0e-11	22.4
129375:129434	attL	NA	NA	NA	NA
WP_155079612.1\|129531_130761_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081617.1\|131305_132280_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.6e-24	30.7
WP_155589631.1\|132572_132821_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|132844_133819_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081822.1\|135258_135708_+	HAD hydrolase-like protein	NA	NA	NA	NA
WP_155081821.1\|135782_137012_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081820.1\|137171_137471_+	hypothetical protein	NA	NA	NA	NA
WP_155081819.1\|137486_138023_+	MFS transporter	NA	NA	NA	NA
WP_155081818.1\|138261_138474_-	hypothetical protein	NA	NA	NA	NA
WP_155081817.1\|138526_138802_+	hypothetical protein	NA	NA	NA	NA
WP_155081816.1\|139316_142661_+	autotransporter domain-containing protein	NA	NA	NA	NA
WP_155085388.1\|142760_142964_+	hypothetical protein	NA	NA	NA	NA
WP_155081815.1\|143014_144262_+\|transposase	ISAs1 family transposase	NA	NA	NA	NA
WP_155081814.1\|144870_145344_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.3e-28	45.1
WP_155081813.1\|145293_145491_-	hypothetical protein	NA	NA	NA	NA
WP_016212298.1\|146051_146378_-	hypothetical protein	NA	NA	NA	NA
WP_155081812.1\|146977_147673_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	8.8e-46	47.2
WP_155081811.1\|147898_148873_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.7e-23	30.9
WP_155081810.1\|149079_149868_+	N-acetylmuramoyl-L-alanine amidase	NA	NA	NA	NA
WP_155081809.1\|150205_150805_+	DUF1353 domain-containing protein	NA	NA	NA	NA
WP_155081808.1\|151378_151696_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155081834.1\|151673_151847_+	phosphatase	NA	NA	NA	NA
WP_155080256.1\|152249_152807_-\|transposase	IS630 family transposase	S5VXX4	Leptospira_phage	7.9e-05	23.2
WP_155079445.1\|154301_155276_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081807.1\|155460_155928_+	tryptophan-rich sensory protein	A0A1V0S976	Catovirus	1.4e-07	35.0
WP_155081806.1\|155937_156552_-	hypothetical protein	NA	NA	NA	NA
WP_155079996.1\|156629_157043_+	hypothetical protein	NA	NA	NA	NA
WP_155081805.1\|157626_157887_+	hypothetical protein	NA	NA	NA	NA
WP_155081804.1\|157803_158457_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.1e-09	30.6
WP_155081803.1\|158502_159387_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081802.1\|159519_159810_-	hypothetical protein	NA	NA	NA	NA
WP_155081801.1\|159900_160203_-	hypothetical protein	A0A219YB42	Aeromonas_phage	2.0e-10	37.4
WP_155081833.1\|160385_160607_-	hypothetical protein	A0A0A7NPV4	Enterobacteria_phage	7.4e-15	60.7
159485:160477	attR	NA	NA	NA	NA
WP_155081800.1\|160692_161322_+	hypothetical protein	NA	NA	NA	NA
WP_155066278.1\|161325_162375_-\|transposase	transposase	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

