CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	1 crisprs	NA	1	1
NZ_CP046272	Enterobacter hormaechei strain E70 plasmid pE70-A, complete sequence	0 crisprs	DEDDh	0	3
NZ_CP046275	Enterobacter hormaechei strain E70 plasmid pE70-TEM1, complete sequence	0 crisprs	NA	0	0
NZ_CP046271	Enterobacter hormaechei strain E70 chromosome, complete genome	1 crisprs	DEDDh,csa3,WYL,DinG,cas3,cas14j	1	7
NZ_CP046274	Enterobacter hormaechei strain E70 plasmid pE70-NDM1, complete sequence	0 crisprs	NA	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046273_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046273_1

39984-40118

Orphan

Consensus_repeat	Method
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046273_1

>merge|NZ_CP046273|1|39984-40118|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCACCTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTCTGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

>NZ_CP046273|1|1|39984-40118|CRISPRCasFinder
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCACGGTCCCAC	CTCCTACTTGCGTGTCAGAACTCATCCTTCAACCCCGTC
TGGAATATCGATTCCACACGCCGGATTTAACTGGGACCATGGTCCCAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046273.1\|WP_032662167.1\|32541_32772_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|226863
NZ_CP046273.1\|WP_032662171.1\|30498_32061_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|173776
NZ_CP046273.1\|WP_032662169.1\|32134_32545_-\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350229
NZ_CP046273.1\|WP_001389365.1\|48422_49187_+\|IS6-like-element-IS6100-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP046273.1\|WP_001067855.1\|41042_41747_-\|IS6-like-element-IS26-family-transposase	unknown	unknown	gnl\|CDD\|225853
NZ_CP046273.1\|WP_023352616.1\|41793_42402_-\|tetracycline-resistance-transcriptional-repressor-TetR(D)	unknown	unknown	gnl\|CDD\|172294
NZ_CP046273.1\|WP_072199628.1\|40294_40975_-\|DUF4113-domain-containing-protein	unknown	unknown	gnl\|CDD\|179607
NZ_CP046273.1\|WP_001144737.1\|48013_48280_+\|plasmid-mobilization-relaxosome-protein-MobC	unknown	unknown	gnl\|CDD\|368576
NZ_CP046273.1\|WP_001039466.1\|42497_43682_+\|tetracycline-efflux-MFS-transporter-Tet(D)	unknown	unknown	gnl\|CDD\|340946
NZ_CP046273.1\|WP_000845048.1\|46150_47164_-\|class-1-integron-integrase-IntI1	unknown	unknown	gnl\|CDD\|185315
NZ_CP046273.1\|WP_013087126.1\|33313_33604_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046273.1\|WP_015572055.1\|35762_36773_-\|replication-initiation-protein	unknown	unknown	gnl\|CDD\|376444
NZ_CP046273.1\|WP_015572054.1\|34283_35060_+\|phage-integrase-family-protein	unknown	unknown	gnl\|CDD\|334163
NZ_CP046273.1\|WP_013087127.1\|33734_34265_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046273.1\|WP_023327689.1\|37513_38680_+\|plasmid-partitioning-protein-SopA	unknown	unknown	gnl\|CDD\|184261
NZ_CP046273.1\|WP_004201280.1\|47319_47793_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	unknown	unknown	gnl\|CDD\|238127
NZ_CP046273.1\|WP_013087134.1\|38679_39645_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	unknown	unknown	gnl\|CDD\|184254
NZ_CP046273.1\|WP_000842134.1\|43776_44886_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP046273.1\|WP_032662174.1\|29491_30514_-\|helicase-UvrD	unknown	unknown	gnl\|CDD\|350690
NZ_CP046273.1\|WP_001067855.1\|45375_46080_-\|IS6-like-element-IS26-family-transposase	unknown	unknown	gnl\|CDD\|225853

Protein	Function_ID	Function_description	E-value
NZ_CP046273.1\|WP_032662167.1\|32541_32772_-\|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein	gnl\|CDD\|226863	COG4456, VagC, Virulence-associated protein and related proteins [Function unknown].	1.20731e-10
NZ_CP046273.1\|WP_032662171.1\|30498_32061_-\|AAA-family-ATPase	gnl\|CDD\|173776	cd01026, TOPRIM_OLD, TOPRIM_OLD: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in bacterial and archaeal nucleases of the OLD (overcome lysogenization defect) family. The bacteriophage P2 OLD protein, which has DNase as well as RNase activity, consists of an N-terminal ABC-type ATPase domain and a C-terminal Toprim domain; the nuclease activity of OLD is stimulated by ATP, though the ATPase activity is not DNA-dependent. Functional details on OLD are scant and further experimentation is required to define the relationship between the ATPase and Toprim nuclease domains. The TOPRIM domain has two conserved motifs, one of which centers at a conserved glutamate and the other one at two conserved aspartates (DxD). The conserved glutamate may act as a general acid in strand cleavage by nucleases. The DXD motif may co-ordinate Mg2+, a cofactor required for full catalytic function.	3.83508e-20
NZ_CP046273.1\|WP_032662169.1\|32134_32545_-\|PIN-domain-containing-protein	gnl\|CDD\|350229	cd09881, PIN_VapC4-5_FitB-like, VapC-like PIN domain of Mycobacterium tuberculosis VapC4 and VapC5, and Neisseria gonorrhoeae FitB and related proteins. This family includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This family belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	4.70668e-41
NZ_CP046273.1\|WP_001389365.1\|48422_49187_+\|IS6-like-element-IS6100-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	8.97603e-67
NZ_CP046273.1\|WP_023352616.1\|41793_42402_-\|tetracycline-resistance-transcriptional-repressor-TetR(D)	gnl\|CDD\|172294	PRK13756, PRK13756, TetR family transcriptional regulator.	5.40352e-132
NZ_CP046273.1\|WP_072199628.1\|40294_40975_-\|DUF4113-domain-containing-protein	gnl\|CDD\|179607	PRK03609, umuC, translesion error-prone DNA polymerase V subunit UmuC.	4.99848e-165
NZ_CP046273.1\|WP_001144737.1\|48013_48280_+\|plasmid-mobilization-relaxosome-protein-MobC	gnl\|CDD\|368576	pfam05713, MobC, Bacterial mobilisation protein (MobC). This family consists of several bacterial MobC-like, mobilisation proteins. MobC proteins belong to the group of relaxases. Together with MobA and MobB they bind to a single cis-active site of a mobilising plasmid, the origin of transfer (oriT) region. The absence of MobC has several different effects on oriT DNA. Site- and strand-specific nicking by MobA protein is severely reduced, accounting for the lower frequency of mobilisation. The localized DNA strand separation required for this nicking is less affected, but becomes more sensitive to the level of active DNA gyrase in the cell. In addition, strand separation is not efficiently extended through the region containing the nick site. These effects suggest a model in which MobC acts as a molecular wedge for the relaxosome-induced melting of oriT DNA. The effect of MobC on strand separation may be partially complemented by the helical distortion induced by supercoiling. However, MobC extends the melted region through the nick site, thus providing the single-stranded substrate required for cleavage by MobA.	3.4368e-05
NZ_CP046273.1\|WP_001039466.1\|42497_43682_+\|tetracycline-efflux-MFS-transporter-Tet(D)	gnl\|CDD\|340946	cd17388, MFS_TetA, Tetracycline resistance protein TetA and related proteins of the Major Facilitator Superfamily of transporters. This subfamily is composed of tetracycline resistance proteins similar to Escherichia coli TetA(A), TetA(B), and TetA(E), which are metal-tetracycline/H(+) antiporters that confer resistance to tetracycline by an active tetracycline efflux, which is an energy-dependent process that decreases the accumulation of the antibiotic in cells. TetA-like tetracycline resistance proteins belongs to the Eukaryotic Solute carrier 46 (SLC46)/Bacterial Tetracycline resistance (TetA) -like (SLC46/TetA-like) family of the Major Facilitator Superfamily (MFS) of transporters. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.08286e-146
NZ_CP046273.1\|WP_000845048.1\|46150_47164_-\|class-1-integron-integrase-IntI1	gnl\|CDD\|185315	PRK15417, PRK15417, integron integrase.	0
NZ_CP046273.1\|WP_001067855.1\|41042_41747_-\|IS6-like-element-IS26-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69
NZ_CP046273.1\|WP_015572055.1\|35762_36773_-\|replication-initiation-protein	gnl\|CDD\|376444	pfam01051, Rep_3, Initiator Replication protein. This protein is an initiator of plasmid replication. RepB possesses nicking-closing (topoisomerase I) like activity. It is also able to perform a strand transfer reaction on ssDNA that contains its target. This family also includes RepA which is an E.coli protein involved in plasmid replication. The RepA protein binds to DNA repeats that flank the repA gene.	0.000207968
NZ_CP046273.1\|WP_015572054.1\|34283_35060_+\|phage-integrase-family-protein	gnl\|CDD\|334163	pfam00589, Phage_integrase, Phage integrase family. Members of this family cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment. The catalytic site residues in CRE recombinase are Arg-173, His-289, Arg-292 and Tyr-324.	9.41107e-39
NZ_CP046273.1\|WP_032662174.1\|29491_30514_-\|helicase-UvrD	gnl\|CDD\|350690	cd17932, DEXQc_UvrD, DEXQD-box helicase domain of UvrD. UvrD is a highly conserved helicase involved in mismatch repair, nucleotide excision repair, and recombinational repair. It plays a critical role in maintaining genomic stability and facilitating DNA lesion repair in many prokaryotic species including Helicobacter pylori and Escherichia coli. UvrD is a member of the DEAD-like helicase superfamily, a diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.	5.74563e-07
NZ_CP046273.1\|WP_023327689.1\|37513_38680_+\|plasmid-partitioning-protein-SopA	gnl\|CDD\|184261	PRK13705, PRK13705, plasmid-partitioning protein SopA; Provisional.	0
NZ_CP046273.1\|WP_004201280.1\|47319_47793_+\|trimethoprim-resistant-dihydrofolate-reductase-DfrA14	gnl\|CDD\|238127	cd00209, DHFR, Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis.	1.49291e-53
NZ_CP046273.1\|WP_013087134.1\|38679_39645_+\|ParB/RepB/Spo0J-family-plasmid-partition-protein	gnl\|CDD\|184254	PRK13698, PRK13698, ParB/RepB/Spo0J family plasmid partition protein.	0
NZ_CP046273.1\|WP_000842134.1\|43776_44886_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP046273.1\|WP_001067855.1\|45375_46080_-\|IS6-like-element-IS26-family-transposase	gnl\|CDD\|225853	COG3316, COG3316, Transposase and inactivated derivatives [DNA replication, recombination, and repair].	2.30323e-69