5. NZ_CP039231

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

12693 : 46861

unidentified_phage(30.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155079741.1\|12693_13668_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081889.1\|13873_14140_-\|transposase	transposase	NA	NA	NA	NA
WP_155589637.1\|14435_16343_-	DUF1561 family protein	NA	NA	NA	NA
WP_155081891.1\|16528_18580_+	DUF1561 family protein	NA	NA	NA	NA
WP_155081892.1\|19035_19269_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079741.1\|19605_20580_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081893.1\|20624_21113_+\|transposase	IS30 family transposase	NA	NA	NA	NA
WP_155079741.1\|21377_22352_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081894.1\|22592_23306_-	acid phosphatase	NA	NA	NA	NA
WP_155079445.1\|23710_24685_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_122942818.1\|24909_25164_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_155081895.1\|25153_25441_+	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	A0A2H4JBF4	uncultured_Caudovirales_phage	9.6e-15	49.5
WP_155079454.1\|25764_25956_+	hypothetical protein	NA	NA	NA	NA
WP_155081491.1\|26883_27336_-\|transposase	transposase	A0A1V0SCG6	Indivirus	9.6e-09	28.4
WP_155068097.1\|27367_27718_-\|transposase	transposase	NA	NA	NA	NA
WP_155079983.1\|28683_29472_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.8e-13	30.4
WP_155080231.1\|29475_29724_-	hypothetical protein	NA	NA	NA	NA
WP_155079958.1\|29779_30088_+	hypothetical protein	NA	NA	NA	NA
WP_155079959.1\|30084_30435_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.5e-14	39.2
WP_155080444.1\|30477_31959_+\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	6.7e-27	37.0
WP_155066936.1\|32107_32458_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155068622.1\|32489_32942_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155589638.1\|32950_34165_-	hypothetical protein	NA	NA	NA	NA
WP_155081897.1\|34418_35804_+	hypothetical protein	M1I670	Acanthocystis_turfacea_Chlorella_virus	2.1e-06	25.3
WP_155081911.1\|35793_35979_-	hypothetical protein	NA	NA	NA	NA
WP_155085400.1\|36006_36819_-\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	2.2e-48	43.6
WP_155068889.1\|36842_37157_+	hypothetical protein	NA	NA	NA	NA
WP_155081899.1\|37562_38555_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.4e-23	31.0
WP_155589639.1\|39956_40940_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	6.0e-24	31.0
WP_155066936.1\|41136_41487_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081901.1\|41413_41572_+	hypothetical protein	NA	NA	NA	NA
WP_155081465.1\|41566_42019_-\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155066936.1\|42050_42401_-\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155067991.1\|42470_42887_+\|transposase	transposase	NA	NA	NA	NA
WP_155081902.1\|42873_43461_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.8e-07	33.0
WP_155080102.1\|43476_43929_-\|transposase	IS200/IS605 family transposase	NA	NA	NA	NA
WP_155081903.1\|44620_45490_-	hypothetical protein	NA	NA	NA	NA
WP_155066610.1\|46285_46861_-\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	1.6e-08	26.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

6. NZ_CP039228

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1087 : 48885

Indivirus(23.53%)

transposase,integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081606.1\|1087_2125_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081607.1\|2167_3109_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-22	31.1
WP_155081608.1\|3413_3932_-\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	1.4e-08	26.4
WP_155080208.1\|3877_4243_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081609.1\|4203_4389_+	hypothetical protein	NA	NA	NA	NA
WP_155081610.1\|4412_4670_+	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|4867_5425_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|5408_5795_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081611.1\|6380_7610_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081611.1\|8456_9686_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155589608.1\|9785_10016_-	hypothetical protein	NA	NA	NA	NA
WP_155079478.1\|10040_10598_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|10581_10968_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155589609.1\|10986_11559_-	hypothetical protein	NA	NA	NA	NA
WP_155081615.1\|11668_12046_+	hypothetical protein	NA	NA	NA	NA
WP_155081616.1\|12556_12835_+	hypothetical protein	NA	NA	NA	NA
WP_155081617.1\|12820_13795_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.6e-24	30.7
WP_155079826.1\|14061_14947_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	9.0e-11	22.4
WP_155081618.1\|15070_15499_+	DUF86 domain-containing protein	NA	NA	NA	NA
WP_155081619.1\|15495_15795_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_155081620.1\|15837_16515_+	hypothetical protein	NA	NA	NA	NA
WP_155081621.1\|16528_17569_+	hypothetical protein	NA	NA	NA	NA
WP_155589610.1\|18073_19429_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	8.9e-26	37.4
WP_155066936.1\|19575_19926_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155068622.1\|19957_20410_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155079612.1\|20490_21720_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081623.1\|21856_22978_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081624.1\|23135_23864_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-37	43.6
WP_155081625.1\|24230_25691_+	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|25959_26934_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155080257.1\|26993_27173_-	hypothetical protein	NA	NA	NA	NA
WP_155081626.1\|27937_28738_+	hypothetical protein	NA	NA	NA	NA
WP_155081627.1\|28777_29308_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	1.6e-34	46.6
WP_155081628.1\|29480_30164_+	cell filamentation protein Fic	NA	NA	NA	NA
WP_155081629.1\|30168_30738_+	recombinase family protein	W6CWV1	Ralstonia_phage	8.6e-23	36.4
WP_155081630.1\|30859_31762_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	7.2e-24	32.5
WP_155079476.1\|31758_32145_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079476.1\|32173_32560_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155589611.1\|32621_32855_+	hypothetical protein	NA	NA	NA	NA
WP_155081686.1\|32919_33498_-	hypothetical protein	NA	NA	NA	NA
WP_155085337.1\|33549_34281_-	hypothetical protein	NA	NA	NA	NA
WP_155589612.1\|34423_34765_+	hypothetical protein	NA	NA	NA	NA
WP_155080275.1\|34804_35308_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155080216.1\|35714_36797_+\|transposase	IS481 family transposase	E9P643	Wolbachia_endosymbiont_wVitB_of_Nasonia_vitripennis_phage	3.8e-144	72.7
WP_155081632.1\|38588_39059_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155066936.1\|39227_39578_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155080208.1\|40000_40366_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155080171.1\|40311_40887_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	1.6e-08	26.2
WP_155081633.1\|41330_41510_+	hypothetical protein	A0A0R6PJ17	Moraxella_phage	1.7e-09	52.6
WP_155081634.1\|41511_41808_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_064006305.1\|41804_42026_-	hypothetical protein	NA	NA	NA	NA
WP_155081635.1\|42370_43669_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080267.1\|43768_43924_-	hypothetical protein	NA	NA	NA	NA
WP_155081636.1\|45015_45978_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_155081637.1\|46001_46331_-	hypothetical protein	NA	NA	NA	NA
WP_155080442.1\|46714_47842_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081638.1\|47998_48229_+\|transposase	transposase	NA	NA	NA	NA
WP_155081639.1\|48345_48885_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	4.5e-29	45.7