>NZ_CP046273.1|WP_013087134.1|38679_39645_+|ParB/RepB/Spo0J-family-plasmid-partition-protein
MKRAPVIPKHTVKDIRPETEPSAAPAAPMVDSLIARVGAMARGNTILLPVCGREVKFILEAIPGESVETASRVWSGNERDQELLTEDALDDLIPSFMLSGQQTPAFGRRVEGVIEIADGSRRRKAAILTSSDYRVLVGDLDDEQMMALSRLGNDYRPVSAYERGNRYAQRLENDFNGNISALAEAENISRKIITRCINTAHLPKSVVALFTHPGELSARSGETLYKAFSGKEALLLQRTQQLHEQKKAGVIFESEEVIGLLTDVLKEPSGKKVNLNTRHQFVPGATALYKGDKVIFNLDKSRLPAECIEKIESILRDLQKV
>NZ_CP046273.1|WP_023327689.1|37513_38680_+|plasmid-partitioning-protein-SopA
MGLMETLDQCITAGHEMTKAIAIAQFNDDSPEARKITRRWRVGEAADLIGVSSQAIRDAEKAGRLPHPDMEMRGRVEQRVGYTIEQINHMRDVFGTRLRRPDDSVPPVIAVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDLHIHAEDTLLPFYLGERDDAAYAVKATCWPGLDIIPSCLALHRIETELMGRFDNGKLPTEPHMMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFFDMLRDLLKNVDLQGFEPDVRILLTKYSNNNGSQSPWMEEQIRDAWGSMVLKNVVRETDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR
>NZ_CP046273.1|WP_015572055.1|35762_36773_-|replication-initiation-protein
MAMENNELPLNLQEVNKTTGEVVKLDVNSASTVQPVALMRLGLFVPTLKSTSRSKTNRKNVTDATEELVQLSIARSEGYTDVRITGSRLDMDTDFKVWLGIIRSMYDFGVKDDTLKLSFVEFVKMCGFDSRRSNKKMRDRISNSLFKLASVTLKFQSETKGWTTHLVQSAYYDITADVVEIRAEPKLFELYQMDRRVLLRLKAIDALQRKESAQALYTYIESLPQNPAPISMKRMRDRLNLTSNLYTQNHTVRKAMAQLKDIGYLDYTEFKRGRATYFSVHYRNPKLISSKVVVPREPEEEVPEQNYDEVIKALKAAGIDPQKLAKALASVKPGND
>NZ_CP046273.1|WP_015572054.1|34283_35060_+|phage-integrase-family-protein
MMPALPGHSGAFSSAQLPVAIDYPAALALRQMALVQDELPKYLLAPEVSALLHYVPDLHRKMLLTTLWNTGARINEALALTRSDFSLAPPYPFVQLATLKQRVEKAARTAGRAPAGSQPHRNVPLSDPQYARQLEMMVATLKIPLERRNKRTGRTEKVRIWEITDRTVRTWLGEAVEAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIPLKVLQSLMGHKSISSTEVYTKVFALDVAARHRVQFSMAEADAVAMLKKR
>NZ_CP046273.1|WP_013087127.1|33734_34265_+|hypothetical-protein
MCKLTGFIMGLTILLGVTARDAGAATLSEMRMVNASQKPGMVIICSRTSEIPQKGESPVRIESLLRGVVLQNDGDRMMFDVTYTQRNAEESIPFRTEKYRLTTELEATRQKMAIDPETIELSLPRARGLEETFLAGMKASPVSFEDYTNYRVKSATEYLILPGPASPDAPVMHCTL
>NZ_CP046273.1|WP_013087126.1|33313_33604_+|hypothetical-protein
MNMKITLSVLFEALIILGHDRVWMEESEFEHIYGYGCYREIHTWDDRTVAWWDDADDTWYLSTEVDVITPFLGPLPKKEGELSEEKCFQLMTLGRY
>NZ_CP046273.1|WP_032662167.1|32541_32772_-|AbrB/MazE/SpoVT-family-DNA-binding-domain-containing-protein
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMAERGDVVSDEGRVNL
>NZ_CP046273.1|WP_032662169.1|32134_32545_-|PIN-domain-containing-protein
MNKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITWAEVSLASQEAGPAAQKLADAFAARLDAILPWDRTAVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR
>NZ_CP046273.1|WP_032662171.1|30498_32061_-|AAA-family-ATPase
MPLITRLMLQNFKKFPELDLRFTHDRNILVGDNESGKSTILLALDLVLSDSRHRVEALGVESLLSQSAVRHFQEGERRAELLPVLTADVFLSNGGDPDLNGRQNLAGIDADGLRMRIAPMTEEYGQDIHNVLQQDPDNFPYEYYSVRFSTFSGGHFAGFRRYLRHLLLDSARIDNEHAAQEYTRTVYSVNVPVADRYRLENSYRQQKMLFCTRHLSAINDTLETYQFGVRSGAKSGLEANLDITEDGISIRHRGKGRQCFIKTEFALQRHQQQGELHALLLEEPENHLSHVSMKRLVNQLATERQTQVFIATHSSHISSRLDLRKAILLGSTRPVLMNELSAETAAFFMKAPDNNVLEFALARRALLVEGDAEFILIEAFYRRLYGRAPEDDGVHIIAIGGTSFRRYLELARLLENRVAALRDNDGNYQQNCDERYADVLCSRTRAFADRDNTRSTFEICLYQDNAALCDALFRGTRRTLTVQEYMLANKAEAAFRLLQLHAEELTVPDYIQEALAWIRE
>NZ_CP046273.1|WP_032662174.1|29491_30514_-|helicase-UvrD
MDKRVIFAVAGSGKTTLLIRRLSEDRRTLILTFTVNNEAHLRAQIIRRFGFIPDGIRVMTWFEFLHGFCFRPFLQERLASRGLSFDRPPPGIPRTNARHYQDPAGRLYHRRLAHLLTARGLLPDIRTRLARYYDELLVDEVQDFAGHDFDFLLELCRAEITVLCCGDFYQHTFDTSRDGNVNSALHDDITRYEARFAAAGFMVDRNTLNRTWRCSTSVCEFITGQLNIRIAAHGIHATLIETITDAERTAALHADNTVIKLFYREHHRYGCYSMNWGVSKGLDHFQDVCIVMGPAHWKLLTRQELAALPPSSRNRLYVACSRARGNIYFVPETHLRRFRN
>NZ_CP046273.1|WP_072199628.1|40294_40975_-|DUF4113-domain-containing-protein
MGIRTALDLALTNPAFIRKNFSVVLERTVRELNGESCMSLEEAPPTKQQIVCSRSFGEKITEYDSLRQAVCQYAERASEKLRKERQYCRHISVFIKTSPFAVKEPYYGNVATEKLLTPTQDTRDIIAAATTALERIWKDGHLYAKAGVMLNDFTGSGVSQLQLFDERPPRPHSSELMKVLDGINHSGLGQIWFAGRGIAPSWQMKRDMLSPAYTTRWKDIPVARIR
>NZ_CP046273.1|WP_001067855.1|41042_41747_-|IS6-like-element-IS26-family-transposase
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP046273.1|WP_023352616.1|41793_42402_-|tetracycline-resistance-transcriptional-repressor-TetR(D)
MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLRNNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPAAPDENLPPLLREALQIMDSDDGEQAFLHGLESLIRGFGHCCK
>NZ_CP046273.1|WP_001039466.1|42497_43682_+|tetracycline-efflux-MFS-transporter-Tet(D)
MNKPAVIALVITLLDAMGIGLIMPVLPSLLREYLPEADVANHYGILLALYAVMQVCFAPLLGRWSDKLGRRPVLLLSLAGAAFDYTLLALSNVLWMLYLGRIISGITGATGAVAASVVADSTAVSERTAWFGRLGAAFGAGLIAGPAIGGLAGDISPHLPFVIAAILNACTFLMVFFIFKPAVQTEEKPAEQKQESAGISFITLLKPLALLLFVFFTAQLIGQIPATVWVLFTESRFAWDSAAVGFSLAGLGAMHALFQAVVAGALAKRLSEKTIIFAGFIADATAFLLMSAITSGWMVYPVLILLAGGGIALPALQGIISAGASAANQGKLQGVLVSLTNLTGVAGPLLFAFIFSQTQQSADGTVWLIGTALYGLLLAICLLIRKPAPVAATC
>NZ_CP046273.1|WP_000842134.1|43776_44886_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MKSRAAVAFGPGLPLEIVEIDVAPPKKGEVLVKISHTGVCHTDAYTLSGDDPEGLFPVVLGHEGAGVVVEVGEGVTSVKPGDHVIPLYTAECGECDFCTSGKTNLCVAVRETQGKGVMPDGTSRFSYNGQPLYHYMGCSTFSEYTVVAEVSLAKINPQANAEQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGGIGLAVVQGARQAKAGRIFAIDTNPSKFELAKQFGATDCINPNDYDKPVQQVLVEMTKWGVDHTFECIGNVNVMRSALESAHRGWGQSVIIGVAGAGKEISTRPFQLVTGRVWKGTAFGGVKGRTQLPGMVEDAMSGKIELAPFVTHTMELDKINEAFDLMHDGKSIRTVIHY
>NZ_CP046273.1|WP_001067855.1|45375_46080_-|IS6-like-element-IS26-family-transposase
MNPFKGRHFQRDIILWAVRWYCKYGISYRELQEMLAERGVNVDHSTIYRWVQRYAPEMEKRLRWYWRNPSDLCPWHMDETYVKVNGRWAYLYRAVDSRGRTVDFYLSSRRNSKAAYRFLGKILNNVKKWQIPRFINTDKAPAYGRALALLKREGRCPSDVEHRQIKYRNNVIECDHGKLKRIIGATLGFKSMKTAYATIKGIEVMRALRKGQASAFYYGDPLGEMRLVSRVFEM
>NZ_CP046273.1|WP_000845048.1|46150_47164_-|class-1-integron-integrase-IntI1
MKTATAPLPPLRSVKVLDQLRERIRYLHYSLRTEQAYVHWVRAFIRFHGVRHPATLGSSEVEAFLSWLANERKVSVSTHRQALAALLFFYGKVLCTDLPWLQEIGRPRPSRRLPVVLTPDEVVRILGFLEGEHRLFAQLLYGTGMRISEGLQLRVKDLDFDHGTIIVREGKGSKDRALMLPESLAPSLREQLSRARAWWLKDQAEGRSGVALPDALERKYPRAGHSWPWFWVFAQHTHSTDPRSGVVRRHHMYDQTFQRAFKRAVEQAGITKPATPHTLRHSFATALLRSGYDIRTVQDLLGHSDVSTTMIYTHVLKVGGAGVRSPLDALPPLTSER
>NZ_CP046273.1|WP_004201280.1|47319_47793_+|trimethoprim-resistant-dihydrofolate-reductase-DfrA14
MKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNRKYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLSTIDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
>NZ_CP046273.1|WP_001144737.1|48013_48280_+|plasmid-mobilization-relaxosome-protein-MobC
MPVLTDEEVNTVRESCRQLGAIGRNLNQVARALNIEFRESDKLKQEAIEKLAERIDQHLDHVSELFDKTWSRWHDCHFQKTTAPVDWA
>NZ_CP046273.1|WP_001389365.1|48422_49187_+|IS6-like-element-IS6100-family-transposase
MTDFKWRHFQGDVILWAVRWYCRYPISYRDLEEMLAERGISVDHTTIYRWVQCYAPEMEKRLRWFWRRGFDPSWRLDETYVKVRGKWTYLYRAVDKRGDTIDFYLSPTRSAKAAKRFLGKALRGLKHWEKPATLNTDKAPSYGAAITELKREGKLDRETAHRQVKYLNNVIEADHGKLKILIKPVRGFKSIPTAYATIKGFEVMRALRKGQARPWCLQPGIRGEVRLVERAFGIGPSALTEAMGMLNHHFAAAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP012428	Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence	20127-20165	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NC_014107	Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence	48095-48133	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP046273	Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence	40032-40070	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP012169	Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence	40032-40070	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP042541	Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence	40032-40070	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP031723	Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence	50311-50349	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP042567	Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence	40032-40070	0	1.0
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP035636	Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence	100226-100264	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1315-1353	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP017182	Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence	1402-1440	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP031569	Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence	7815-7853	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP050011	Citrobacter sp. Y3 plasmid unnamed2, complete sequence	27572-27610	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP019840	Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence	70340-70378	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP022149	Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence	50338-50376	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP009855	UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence	14593-14631	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP008907	Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence	83191-83229	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP026851	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1	65584-65622	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_LT991956	Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2	52487-52525	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP029719	UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence	1341-1379	1	0.974
NZ_CP046273_1	1.1\|40032\|39\|NZ_CP046273\|CRISPRCasFinder	40032-40070	39	NZ_CP039454	Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence	72766-72804	3	0.923

1. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP012428 (Klebsiella pneumoniae strain KP5 plasmid pSg1-2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

2. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NC_014107 (Enterobacter cloacae subsp. cloacae ATCC 13047 plasmid pECL_A, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

3. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP046273 (Enterobacter hormaechei strain E70 plasmid pE70-sul2, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

4. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP012169 (Enterobacter hormaechei subsp. steigerwaltii strain 34998 plasmid p34998-210.894kb, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

5. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP042541 (Enterobacter hormaechei strain C4 plasmid pC4_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

6. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP031723 (Enterobacter hormaechei strain WCHEH020038 plasmid p2_020038, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

7. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP042567 (Enterobacter hormaechei strain C44 plasmid pC44_001, complete sequence) position: , mismatch: 0, identity: 1.0

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgtc	Protospacer
***************************************

8. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP035636 (Enterobacter cloacae strain EN3600 plasmid unnamed4, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

9. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

10. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP017182 (Enterobacter kobei strain DSM 13645 plasmid pDSMZ13645, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

11. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP031569 (Enterobacter hormaechei strain 2013_1a plasmid pIncFIB-1301491, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

12. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP050011 (Citrobacter sp. Y3 plasmid unnamed2, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

13. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP019840 (Enterobacter roggenkampii strain R11 plasmid pASM1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

14. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP022149 (Enterobacter roggenkampii strain 704SK10 plasmid p704SK10_1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

15. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP009855 (UNVERIFIED_ORG: Enterobacter cloacae strain ECNIH5 plasmid pENT-22e, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

16. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP008907 (Enterobacter hormaechei subsp. hoffmannii ECR091 plasmid pENT-4bd, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

17. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP026851 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0072 plasmid unnamed1) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

18. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_LT991956 (Enterobacter hormaechei subsp. steigerwaltii isolate C309 plasmid pC309-p2) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

19. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP029719 (UNVERIFIED_ORG: Enterobacter cloacae strain AR_0154 plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.974

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtgtcagaactcatccttcaaccccgcc	Protospacer
*************************************.*

20. spacer 1.1|40032|39|NZ_CP046273|CRISPRCasFinder matches to NZ_CP039454 (Enterobacter bugandensis strain 220 plasmid pSurvcare220, complete sequence) position: , mismatch: 3, identity: 0.923

ctcctacttgcgtgtcagaactcatccttcaaccccgtc	CRISPR spacer
ctcctacttgcgtttcagaactcatccgtcaaccccgcc	Protospacer
************* ************* *********.*

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

34283 : 57016

Escherichia_phage(28.57%)

integrase,transposase

attL 45324:45383|attR 54108:54928

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015572054.1\|34283_35060_+\|integrase	phage integrase family protein	I3WFA4	Macacine_betaherpesvirus	7.0e-52	91.2
WP_015572055.1\|35762_36773_-	replication initiation protein	J9Q7H0	Salmonella_phage	6.3e-85	55.2
WP_023327689.1\|37513_38680_+	plasmid-partitioning protein SopA	A0A2I6B2X3	Macacine_betaherpesvirus	5.5e-218	94.3
WP_013087134.1\|38679_39645_+	ParB/RepB/Spo0J family plasmid partition protein	I3WF22	Macacine_betaherpesvirus	9.8e-136	76.9
WP_072199628.1\|40294_40975_-	DUF4113 domain-containing protein	F1C5A5	Cronobacter_phage	1.6e-79	62.8
WP_001067855.1\|41042_41747_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_023352616.1\|41793_42402_-	tetracycline resistance transcriptional repressor TetR(D)	NA	NA	NA	NA
WP_001039466.1\|42497_43682_+	tetracycline efflux MFS transporter Tet(D)	NA	NA	NA	NA
WP_000842134.1\|43776_44886_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	2.8e-33	30.2
45324:45383	attL	NA	NA	NA	NA
WP_001067855.1\|45375_46080_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000845048.1\|46150_47164_-\|integrase	class 1 integron integrase IntI1	A0A1P8DJJ6	Virus_Rctr41k	1.0e-71	45.5
WP_004201280.1\|47319_47793_+	trimethoprim-resistant dihydrofolate reductase DfrA14	G3MBI7	Bacillus_virus	8.4e-16	28.9
WP_001144737.1\|48013_48280_+	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_001389365.1\|48422_49187_+\|transposase	IS6-like element IS6100 family transposase	A0A077SL39	Escherichia_phage	4.3e-86	65.7
WP_004098817.1\|49447_50662_+	type II site-specific deoxyribonuclease	E5E3X4	Burkholderia_phage	1.2e-34	42.5
WP_001288432.1\|50695_52129_-	DNA cytosine methyltransferase	E5E3X6	Burkholderia_phage	7.0e-106	50.6
WP_001749967.1\|52510_52717_-	hypothetical protein	NA	NA	NA	NA
WP_000893479.1\|52721_53231_-	restriction endonuclease	NA	NA	NA	NA
WP_001067855.1\|53410_54115_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_000427619.1\|56011_57016_+\|transposase	IS110-like element IS5075 family transposase	NA	NA	NA	NA
54108:54928	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046272

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 63403

Salmonella_phage(91.3%)