DBSCAN-SWA_2

52377 : 98744

Acinetobacter_phage(20.0%)

transposase,integrase

attL 58047:58106|attR 85555:87087

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155081641.1\|52377_53103_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	4.3e-11	30.8
WP_155079478.1\|53373_53931_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|53914_54301_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079836.1\|54922_55129_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|55494_55881_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|55864_56422_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_047927838.1\|56686_56932_+	hypothetical protein	NA	NA	NA	NA
WP_155081642.1\|56928_57228_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_155081643.1\|57337_58063_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.3e-44	41.4
58047:58106	attL	NA	NA	NA	NA
WP_155079612.1\|58203_59433_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081644.1\|59907_60882_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	1.1e-25	31.3
WP_155081645.1\|60946_61333_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155589613.1\|61467_62166_+	hypothetical protein	NA	NA	NA	NA
WP_155081647.1\|62755_62944_+	hypothetical protein	NA	NA	NA	NA
WP_155081648.1\|63645_64353_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	3.0e-09	34.0
WP_155080068.1\|65252_65735_-	hypothetical protein	NA	NA	NA	NA
WP_155080067.1\|65893_66040_-	hypothetical protein	NA	NA	NA	NA
WP_155080066.1\|66005_66590_-	hypothetical protein	NA	NA	NA	NA
WP_122943230.1\|68474_69410_-	hypothetical protein	NA	NA	NA	NA
WP_155080338.1\|69780_70068_+\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3
WP_155079478.1\|70092_70650_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|70633_71020_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081649.1\|71073_71757_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	1.2e-42	39.6
WP_155080546.1\|71786_72515_+\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.4e-38	42.6
WP_155081650.1\|72622_73510_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080557.1\|73711_74050_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|74033_74591_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081651.1\|74571_74808_-	hypothetical protein	NA	NA	NA	NA
WP_155081652.1\|75198_77472_+	hypothetical protein	NA	NA	NA	NA
WP_155081653.1\|77556_77913_-	hypothetical protein	NA	NA	NA	NA
WP_155081654.1\|77950_78091_+	hypothetical protein	NA	NA	NA	NA
WP_155079868.1\|78056_79212_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155081655.1\|79209_79347_+	hypothetical protein	NA	NA	NA	NA
WP_155081656.1\|79406_79994_+\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	2.3e-31	39.7
WP_155081657.1\|80118_80847_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	1.2e-37	43.6
WP_155081731.1\|80981_81488_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|81549_81900_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081465.1\|81931_82384_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155066739.1\|82536_82887_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081107.1\|82813_83053_+	hypothetical protein	NA	NA	NA	NA
WP_155081658.1\|83617_84211_+\|transposase	IS630 family transposase	A0A1V0SDF3	Indivirus	9.6e-09	26.2
WP_155081607.1\|84170_85112_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-22	31.1
WP_155081659.1\|85154_85604_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|85711_86941_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081660.1\|87166_87979_+	AAA family ATPase	Q7M293	Enterobacteria_phage	2.4e-10	24.4
85555:87087	attR	NA	NA	NA	NA
WP_155081661.1\|87971_88916_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_155081662.1\|89151_89799_-	hypothetical protein	NA	NA	NA	NA
WP_155080444.1\|90174_91656_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	6.7e-27	37.0
WP_155079959.1\|91698_92049_-	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZDM8	Stx2-converting_phage	4.5e-14	39.2
WP_155079958.1\|92045_92354_-	hypothetical protein	NA	NA	NA	NA
WP_155081663.1\|92427_93105_-\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	6.4e-09	34.0
WP_155081664.1\|93909_94512_-	hypothetical protein	NA	NA	NA	NA
WP_155081665.1\|94963_95833_-	hypothetical protein	NA	NA	NA	NA
WP_155081666.1\|96222_97266_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155080444.1\|97262_98744_-\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	6.7e-27	37.0

DBSCAN-SWA_3

102644 : 195298

121

unidentified_phage(21.74%)

capsid,tail,head,transposase,integrase

attL 128625:128684|attR 175127:176236

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155066936.1\|102644_102995_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155079958.1\|103255_103564_+	hypothetical protein	NA	NA	NA	NA
WP_155081670.1\|103743_104043_+	IS66 family insertion sequence element accessory protein TnpB	A0A0P0ZBY2	Stx2-converting_phage	1.8e-11	38.6
WP_155079476.1\|104125_104512_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081671.1\|104495_105041_+	hypothetical protein	NA	NA	NA	NA
WP_155589614.1\|105043_106630_+\|transposase	IS66 family transposase	S5VTP8	Leptospira_phage	1.0e-25	36.6
WP_155081673.1\|107177_107873_+	hypothetical protein	NA	NA	NA	NA
WP_155081674.1\|107893_108130_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|108230_109205_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081675.1\|109228_110233_+	hypothetical protein	NA	NA	NA	NA
WP_155066936.1\|110298_110649_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155068622.1\|110680_111133_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	4.3e-09	28.4
WP_155589615.1\|111535_112402_+	hypothetical protein	NA	NA	NA	NA
WP_155081678.1\|112981_113197_+	hypothetical protein	NA	NA	NA	NA
WP_155081679.1\|113379_113691_+\|head,tail	phage gp6-like head-tail connector protein	Q8SBH7	Shigella_phage	2.5e-08	30.8
WP_155081680.1\|113687_114011_+\|head	phage head closure protein	A0A1W6JP44	Morganella_phage	6.0e-13	39.0
WP_155081681.1\|114351_114612_-	hypothetical protein	NA	NA	NA	NA
WP_155079445.1\|114635_115610_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081733.1\|116180_116738_-	helix-turn-helix domain-containing protein	A0A1S6L009	Salmonella_phage	5.1e-52	56.2
WP_155081682.1\|116737_117055_-	DUF2442 domain-containing protein	NA	NA	NA	NA
WP_155081683.1\|117009_117270_-	DUF4160 domain-containing protein	NA	NA	NA	NA
WP_155081684.1\|117704_118025_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.9e-13	40.4
WP_155081685.1\|118244_118469_-	hypothetical protein	NA	NA	NA	NA
WP_155081686.1\|118625_119204_-	hypothetical protein	NA	NA	NA	NA
WP_155081687.1\|119675_120275_-	hypothetical protein	NA	NA	NA	NA
WP_155081688.1\|120349_120667_-\|transposase	transposase	NA	NA	NA	NA
WP_155081689.1\|120970_121774_+	hypothetical protein	NA	NA	NA	NA
WP_155589616.1\|121763_121910_+	hypothetical protein	NA	NA	NA	NA
WP_155589617.1\|122054_122198_+	hypothetical protein	NA	NA	NA	NA
WP_155081690.1\|122470_123040_+	hypothetical protein	NA	NA	NA	NA
WP_122942947.1\|123165_123444_+	peptidase	A0A2L1IV28	Escherichia_phage	4.9e-24	52.2
WP_122942945.1\|123454_123760_+	HigA family addiction module antidote protein	A0A2I7RCV5	Vibrio_phage	1.1e-05	39.7
WP_155589618.1\|123914_125009_-	hypothetical protein	A0A2I7RG64	Vibrio_phage	1.7e-35	32.5
WP_155079478.1\|125052_125610_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|125593_125980_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155589619.1\|125976_126486_-	DEAD/DEAH box helicase	A0A0K0MD54	Pseudoalteromonas_phage	3.9e-19	38.4
WP_155068933.1\|126527_126881_-	hypothetical protein	NA	NA	NA	NA
128625:128684	attL	NA	NA	NA	NA
WP_155079741.1\|128717_129692_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081692.1\|130323_130896_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	4.0e-36	45.6