terminase,portal,transposase,integrase,tail

attL 6676:6692|attR 31446:31462

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058652536.1\|0_1056_+	replication protein RepA	J9Q7H0	Salmonella_phage	1.0e-186	98.6
WP_006812558.1\|1625_1838_-	hypothetical protein	J9Q7S8	Salmonella_phage	3.1e-34	98.6
WP_072643051.1\|1837_2098_-	hypothetical protein	J9Q7Z5	Salmonella_phage	1.3e-42	100.0
WP_058652534.1\|2170_2350_-	hypothetical protein	J9Q6J1	Salmonella_phage	1.2e-20	100.0
WP_058652533.1\|2390_2666_-	hypothetical protein	J9Q738	Salmonella_phage	2.7e-46	97.8
WP_058652532.1\|2734_3145_-	hypothetical protein	J9Q7G9	Salmonella_phage	2.4e-75	97.8
WP_058652531.1\|3128_3500_-	DUF2591 domain-containing protein	J9Q7S7	Salmonella_phage	5.2e-69	98.4
WP_004110049.1\|3662_4493_-	hypothetical protein	J9Q7Z4	Salmonella_phage	1.1e-127	99.3
WP_058652530.1\|4496_4697_-	hypothetical protein	J9Q6J0	Salmonella_phage	2.5e-25	98.5
WP_162339404.1\|4788_5820_-	recombinase	J9Q736	Salmonella_phage	9.0e-196	99.1
WP_000920226.1\|5867_6134_-	hypothetical protein	J9Q7G8	Salmonella_phage	1.6e-40	100.0
WP_058652528.1\|6133_7078_-	5'-3' exonuclease	J9Q7S6	Salmonella_phage	2.2e-180	98.7
6676:6692	attL	NA	NA	NA	NA
WP_058652527.1\|7138_8155_-	hypothetical protein	J9Q7Z3	Salmonella_phage	2.4e-164	99.3
WP_023180923.1\|8274_8706_-	hypothetical protein	J9Q6I8	Salmonella_phage	1.7e-71	98.6
WP_058652526.1\|9249_9813_+	hypothetical protein	J9Q7G7	Salmonella_phage	7.6e-64	65.6
WP_162339405.1\|9849_10266_-	hypothetical protein	J9Q7S4	Salmonella_phage	2.4e-67	96.4
WP_058652524.1\|10280_13799_-	DNA polymerase III subunit alpha	J9Q7Z2	Salmonella_phage	0.0e+00	99.4
WP_058652523.1\|13979_15215_-	AAA domain-containing protein	J9Q733	Salmonella_phage	3.9e-238	99.3
WP_058652522.1\|15311_17684_-	porphyrin biosynthesis protein	J9Q7G6	Salmonella_phage	0.0e+00	91.1
WP_004110118.1\|17793_18006_-	hypothetical protein	NA	NA	NA	NA
WP_058652521.1\|18269_18656_+	transcriptional regulator	NA	NA	NA	NA
WP_058652520.1\|18647_19754_-\|integrase	site-specific integrase	A0A1P8DTG6	Proteus_phage	5.6e-26	32.6
WP_058652519.1\|19927_20344_-	hypothetical protein	NA	NA	NA	NA
WP_058652518.1\|20334_20859_-	hypothetical protein	NA	NA	NA	NA
WP_006812570.1\|20955_21201_-	GrxA family glutaredoxin	A0A2I7SAE2	Vibrio_phage	1.0e-12	44.9
WP_058652517.1\|21200_21560_-	hypothetical protein	K7PH35	Enterobacteria_phage	2.3e-37	67.2
WP_058652516.1\|21575_21779_-	hypothetical protein	A0A0B6VT64	Edwardsiella_phage	5.2e-07	50.8
WP_072207462.1\|21789_22623_-	phosphate starvation-inducible protein PhoH	W8D063	Erwinia_phage	1.4e-90	65.5
WP_126519095.1\|22806_24003_+	hypothetical protein	NA	NA	NA	NA
WP_058652458.1\|25007_25313_-	hypothetical protein	J9Q7S1	Salmonella_phage	4.1e-48	97.0
WP_022649968.1\|25461_25674_-	hypothetical protein	J9Q6I3	Salmonella_phage	5.8e-33	98.6
WP_058652459.1\|25833_27156_-	DNA ligase	J9Q7G5	Salmonella_phage	6.2e-258	99.1
WP_032623539.1\|27190_27448_-	hypothetical protein	J9Q7R9	Salmonella_phage	4.0e-36	97.6
WP_058652460.1\|27748_28543_-	hypothetical protein	J9Q7Z0	Salmonella_phage	9.9e-110	74.2
WP_117308950.1\|28729_29086_+	sel1 repeat family protein	NA	NA	NA	NA
WP_087451024.1\|29135_30255_+\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_006812535.1\|30493_30811_+	hypothetical protein	J9Q750	Salmonella_phage	3.3e-48	81.9
WP_006812534.1\|30894_31731_+	GIY-YIG nuclease family protein	NA	NA	NA	NA
31446:31462	attR	NA	NA	NA	NA
WP_006812533.1\|31869_33060_+	hypothetical protein	J9Q803	Salmonella_phage	2.4e-120	54.8
WP_006812532.1\|34494_34737_-	hypothetical protein	J9Q751	Salmonella_phage	8.9e-38	93.8
WP_158009091.1\|34726_35041_-	DUF4084 domain-containing protein	NA	NA	NA	NA
WP_032655917.1\|35108_35327_+	hypothetical protein	J9Q804	Salmonella_phage	1.6e-33	95.8
WP_006812530.1\|35467_35779_+	hypothetical protein	J9Q7T7	Salmonella_phage	1.2e-47	97.1
WP_006812529.1\|35907_36303_+	hypothetical protein	J9Q7I1	Salmonella_phage	2.0e-42	66.2
WP_162268523.1\|36513_36711_+	hypothetical protein	J9Q753	Salmonella_phage	3.8e-31	96.9
WP_006812526.1\|36916_37399_+	hypothetical protein	J9Q805	Salmonella_phage	2.5e-87	97.5
WP_016051712.1\|38042_38246_-	hypothetical protein	J9Q7I3	Salmonella_phage	1.3e-29	100.0
WP_040110254.1\|38296_38947_-	hypothetical protein	J9Q754	Salmonella_phage	2.1e-113	99.1
WP_006812523.1\|39269_39797_-	transcriptional regulator	J9Q6L0	Salmonella_phage	2.6e-82	99.3
WP_000683475.1\|39801_40224_-	hypothetical protein	J9Q806	Salmonella_phage	8.2e-63	85.7
WP_001291547.1\|40283_40562_-	hypothetical protein	J9Q7T9	Salmonella_phage	3.4e-41	98.9
WP_058652472.1\|40564_42124_-	DEAD/DEAH box helicase	J9Q7I4	Salmonella_phage	2.2e-294	99.4
WP_023316007.1\|42206_42887_+	ParB N-terminal domain-containing protein	J9Q756	Salmonella_phage	1.3e-121	99.1
WP_040110316.1\|42886_43555_+	ParB N-terminal domain-containing protein	J9Q6L1	Salmonella_phage	4.3e-114	99.1
WP_016051719.1\|43551_44190_+	ATP-binding cassette domain-containing protein	J9Q807	Salmonella_phage	3.8e-112	100.0
WP_001113021.1\|44182_44437_+	hypothetical protein	J9Q7U0	Salmonella_phage	4.1e-41	98.8
WP_058652471.1\|44442_45333_+	hypothetical protein	J9Q7I6	Salmonella_phage	3.1e-168	99.3
WP_000176291.1\|45342_45609_+	hypothetical protein	J9Q757	Salmonella_phage	1.3e-42	100.0
WP_058652470.1\|45806_46448_+	hypothetical protein	J9Q6D4	Salmonella_phage	7.5e-108	97.7
WP_058652469.1\|46450_47707_+\|terminase	terminase	J9Q7Y2	Salmonella_phage	4.1e-251	99.8
WP_058652468.1\|47740_49315_+\|portal	phage portal protein	J9Q7R1	Salmonella_phage	1.2e-300	99.0
WP_040110314.1\|49337_50234_+	hypothetical protein	J9Q7F4	Salmonella_phage	5.1e-147	98.0
WP_040110313.1\|50260_51136_+	hypothetical protein	J9Q710	Salmonella_phage	1.9e-162	99.7
WP_001115046.1\|51210_52134_+	Ig domain-containing protein	J9Q6D6	Salmonella_phage	3.3e-157	100.0
WP_000801184.1\|52177_52612_+	hypothetical protein	J9Q7Y3	Salmonella_phage	2.1e-74	100.0
WP_000057119.1\|52611_53445_+	hypothetical protein	J9Q7R2	Salmonella_phage	2.6e-153	100.0
WP_001027662.1\|53542_53887_+	hypothetical protein	J9Q7F6	Salmonella_phage	1.9e-57	100.0
WP_000523626.1\|53877_54351_+	hypothetical protein	J9Q711	Salmonella_phage	2.3e-82	100.0
WP_000469441.1\|54352_54736_+	hypothetical protein	J9Q6D8	Salmonella_phage	1.7e-67	100.0
WP_058652467.1\|54810_55557_+	Ig domain-containing protein	J9Q7Y4	Salmonella_phage	8.7e-116	89.1
WP_000163862.1\|55617_55935_+	hypothetical protein	J9Q7R3	Salmonella_phage	6.0e-50	98.1
WP_000952684.1\|56060_56285_+	hypothetical protein	J9Q7F7	Salmonella_phage	4.2e-34	100.0
WP_058652466.1\|56292_60873_+	tape measure protein	J9Q712	Salmonella_phage	0.0e+00	90.1
WP_000440566.1\|60914_61250_+\|tail	phage tail protein	J9Q6E1	Salmonella_phage	5.7e-59	97.3
WP_016051624.1\|61339_62038_+\|tail	phage minor tail protein L	J9Q7Y5	Salmonella_phage	3.7e-137	100.0
WP_058652465.1\|62030_62828_+\|tail	phage tail protein	J9Q7R4	Salmonella_phage	8.6e-154	95.1
WP_023316017.1\|62815_63403_+\|tail	tail assembly protein	J9Q7F8	Salmonella_phage	1.9e-102	92.3

DBSCAN-SWA_2

68176 : 90849

Salmonella_phage(91.67%)

tail,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058652464.1\|68176_72358_+\|tail	phage tail protein	J9Q6E3	Salmonella_phage	0.0e+00	79.7
WP_040110304.1\|72422_73211_+	receptor-recognizing protein	E5DHZ0	Enterobacter_phage	3.9e-58	63.5
WP_000064173.1\|73285_73609_+	hypothetical protein	J9Q6E7	Salmonella_phage	1.4e-46	92.5
WP_006812500.1\|73622_74315_+	membrane protein	J9Q7Y7	Salmonella_phage	3.9e-126	96.1
WP_000147960.1\|74316_74568_+	hypothetical protein	J9Q7R6	Salmonella_phage	1.9e-30	89.2
WP_080399007.1\|74518_74725_+	hypothetical protein	J9Q7G2	Salmonella_phage	3.1e-23	78.5
WP_016582627.1\|74752_75277_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_016582626.1\|75280_75550_-	DUF1778 domain-containing protein	NA	NA	NA	NA
WP_023315962.1\|75966_76632_+	AAA family ATPase	J9Q7R7	Salmonella_phage	4.7e-113	95.0
WP_160956455.1\|76637_76991_+	hypothetical protein	J9Q7G3	Salmonella_phage	2.2e-45	100.0
WP_077990606.1\|77032_77830_-	DUF2971 domain-containing protein	J9Q7Y9	Salmonella_phage	2.1e-11	26.1
WP_058652463.1\|78093_78819_+	hypothetical protein	J9Q7R8	Salmonella_phage	1.1e-139	98.8
WP_006812582.1\|78879_80220_+	AAA family ATPase	J9Q7G4	Salmonella_phage	1.3e-247	99.8
WP_058652462.1\|80309_81494_+	hypothetical protein	J9Q720	Salmonella_phage	4.3e-210	94.6
WP_117308951.1\|81485_82367_-	sel1 repeat family protein	NA	NA	NA	NA
WP_087451024.1\|82437_83558_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_006812537.1\|83962_84166_+	putative selenium delivery protein YdfZ	J9Q802	Salmonella_phage	6.8e-31	97.0
WP_117308952.1\|84221_84920_-	DUF1311 domain-containing protein	J9Q6K3	Salmonella_phage	2.7e-111	89.2
WP_072643031.1\|84958_85510_-	hypothetical protein	J9Q748	Salmonella_phage	6.7e-97	91.3
WP_072643032.1\|85506_86148_-	HD domain-containing protein	J9Q7H7	Salmonella_phage	6.5e-112	97.2
WP_047055004.1\|86239_86611_-	hypothetical protein	J9Q7T4	Salmonella_phage	2.0e-60	96.7
WP_006812541.1\|86613_86895_-	hypothetical protein	J9Q801	Salmonella_phage	6.5e-48	100.0
WP_117308953.1\|86891_87581_-	hypothetical protein	J9Q6K2	Salmonella_phage	6.1e-124	97.8
WP_162339402.1\|87639_89325_-	DUF4942 domain-containing protein	J9Q747	Salmonella_phage	0.0e+00	98.0
WP_072643034.1\|89466_90039_-	hypothetical protein	J9Q7H6	Salmonella_phage	4.5e-96	97.9
WP_117308955.1\|90156_90345_-	hypothetical protein	J9Q800	Salmonella_phage	1.3e-23	93.5
WP_047055014.1\|90354_90849_-	hypothetical protein	J9Q6J9	Salmonella_phage	6.2e-78	95.1

DBSCAN-SWA_3

93940 : 113957

Salmonella_phage(95.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_016245729.1\|93940_95938_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.6e-21	26.2
WP_000262979.1\|96777_97008_-	hypothetical protein	J9Q7H5	Salmonella_phage	2.1e-36	100.0
WP_004109976.1\|97210_97804_-	phage N-6-adenine-methyltransferase	J9Q7T2	Salmonella_phage	2.1e-112	100.0
WP_072643035.1\|97989_98916_-	hypothetical protein	J9Q7Z9	Salmonella_phage	2.2e-108	93.2
WP_000208226.1\|98960_99518_-	3'-5' exonuclease	J9Q6J8	Salmonella_phage	7.0e-102	99.5
WP_004109992.1\|99527_99947_-	hypothetical protein	J9Q743	Salmonella_phage	6.4e-68	97.8
WP_000386471.1\|100010_100655_-	AAA family ATPase	J9Q7H4	Salmonella_phage	5.2e-117	100.0
WP_160859086.1\|100654_101125_-	dihydrofolate reductase	J9Q7T1	Salmonella_phage	2.0e-89	100.0
WP_160956520.1\|101127_101523_-	hypothetical protein	J9Q7Z8	Salmonella_phage	3.6e-68	97.7
WP_022649915.1\|101542_102646_-	thymidylate synthase	J9Q6J6	Salmonella_phage	1.1e-218	99.2
WP_057102246.1\|102835_103705_-	phosphoribosyl-ATP pyrophosphohydrolase	J9Q742	Salmonella_phage	2.1e-161	99.0
WP_058652544.1\|103787_104930_-	ribonucleotide-diphosphate reductase subunit beta	J9Q7H3	Salmonella_phage	4.9e-219	99.7
WP_058652543.1\|105037_107353_-	ribonucleoside-diphosphate reductase subunit alpha	J9Q7T0	Salmonella_phage	0.0e+00	99.6
WP_058652542.1\|107430_108000_-	hypothetical protein	J9Q7Z7	Salmonella_phage	1.3e-103	99.5
WP_058652541.1\|108011_108758_-	hypothetical protein	J9Q6J5	Salmonella_phage	1.5e-136	98.4
WP_162339403.1\|108747_109251_-	SMC family ATPase	J9Q741	Salmonella_phage	8.2e-86	98.8
WP_058652539.1\|110893_111979_-	exonuclease	J9Q7S9	Salmonella_phage	1.6e-206	98.9
WP_000832167.1\|112207_112711_+	hypothetical protein	J9Q7Z6	Salmonella_phage	5.5e-90	98.2
WP_058652538.1\|112742_113237_-	hypothetical protein	J9Q6J3	Salmonella_phage	3.3e-87	97.0
WP_058652537.1\|113312_113957_-	hypothetical protein	J9Q739	Salmonella_phage	1.1e-122	98.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046271_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046271_1

1927495-1927618

Orphan

Consensus_repeat	Method
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046271_1

>merge|NZ_CP046271|1|1927495-1927618|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTACAGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAACGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

>NZ_CP046271|1|1|1927495-1927618|CRISPRCasFinder
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA	CAGACGCAAGATGGTGCGTTCAATTGGACTCGAACCAA
CGACCCCCACCATGTCAAGGTGGTGCTCTAACCAACTGAGCTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046271.1\|WP_003857639.1\|1931497_1932697_-\|Bcr/CflA-family-multidrug-efflux-MFS-transporter	unknown	unknown	gnl\|CDD\|182924
NZ_CP046271.1\|WP_003857638.1\|1932809_1933721_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|182948
NZ_CP046271.1\|WP_022650940.1\|1937220_1937979_-\|C40-family-peptidase	unknown	unknown	gnl\|CDD\|366353
NZ_CP046271.1\|WP_058652882.1\|1918658_1920065_+\|DUF1996-domain-containing-protein	unknown	unknown	gnl\|CDD\|370451
NZ_CP046271.1\|WP_003857632.1\|1935061_1935151_+\|YnhF-family-membrane-protein	unknown	unknown	unknown
NZ_CP046271.1\|WP_003857643.1\|1929377_1930019_+\|riboflavin-synthase	unknown	unknown	gnl\|CDD\|183846
NZ_CP046271.1\|WP_003857664.1\|1920388_1921171_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293813
NZ_CP046271.1\|WP_003857645.1\|1927778_1929152_-\|MdtK-family-multidrug-efflux-MATE-transporter	unknown	unknown	gnl\|CDD\|234981
NZ_CP046271.1\|WP_045344100.1\|1924388_1924919_+\|type-VI-secretion-system-lipoprotein-TssJ	unknown	unknown	gnl\|CDD\|378947
NZ_CP046271.1\|WP_003857662.1\|1921243_1921879_+\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|238449
NZ_CP046271.1\|WP_003857631.1\|1935312_1936479_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|225371
NZ_CP046271.1\|WP_003857629.1\|1936516_1937098_-\|superoxide-dismutase-[Fe]	unknown	unknown	gnl\|CDD\|182534
NZ_CP046271.1\|WP_058652881.1\|1921907_1923503_-\|FAD-NAD(P)-binding-protein	unknown	unknown	gnl\|CDD\|182134
NZ_CP046271.1\|WP_003857647.1\|1926818_1927289_+\|Hsp20-family-protein	unknown	unknown	gnl\|CDD\|107227
NZ_CP046271.1\|WP_058652896.1\|1924918_1925362_+\|type-VI-secretion-system-baseplate-subunit-TssE	unknown	unknown	gnl\|CDD\|274540
NZ_CP046271.1\|WP_003857641.1\|1930050_1931199_-\|cyclopropane-fatty-acyl-phospholipid-synthase	unknown	unknown	gnl\|CDD\|183282
NZ_CP046271.1\|WP_022650936.1\|1926445_1926646_+\|cell-surface-composition-regulator-GlgS	unknown	unknown	gnl\|CDD\|179501
NZ_CP046271.1\|WP_003857634.1\|1933738_1934764_-\|HTH-type-transcriptional-repressor-PurR	unknown	unknown	gnl\|CDD\|236739
NZ_CP046271.1\|WP_003857665.1\|1920122_1920263_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046271.1\|WP_096888918.1\|1925681_1926089_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|182205

Protein	Function_ID	Function_description	E-value
NZ_CP046271.1\|WP_003857639.1\|1931497_1932697_-\|Bcr/CflA-family-multidrug-efflux-MFS-transporter	gnl\|CDD\|182924	PRK11043, PRK11043, Bcr/CflA family multidrug efflux MFS transporter.	0
NZ_CP046271.1\|WP_003857638.1\|1932809_1933721_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|182948	PRK11074, PRK11074, putative DNA-binding transcriptional regulator; Provisional.	0
NZ_CP046271.1\|WP_022650940.1\|1937220_1937979_-\|C40-family-peptidase	gnl\|CDD\|366353	pfam00877, NLPC_P60, NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.	1.9126e-42
NZ_CP046271.1\|WP_058652882.1\|1918658_1920065_+\|DUF1996-domain-containing-protein	gnl\|CDD\|370451	pfam09362, DUF1996, Domain of unknown function (DUF1996). This family of proteins are functionally uncharacterized.	9.73996e-31
NZ_CP046271.1\|WP_003857643.1\|1929377_1930019_+\|riboflavin-synthase	gnl\|CDD\|183846	PRK13020, PRK13020, riboflavin synthase subunit alpha; Provisional.	5.19053e-120
NZ_CP046271.1\|WP_003857664.1\|1920388_1921171_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293813	cd07727, YmaE-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis YmaE and related proteins; MBL-fold metallo hydrolase domain. Includes the uncharacterized Bacillus subtilis YmaE and Nostoc all1228 proteins.Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry. .	8.8084e-55
NZ_CP046271.1\|WP_003857645.1\|1927778_1929152_-\|MdtK-family-multidrug-efflux-MATE-transporter	gnl\|CDD\|234981	PRK01766, PRK01766, multidrug efflux protein; Reviewed.	0
NZ_CP046271.1\|WP_045344100.1\|1924388_1924919_+\|type-VI-secretion-system-lipoprotein-TssJ	gnl\|CDD\|378947	pfam12790, T6SS-SciN, Type VI secretion lipoprotein, VasD, EvfM, TssJ, VC_A0113. One of the virulence mechanisms of E coli is the production of toxins which it produces from dedicated machineries called secretion systems. Seven secretion systems have been described, which assemble from 3 to up to more than 20 subunits. These secretion systems derive from or have co-evolved with bacterial organelles such as ABC transporters (type I), type IV pili (type 2), flagella (type 3), or conjugative machines (type IV). The type VI secretion system (T6SS) is present in most pathogens that have contact with animals, plants, or humans. SciN is a lipoprotein tethered to the outer membrane and expressed in the periplasm of E coli and is essential for T6S-dependent secretion of the Hcp-like SciD protein and for biofilm formation.	4.63623e-38
NZ_CP046271.1\|WP_003857662.1\|1921243_1921879_+\|carbonic-anhydrase	gnl\|CDD\|238449	cd00884, beta_CA_cladeB, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	1.47181e-91
NZ_CP046271.1\|WP_003857631.1\|1935312_1936479_+\|MFS-transporter	gnl\|CDD\|225371	COG2814, AraJ, Arabinose efflux permease [Carbohydrate transport and metabolism].	1.19451e-99
NZ_CP046271.1\|WP_058652881.1\|1921907_1923503_-\|FAD-NAD(P)-binding-protein	gnl\|CDD\|182134	PRK09897, PRK09897, FAD-NAD(P)-binding protein.	0
NZ_CP046271.1\|WP_003857647.1\|1926818_1927289_+\|Hsp20-family-protein	gnl\|CDD\|107227	cd06470, ACD_IbpA-B_like, Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins. IbpA and IbpB are 16 kDa small heat shock proteins (sHsps). sHsps are molecular chaperones that suppress protein aggregation and protect against cell stress, and are generally active as large oligomers consisting of multiple subunits. IbpA and IbpB are produced during high-level production of various heterologous proteins, specifically human prorenin, renin and bovine insulin-like growth factor 2 (bIGF-2), and are strongly associated with inclusion bodies containing these heterologous proteins. IbpA and IbpB work as an integrated system to stabilize thermally aggregated proteins in a disaggregation competent state. The chaperone activity of IbpB is also significantly elevated as the temperature increases from normal to heat shock. The high temperature results in the disassociation of 2-3-MDa IbpB oligomers into smaller approximately 600-kDa structures. This elevated activity seen under heat shock conditions is retained for an extended period of time after the temperature is returned to normal. IbpA also forms multimers.	3.67422e-40
NZ_CP046271.1\|WP_058652896.1\|1924918_1925362_+\|type-VI-secretion-system-baseplate-subunit-TssE	gnl\|CDD\|274540	TIGR03357, hypothetical_protein_Atu4338, type VI secretion system lysozyme-like protein. The description for Pfam family pfam04965 cites acidic lysozyme activity for some phage-encoded members. This family represents a different subgroup of the proteins from pfam04965, where all members are associated with bacterial type VI secretion system genomic contexts.	1.18818e-27
NZ_CP046271.1\|WP_003857641.1\|1930050_1931199_-\|cyclopropane-fatty-acyl-phospholipid-synthase	gnl\|CDD\|183282	PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase.	0
NZ_CP046271.1\|WP_022650936.1\|1926445_1926646_+\|cell-surface-composition-regulator-GlgS	gnl\|CDD\|179501	PRK02922, PRK02922, cell surface composition regulator GlgS.	5.34664e-29
NZ_CP046271.1\|WP_003857634.1\|1933738_1934764_-\|HTH-type-transcriptional-repressor-PurR	gnl\|CDD\|236739	PRK10703, PRK10703, HTH-type transcriptional repressor PurR.	0
NZ_CP046271.1\|WP_003857629.1\|1936516_1937098_-\|superoxide-dismutase-[Fe]	gnl\|CDD\|182534	PRK10543, PRK10543, superoxide dismutase [Fe].	1.40399e-136
NZ_CP046271.1\|WP_096888918.1\|1925681_1926089_+\|hypothetical-protein	gnl\|CDD\|182205	PRK10040, PRK10040, hypothetical protein; Provisional.	3.03643e-15

>NZ_CP046271.1|WP_003857647.1|1926818_1927289_+|Hsp20-family-protein
MMTLRTFPVLNDLSDSLFADRFNRIDRLFSQLTGSTPLPSTPSYNIRRLGDNRYELTLSVPGWKESELEIETVGGQLNISGKREEEKTENGEEGWIHRGISRSDFRASYSLPEHVKVTGASLENGLLAIELHQDIPEEEKPQRIAINNNPAIEHKP
>NZ_CP046271.1|WP_022650936.1|1926445_1926646_+|cell-surface-composition-regulator-GlgS
MKRQDINALKNFDFLARSFARMYALGQPVDIDAVTGNMSNKQQAWFRERYDHYRKQAERARVIELR
>NZ_CP046271.1|WP_096888918.1|1925681_1926089_+|hypothetical-protein
MDTDMKMRILLLTVSVLFNMQAGAARGRQPCSGSKGGIAHCTSDGRFVCNDGSLSQSKRFCSGYGASELPRQVKPSPSARKAQTKKRIAVKGQEQRVVENNAQFDTQPRQPTCAPLYLANKPGFTHLPICSGNQY
>NZ_CP046271.1|WP_058652896.1|1924918_1925362_+|type-VI-secretion-system-baseplate-subunit-TssE
MPRPSLYDMLYGNFAGGLDLHSVSEENQLILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGMPGTAHQLITTLSAVLLKYEPRLSRINVVMQEQIQPGELRYAIDAELKGVGLVRYGTEFMPEGRVLIRHLKQQQYPDNTARL
>NZ_CP046271.1|WP_045344100.1|1924388_1924919_+|type-VI-secretion-system-lipoprotein-TssJ
MKMAITAGKALAITLATLLTGCGLTQKVTDGTVAVTKSIFYRQVKTLHLDIQAREGVNNNAKGASLATVVRIYQLKERKAFDSTDYPSLFASDTQAIKADLVAEKDIRLRPGESVTLDMRMEESAQVVAVAGMFMAPDQVNDTWRITLTRDDLDPDKARVIEVSNNRLTLKPLEGE
>NZ_CP046271.1|WP_058652881.1|1921907_1923503_-|FAD-NAD(P)-binding-protein
MKKIAIIGSGPTGIYTFYSLLNNAAPLSITVFEKADQPGVGMPYSDEDNSRLMLANIASIEIPPIFITYLDWLKQQNAARLARYNVDSEKLHDRQFLPRILLGEYFHDRFLAVAAEAKKAGFHIEVHPNAEVTDIKADADGVALSVNDAPFSRRFDLAVVATGHVWPDENETTRAYFPSPWSGLMDAEVRACEVGIMGTSLSGLDAAMAVVMQHGRFSGKQFVVNKGSEGLKIMLMSRTGVLPEADFYCPIPYEPLSVLTDCVVESEIDKGPDGLLDRIFALMVKELELADPRWCQAIALGTLNADTLRDAWFEDRKKHGPFTWAEANLKEVERNKREKRTVAWRYTVLRLHEVLQAIVPSLNEHDRERFKSGLERVFIDNYAAIPPQSIRRLLALREAGIISVVALGDDYDLDIGSDQTVITTAKKSYRFDVFIDARGQKPLRNKDIPFPTLRKQLAGTGDDVPDVGEDYTLLAPASLRGRIAFGAIPWLMHDHPFVQGLSECAEIGKAMAKAAGKPASGVRRKLPYMEF
>NZ_CP046271.1|WP_003857662.1|1921243_1921879_+|carbonic-anhydrase
MQHIIEGFLSFQKEIFPQRKELFRSLASSQNPKALFISCSDSRLVPELVTQQEPGQLFVIRNAGNIVPPFGPEPGGVSATIEYAVVALGVTDIVICGHSNCGAMKAIADNADLEPMPAVSHWLRYSDAAKAVVEKKTWDKPIDKVNAMVQENVFAQLSNIKTHPSVAVGLRNNAIRLHGWVYDIESGKILALDKNTKSFVSLSENPEVFFE
>NZ_CP046271.1|WP_003857664.1|1920388_1921171_+|MBL-fold-metallo-hydrolase
MITLCKTCGTAYDEQPKNCPICDDERQYVPVTGQAWTDFDSLTTTHTNKWQQLEPQLFSIKTVPAFAINQRALLLRTPQGNVLWDCIANLDPATRALVDALGGISAIAISHPHYYTTMQEWAAAFNAPIYLHASDRQWVMRDSPAIRFWEEDALEIMPLVTLLRLGGHFAGGTVLHWQSGDGVLLAGDILQVTPGKDAVSFMWSYPNMLPLPARTVESVIGRLTGKTYQRLYGAFEGQNIPVNADEIVQRSGQKYIACLR
>NZ_CP046271.1|WP_003857665.1|1920122_1920263_-|hypothetical-protein
MEIDLDNLVFNGLDEAEERNAERLDDADKKAQAIVADDDCGDACKI
>NZ_CP046271.1|WP_058652882.1|1918658_1920065_+|DUF1996-domain-containing-protein
MKRTVLTPALSATALLLTMQAAHAGPQAHVVCSYSHTLGDDAIMMFSMPNEAMLHDFFGNVHTDAYSSRESLRTQEKTTCDNKADSSAYWAPSLKLPDGTVVKPAYQKTYYQASNVDAWPLHPFPAGLSLLAGDHHGTAPNPHITFLCANGKGYTTRTGEVCGLRKAKDAVQFNIGIQFPNCWDGVNLKPAHGLANATYDTKGQCPSAFPVKIPTVNMNIAYVLPTISSLDTSKVQLSLDPIMHGSEREERWGSLYTAHADFMNGWTEDAARFMTDLCMNRGMDCGTTVPYGYSKAKANVWLSSMEPALSQPDPQVLLVQDNWKNGGRTKNSETLSLAKFHIPPLPAGQDPAQFKYRVRIFGGKVETNGADQIFFYPASNDWDPATVSWHSRPSCNYRSDAVLYLNHSREYRMVDVDKAVRKALAEGKTEISWYIGGDRQGNHYQFETGSSPQSLILMLTGFSKTPEI
>NZ_CP046271.1|WP_003857645.1|1927778_1929152_-|MdtK-family-multidrug-efflux-MATE-transporter
MQKYMIEARQLLALAIPVIVAQVAQTAMGFVDTVMAGGYSATDMAAVAIGTSIWLPAILFGHGLLLALTPVIAQLNGSGRRDRVAHQVRQGFWLAGFVSVLIMIVLWNAGYIIRAMHNIDPALADKAVGYLRALLWGAPGYLFFQVARNQCEGLAKTKPGMVMGFIGLLVNIPVNYIFIYGHFGMPELGGVGCGVATAAVYWVMFGSMLTYIKHARSMRDIRNDTTFSTPDWSMLTRLTQLGLPIALALFFEVTLFAVVALLVSPLGIIDVAGHQIALNFSSLMFVLPMSLAAAVTIRVGFRLGQGSTLDAQTAARTGLGVGVCMAVCTALFTVLLREQIALLYNDNPEVVTLASHLMLLAAIYQISDSIQVIGSGVLRGYKDTRSIFFITFIAYWVLGLPCGYILALTDLVVDRMGPAGFWMGFIIGLTSAAIMMMLRMRFLQRQPSTVILQRAAR
>NZ_CP046271.1|WP_003857643.1|1929377_1930019_+|riboflavin-synthase
MFTGIVQGTAKVVSIDEKPNFRTHVVELPEYMLDGIETGASIAHNGCCLTVTEINGNQISFDLMKETLRITNLGELVVGDIINVERAAKFSDEIGGHLMSGHIMTTAEVAKIVTSENNRQIWFKVQDPSLMKYILYKGFIGIDGISLTVGEVTPTRFCVHLIPETLQRTTLGAKKLGQRVNIEIDPQTQAVVDTVERVLAAKEAAIIKTVEEE
>NZ_CP046271.1|WP_003857641.1|1930050_1931199_-|cyclopropane-fatty-acyl-phospholipid-synthase
MSSSCIEEVSVPDDNWSRIVSELLGRAGITINGSSPSDPQIKHPDFFKRVLQEGSLGLGESYMDGWWECERLDMFFSSVLRAGLEKQLPRHFKDTLRIASARLFNLQSKKRAWIVGKEHYDLGNDLFSRMLDPLMQYSCGYWKKATTLEEAQQDKLQLICDKLQLQPGMRVLDIGCGWGGLAWFMAKNYGVSVVGVTISAEQQKMAQERCLGLDVDIRLQDYRDLNEQFDRIVSVGMFEHVGPKNYKTYFEVADRNLKPDGIFLLHTIGSKRTDNNVDPWINKYIFPNGCLPSVRQIANASEPHFIVEDWHNFGADYDTTLMAWHERFQAAWPEIADNYSERFKRMFSYYLNACAGAFRARDIQLWQVVFSRGIEHGLRVAR
>NZ_CP046271.1|WP_003857639.1|1931497_1932697_-|Bcr/CflA-family-multidrug-efflux-MFS-transporter
MQPRKGFLVWLGGLSVLGFLATDMYLPAFAAMQEDLQTPAAAISASLSLFLAGFAFAQLLWGPLSDRFGRKPVLLLGLAIFAAGCLGMLWVRDAAWLLALRFIQAVGVCAAAVTWQALVTDYYPASRTNRIFATIMPLVGLSPALAPLLGSWILAHFDWQAIFATLFAITLVLMLPAFGLKPAHKKETHPDAKPITFTSLLRSKAYRGNVLIYAACSASFFAWLTGSPFILHDMGYSPAAIGLSYVPQTIAFLVGGYGCRAALQKWEGQQMLPWLLVLYALSVIATWAVGFIPGAGLAEILIPFCVMAIANGAIYPIVVAQALRPFPQATGRAAALQNTLQLGLCFLASLVVSALIATPLLTTTSVMLITVALAGLGYRMQSSALREQNDNAQTETSHA
>NZ_CP046271.1|WP_003857638.1|1932809_1933721_+|LysR-family-transcriptional-regulator
MWSDYSLEVVDAVARNGSFTGAAQELHRVPSAISYTVRQLEAWLAVPLFERRHRDVELTPAGAWFLKEGRSVIKKMQITREQCQQIANGWRGHLAIAVDNIVKPERTRQMIVDFYRHFSDVELRVSQEVFNGVWDALADGRAEMAIGATQAIPVGGRYAFRDMGMLSWTCVVARDHPLAALEGPLSDDTLRNWPSLVLEDTSRSLPKRITWLLDNQRRVVAPDWESSATCLSAGLCVGMVPVHFARPRIDAGEWVALTLENPFPDAACCLTWQQNDVSPAMAWLLDYLGDSETLNREWLREPA
>NZ_CP046271.1|WP_003857634.1|1933738_1934764_-|HTH-type-transcriptional-repressor-PurR
MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNIEKQRAYLSMMAQKRVDGLLVMCSEYPESVLSMLEEYRHIPMVVMDWGEARADFTDSVIDNAFEGGYMAGRYLVERGHREIGVIPGPLERNTGAGRLAGFMKAMEEALITVPENWIVQGDFEPESGYRAMQQIVSQPHRPTAVFCGGDIMAMGALCAADELGLRVPQDISVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREQSQSIEVHPRLIERRSVADGPFRDYRR
>NZ_CP046271.1|WP_003857632.1|1935061_1935151_+|YnhF-family-membrane-protein
MSTDLKFSLFTTIVVLALIVAGGLTAALH
>NZ_CP046271.1|WP_003857631.1|1935312_1936479_+|MFS-transporter
MKINFPLLALAIGAFGIGTTEFSPMGLLPVIARGVDVSIPAAGMLISAYAIGVMVGAPLMTLLLSHRARRNALIFLMAIFTLGNVFSAISPDYTTLMLSRILTSLNHGAFFGLGSVVAASVVPKHKQASAVATMFMGLTIANIGGVPAATWLGEAIGWRMSFLATAGLGVVAMVALFFSLPKGSAGERPEVRKELAVLMRPQVLSALLTTVLGAGAMFTLYTYISPVLHDITHATPLFVTAMLVLIGVGFSIGNYLGGKFADRSVSGTLKGFLTLLIVIMVAIPWLARNEVGAAIAMVVWGAATFAVVPPLQMRVMRVAHEAPGLSSSVNIGAFNLGNALGAAAGGAVISGGLGYSFVPVMGAIIAALGLLLVIMSGRKQPQAVCTAE
>NZ_CP046271.1|WP_003857629.1|1936516_1937098_-|superoxide-dismutase-[Fe]
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTDFEGKTLEEIVRSSDGGVFNNAAQVWNHTFYWHCLAPNAGGEPDGELAAAINAAFGSFADFKAKFTDAAVKNFGSGWTWLVKEADGKLAIVSTSNAGTPLTTSATPLMTVDVWEHAYYIDYRNARPNYLEHFWALVNWEFVAKNFAA
>NZ_CP046271.1|WP_022650940.1|1937220_1937979_-|C40-family-peptidase
MARITKISMTLCALLFTTLSFTPAANASEQARHSAVQKTHLAKSTERKKKTTSKTVKKKTTAQTKKTASSKTKTLRSGTHKTTRTTASLVNEKCTVRKGHKTKCAKVTKLADVHKARMQKAQKTAMNKLMGQIGKPYRWGGTSPRTGFDCSGLVYYAYKDLVKFRIPRTANEMYHLRDAAPVNRGELQNGDLVFFRTQGRGTADHVGVYVGNGKFIQSPRSGQDIQITSLSEDYWVRHYVGARRVMTPKTIR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046271_1	1.1\|1927538\|38\|NZ_CP046271\|CRISPRCasFinder	1927538-1927575	38	NZ_CP043437	Enterobacter sp. LU1 plasmid unnamed	113727-113764	2	0.947

1. spacer 1.1|1927538|38|NZ_CP046271|CRISPRCasFinder matches to NZ_CP043437 (Enterobacter sp. LU1 plasmid unnamed) position: , mismatch: 2, identity: 0.947

cagacgcaagatggtgcgttcaattggactcgaaccaa	CRISPR spacer
cagacgcagaatggtgcgttcaattggactcgaaccaa	Protospacer
********..****************************

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

908849 : 916444

Enterobacteria_phage(30.0%)

integrase

attL 901265:901279|attR 926951:926965

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
901265:901279	attL	NA	NA	NA	NA
WP_003863199.1\|908849_909902_-	phosphoporin PhoE	Q1MVN1	Enterobacteria_phage	2.6e-118	60.9
WP_003863197.1\|910207_911311_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.7e-59	39.9
WP_003863195.1\|911322_912576_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.3e-97	46.6
WP_003863194.1\|912777_913941_-\|integrase	site-specific integrase	A0A220NQU7	Salmonella_phage	9.1e-221	95.6
WP_003863191.1\|913817_914168_-	helix-turn-helix domain-containing protein	Q5G8V4	Enterobacteria_phage	1.5e-57	95.7
WP_003863189.1\|914170_914380_-	hypothetical protein	A0A220IH74	Escherichia_phage	2.1e-11	59.3
WP_032628143.1\|914416_914965_-	hypothetical protein	E5AGD3	Erwinia_phage	2.3e-20	35.0
WP_003863184.1\|914973_915174_-	hypothetical protein	G8C7S1	Escherichia_phage	1.1e-20	71.2
WP_058652674.1\|915182_915983_-	hypothetical protein	K7P7Q8	Enterobacteria_phage	5.1e-138	85.0
WP_022650433.1\|915982_916444_-	VUT family protein	A0A2H4N7D9	Pectobacterium_phage	4.1e-39	55.7
926951:926965	attR	NA	NA	NA	NA

DBSCAN-SWA_2

1744315 : 1797604

Salmonella_phage(22.41%)

capsid,tRNA,holin,integrase,head,portal,terminase,tail

attL 1739871:1739885|attR 1746681:1746695

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1739871:1739885	attL	NA	NA	NA	NA
WP_003857877.1\|1744315_1744816_-\|tRNA	YbaK/prolyl-tRNA synthetase associated domain-containing protein	NA	NA	NA	NA
WP_117308995.1\|1745035_1746178_-\|integrase	tyrosine-type recombinase/integrase	O21929	Phage_21	2.4e-93	49.0
WP_022650818.1\|1746152_1746416_-	hypothetical protein	NA	NA	NA	NA
WP_117308996.1\|1746448_1746718_-	hypothetical protein	K7PKM4	Enterobacterial_phage	1.6e-32	79.8
1746681:1746695	attR	NA	NA	NA	NA
WP_117308997.1\|1746918_1747644_-	hypothetical protein	M9NZE4	Enterobacteria_phage	9.2e-30	40.4
WP_045617025.1\|1747640_1748468_-	hypothetical protein	K7PKM7	Enterobacterial_phage	2.8e-123	86.3
WP_117309026.1\|1748467_1748881_-	hypothetical protein	K7PJS4	Enterobacterial_phage	6.8e-54	84.7
WP_117308998.1\|1749335_1749794_+	hypothetical protein	NA	NA	NA	NA
WP_152921628.1\|1750172_1750553_-	hypothetical protein	NA	NA	NA	NA
WP_045359139.1\|1750730_1750940_+	hypothetical protein	G8C7T7	Escherichia_phage	2.3e-18	73.4
WP_045359138.1\|1750975_1751332_-	hypothetical protein	G0ZNF1	Cronobacter_phage	2.0e-54	92.4
WP_117308999.1\|1751443_1752262_-	DUF3037 domain-containing protein	NA	NA	NA	NA
WP_126523694.1\|1752258_1752942_-	hypothetical protein	NA	NA	NA	NA
WP_117309001.1\|1753064_1753817_-	helix-turn-helix transcriptional regulator	A0A2I6PIE7	Escherichia_phage	1.1e-73	55.0
WP_117309002.1\|1753851_1754103_+	DNA-binding protein	A0A2I6PIE5	Escherichia_phage	1.0e-12	49.3
WP_047359615.1\|1754131_1754686_+	hypothetical protein	S5FXP0	Shigella_phage	5.4e-46	53.5
WP_032619902.1\|1754849_1755029_+	DUF4222 domain-containing protein	S5M7S5	Escherichia_phage	3.3e-13	69.2
WP_117309003.1\|1755018_1755897_+	GntR family transcriptional regulator	U5P0A0	Shigella_phage	7.7e-39	82.0
WP_063863790.1\|1755893_1756388_+	hypothetical protein	NA	NA	NA	NA
WP_117309004.1\|1756387_1757047_+	DNA methyltransferase	I6PDF5	Cronobacter_phage	7.2e-98	78.1
WP_117309005.1\|1757043_1757271_+	hypothetical protein	NA	NA	NA	NA
WP_117309006.1\|1757267_1757657_+	RusA family crossover junction endodeoxyribonuclease	K7PKN5	Enterobacterial_phage	1.2e-68	95.3
WP_117309007.1\|1757653_1758643_+	DUF968 domain-containing protein	K7PJS6	Enterobacterial_phage	9.6e-179	89.4
WP_117309008.1\|1758657_1759020_+	antitermination protein Q	K7PGW2	Enterobacterial_phage	1.2e-57	92.5
WP_045617010.1\|1759068_1759884_-	TIR domain-containing protein	K7PLZ9	Enterobacterial_phage	1.9e-87	60.3
WP_015570939.1\|1760215_1760641_+	tellurite/colicin resistance protein	Q71TK7	Escherichia_phage	6.6e-60	84.4
WP_017384388.1\|1760637_1760793_+	DUF3927 family protein	S4TRP5	Salmonella_phage	5.0e-10	68.8
WP_017384387.1\|1761521_1761911_+	membrane protein	G8C7V8	Escherichia_phage	1.1e-58	92.2
WP_017384386.1\|1761900_1762179_+\|holin	phage holin family protein	G8C7V9	Escherichia_phage	1.7e-37	85.9
WP_117309009.1\|1762178_1762808_+	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	2.1e-102	88.5
WP_063853303.1\|1762815_1763085_+	hypothetical protein	G8C7W1	Escherichia_phage	1.9e-25	71.9
WP_062939161.1\|1763223_1763601_+	hypothetical protein	A0A192Y658	Salmonella_phage	1.0e-27	57.9
WP_020690713.1\|1763746_1763950_+	hypothetical protein	A0A1W6JPG4	Morganella_phage	1.6e-11	52.9
WP_047719375.1\|1764015_1764204_+	hypothetical protein	A0A2I7RUD6	Vibrio_phage	2.7e-18	77.0
WP_117309011.1\|1764636_1764864_+	hypothetical protein	A0A1L6Z528	Klebsiella_phage	3.3e-18	73.3
WP_117309012.1\|1765530_1766988_+	glycosyltransferase family 2 protein	K7PKP3	Enterobacterial_phage	1.1e-271	91.5
WP_117309013.1\|1767079_1767256_-	ATP-NAD kinase	NA	NA	NA	NA
WP_049019491.1\|1767374_1767944_+	HNH endonuclease	G8IDS8	Mycobacterium_phage	4.4e-19	38.9
WP_117309014.1\|1767940_1768519_+	hypothetical protein	S4TR53	Salmonella_phage	1.8e-92	82.7
WP_045895687.1\|1768511_1768880_+	HNH endonuclease	S4TTG9	Salmonella_phage	1.0e-56	88.5
WP_000954404.1\|1768985_1769480_+\|terminase	terminase small subunit	S4TNN3	Salmonella_phage	1.7e-83	100.0
WP_117309015.1\|1769476_1771138_+\|terminase	terminase large subunit	S4TSQ6	Salmonella_phage	0.0e+00	98.7
WP_049019489.1\|1771196_1773131_+\|capsid	phage major capsid protein	S4TNE3	Salmonella_phage	0.0e+00	93.3
WP_117309016.1\|1773334_1774696_+\|portal	phage portal protein	S4TTG7	Salmonella_phage	1.2e-243	92.7
WP_117309017.1\|1774692_1775910_+\|head,tail	phage gp6-like head-tail connector protein	S4TNN1	Salmonella_phage	6.8e-94	71.6
WP_117309018.1\|1775906_1776233_+\|head,tail	phage gp6-like head-tail connector protein	S4TSQ3	Salmonella_phage	7.5e-48	88.9
WP_063863774.1\|1776241_1776592_+\|head	phage head closure protein	S4TND9	Salmonella_phage	1.1e-52	89.7
WP_117309019.1\|1776588_1777038_+	HK97 gp10 family phage protein	K7P6X4	Enterobacteria_phage	4.9e-74	98.7
WP_117309020.1\|1777034_1777382_+	DUF3168 domain-containing protein	Q9MCS8	Enterobacteria_phage	8.5e-58	97.4
WP_045281469.1\|1777441_1777885_+	hypothetical protein	K7PHL2	Enterobacterial_phage	1.0e-71	93.1
WP_001549114.1\|1777893_1778277_+\|tail	phage tail protein	K7PKV6	Enterobacterial_phage	4.4e-63	93.7
WP_006809154.1\|1778285_1778564_+	DUF4035 domain-containing protein	Q9MCS5	Enterobacteria_phage	1.2e-43	97.8
WP_032634878.1\|1778619_1778955_+	membrane protein	S4TR42	Salmonella_phage	3.0e-52	94.6
WP_117309021.1\|1779001_1782493_+\|tail	phage tail tape measure protein	A0A2H4JHR1	uncultured_Caudovirales_phage	0.0e+00	86.1
WP_022650857.1\|1782495_1782834_+\|tail	phage tail protein	K7PKL8	Enterobacterial_phage	1.1e-38	60.7
WP_016240208.1\|1782830_1783589_+\|tail	phage minor tail protein L	A0A1W6JNX9	Morganella_phage	3.9e-95	63.6
WP_117309022.1\|1783591_1784302_+	C40 family peptidase	F1C573	Cronobacter_phage	1.7e-97	69.8
WP_047731792.1\|1784301_1784886_+\|tail	tail assembly protein	A0A1P8DTG7	Proteus_phage	1.1e-54	53.1
WP_080337223.1\|1784932_1785118_-	hypothetical protein	NA	NA	NA	NA
WP_117309023.1\|1785708_1789554_+	DUF1983 domain-containing protein	Q9MCU0	Escherichia_phage	0.0e+00	63.3
WP_022651029.1\|1789597_1789912_+	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
WP_022651030.1\|1789912_1790584_+	hypothetical protein	A0A2P0WA07	Enterobacter_phage	2.6e-87	73.1
WP_117308971.1\|1790691_1790925_+	cor protein	E4WL42	Enterobacteria_phage	7.3e-29	75.0
WP_155961075.1\|1790983_1792315_+\|tail	phage tail protein	K7PH95	Enterobacterial_phage	2.7e-99	49.9
WP_155961097.1\|1792292_1792820_-	hypothetical protein	A0A220NRP2	Escherichia_phage	3.2e-72	78.4
WP_045350188.1\|1793220_1793769_+	recombinase family protein	A0A1S6L009	Salmonella_phage	2.6e-77	80.6
WP_032665393.1\|1793884_1794307_+	hypothetical protein	K7P834	Enterobacteria_phage	6.0e-21	44.1
WP_117309025.1\|1795074_1796541_+	flagellin FliC	NA	NA	NA	NA
WP_045895310.1\|1796686_1797604_+	helix-turn-helix domain-containing protein	A0A077SL42	Escherichia_phage	8.3e-68	43.6

DBSCAN-SWA_3

2034437 : 2041685

Escherichia_phage(83.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_022651054.1\|2034437_2035115_+	type A chloramphenicol O-acetyltransferase	G3CFL0	Escherichia_phage	1.5e-77	62.6
WP_032609101.1\|2035290_2035602_-	YebG family protein	NA	NA	NA	NA
WP_017384547.1\|2035711_2036326_-	Tat proofreading chaperone DmsD	A0A077SLS7	Escherichia_phage	3.3e-28	34.7
WP_022651056.1\|2036370_2037225_-	dimethyl sulfoxide reductase anchor subunit	A0A077SK59	Escherichia_phage	1.2e-23	34.9
WP_003858259.1\|2037226_2037844_-	dimethylsulfoxide reductase subunit B	A0A077SL61	Escherichia_phage	1.4e-74	59.1
WP_072207423.1\|2037854_2040251_-	dimethyl sulfoxide reductase subunit A	A0A077SK27	Escherichia_phage	4.1e-215	49.5
WP_003857424.1\|2040422_2040728_-	DUF1161 domain-containing protein	NA	NA	NA	NA
WP_003857421.1\|2040830_2041685_-	benzoate transporter	M1I711	Paramecium_bursaria_Chlorella_virus	8.1e-25	33.2

DBSCAN-SWA_4

2336800 : 2415340

Enterobacteria_phage(28.85%)

transposase,tRNA,holin,integrase,plate,terminase,tail

attL 2382857:2382873|attR 2420940:2420956

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003856933.1\|2336800_2337961_+	porin OmpS2	Q1MVN1	Enterobacteria_phage	2.5e-117	59.3
WP_022651250.1\|2337995_2338418_-	GFA family protein	NA	NA	NA	NA
WP_003856931.1\|2338421_2338619_-	hypothetical protein	NA	NA	NA	NA
WP_071785691.1\|2339039_2339240_+\|integrase	tyrosine-type recombinase/integrase	A0A0U2JGI6	Escherichia_phage	1.1e-20	71.7
WP_058652221.1\|2339659_2340337_+	SOS response-associated peptidase	A0A2H4J5W2	uncultured_Caudovirales_phage	3.1e-80	58.7
WP_032734475.1\|2340514_2341360_+	AAA family ATPase	A0A1X9IGI7	Lactococcus_phage	