WP_155081693.1\|131288_131429_+	hypothetical protein	NA	NA	NA	NA
WP_155068941.1\|131963_132419_-	hypothetical protein	NA	NA	NA	NA
WP_155081694.1\|133167_133539_-\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_155079868.1\|133546_134703_-\|transposase	IS3 family transposase	A0A0P0I4A4	Acinetobacter_phage	8.9e-51	39.4
WP_155081695.1\|134820_135429_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	2.6e-09	34.0
WP_155079478.1\|135409_135967_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|135950_136337_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079741.1\|136500_137475_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081964.1\|137904_138327_+	hypothetical protein	NA	NA	NA	NA
WP_155081931.1\|138328_138652_+	hypothetical protein	NA	NA	NA	NA
WP_155081930.1\|138708_138972_+	DUF4035 domain-containing protein	NA	NA	NA	NA
WP_155081929.1\|138975_141054_+\|tail	phage tail tape measure protein	A0A1J0GWA6	Alteromonas_phage	6.7e-57	32.8
WP_155081928.1\|141046_141388_+\|tail	phage tail protein	NA	NA	NA	NA
WP_155066936.1\|141991_142342_+\|transposase	transposase	A0A218MNC9	uncultured_virus	4.3e-09	37.6
WP_155081465.1\|142373_142826_+\|transposase	IS630 family transposase	A0A1V0SCG6	Indivirus	3.3e-09	28.4
WP_155081926.1\|142922_143687_+	hypothetical protein	A0A0R6PHF9	Moraxella_phage	1.7e-42	41.1
WP_155081925.1\|143739_144552_-	hypothetical protein	NA	NA	NA	NA
WP_155066440.1\|144867_145842_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	4.9e-26	30.7
WP_155081924.1\|145902_146460_+\|tail	tail assembly protein	K7PM97	Enterobacterial_phage	9.3e-22	35.6
WP_155081923.1\|146456_149075_+	hypothetical protein	A0A0R6PIC0	Moraxella_phage	1.2e-108	32.8
WP_155079478.1\|149055_149613_-\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079476.1\|149596_149983_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081921.1\|150048_150702_+	hypothetical protein	NA	NA	NA	NA
WP_155081920.1\|150701_151178_+	hypothetical protein	NA	NA	NA	NA
WP_155081918.1\|151448_152129_+	hypothetical protein	NA	NA	NA	NA
WP_155081917.1\|152138_152792_+	DUF4376 domain-containing protein	NA	NA	NA	NA
WP_155081916.1\|152791_153229_+	hypothetical protein	NA	NA	NA	NA
WP_155081963.1\|153228_153657_+	hypothetical protein	NA	NA	NA	NA
WP_155081915.1\|153850_154468_+	hypothetical protein	NA	NA	NA	NA
WP_155081914.1\|154561_154792_-	hypothetical protein	NA	NA	NA	NA
WP_155081913.1\|154859_155588_-	hypothetical protein	NA	NA	NA	NA
WP_051929651.1\|155591_156644_-	ParA family protein	NA	NA	NA	NA
WP_155081961.1\|157454_158540_+	hypothetical protein	NA	NA	NA	NA
WP_155081960.1\|158627_159878_+	MFS transporter	NA	NA	NA	NA
WP_017377663.1\|160130_160460_+	type II toxin-antitoxin system RelE/ParE family toxin	A0A141GEX6	Brucella_phage	6.1e-13	44.9
WP_017377662.1\|160470_160785_+	hypothetical protein	NA	NA	NA	NA
WP_155081959.1\|161105_161903_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_155081958.1\|161891_162932_-	alkene reductase	NA	NA	NA	NA
WP_155080465.1\|163027_163348_-	hypothetical protein	NA	NA	NA	NA
WP_155589620.1\|163366_163531_-	hypothetical protein	NA	NA	NA	NA
WP_155079612.1\|163676_164906_-\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081956.1\|165042_165474_-	hypothetical protein	NA	NA	NA	NA
WP_155081955.1\|165503_165971_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155081954.1\|165970_166429_-	hypothetical protein	NA	NA	NA	NA
WP_155081953.1\|166768_167071_+	hypothetical protein	NA	NA	NA	NA
WP_155081952.1\|167148_167310_+	hypothetical protein	NA	NA	NA	NA
WP_155081951.1\|167568_167736_+	hypothetical protein	NA	NA	NA	NA
WP_155081950.1\|167843_168962_+	hypothetical protein	NA	NA	NA	NA
WP_155079476.1\|168958_169345_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|169328_169886_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155081949.1\|170120_170459_+	hypothetical protein	R9TNL4	Vibrio_phage	3.5e-24	53.8
WP_155081948.1\|170451_170622_+	hypothetical protein	NA	NA	NA	NA
WP_155081450.1\|170681_171656_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081947.1\|171902_172133_+	hypothetical protein	NA	NA	NA	NA
WP_155081946.1\|172136_172607_+	single-stranded DNA-binding protein	A0A220NRQ8	Escherichia_phage	5.8e-33	63.4
WP_155081945.1\|172755_173121_+	hypothetical protein	NA	NA	NA	NA
WP_027242932.1\|173268_173496_+	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_016210974.1\|173504_173912_+	DUF4411 family protein	NA	NA	NA	NA
WP_155081944.1\|173923_174709_+	DNA/RNA non-specific endonuclease	A0A2H4N7Z3	Lake_Baikal_phage	4.5e-38	41.8
WP_155081943.1\|174929_175160_+	hypothetical protein	NA	NA	NA	NA
WP_155079741.1\|175219_176194_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	2.4e-25	31.0
WP_155081938.1\|176231_177425_+\|transposase	IS91 family transposase	NA	NA	NA	NA
175127:176236	attR	NA	NA	NA	NA
WP_155081937.1\|177570_178428_+\|capsid	phage major capsid protein	A0A2I4R671	Erysipelothrix_phage	6.4e-62	46.3
WP_155081936.1\|178582_179167_+	hypothetical protein	NA	NA	NA	NA
WP_155081935.1\|179549_179966_+	hypothetical protein	NA	NA	NA	NA
WP_155081934.1\|180154_180466_+\|head,tail	phage gp6-like head-tail connector protein	A0A2H4J711	uncultured_Caudovirales_phage	1.0e-09	35.6
WP_155081933.1\|180462_180786_+\|head	phage head closure protein	A0A1W6JP44	Morganella_phage	6.0e-13	38.8
WP_155081932.1\|180778_181174_+	hypothetical protein	Q7Y404	Yersinia_phage	3.7e-09	38.4
WP_155079445.1\|181403_182378_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081710.1\|182715_183696_+\|transposase	IS30 family transposase	W5R8L2	Staphylococcus_phage	1.7e-23	32.2
WP_155079476.1\|183847_184234_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_155079478.1\|184217_184775_+\|transposase	IS630 family transposase	NA	NA	NA	NA
WP_155079612.1\|184989_186219_+\|transposase	IS91 family transposase	NA	NA	NA	NA
WP_155081711.1\|186464_186665_-	hypothetical protein	NA	NA	NA	NA
WP_155081712.1\|186770_188636_+	AAA family ATPase	A0A2I7R5Z1	Vibrio_phage	8.7e-56	30.7
WP_155081713.1\|189939_190668_-\|transposase	IS6 family transposase	A0A1X9I6C6	Streptococcus_phage	6.0e-37	43.1
WP_032126138.1\|191158_191422_+	RNA-binding protein	NA	NA	NA	NA
WP_155079445.1\|191622_192597_-\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081714.1\|192727_193393_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	9.0e-40	42.3
WP_155079445.1\|193570_194545_+\|transposase	IS30 family transposase	H7BWC8	unidentified_phage	5.4e-25	31.0
WP_155081715.1\|194564_194963_-\|transposase	IS3 family transposase	A0A1P8CWQ3	Bacillus_phage	1.1e-08	32.3
WP_155080338.1\|195010_195298_-\|transposase	transposase	A9YX41	Burkholderia_phage	2.2e-06	38.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage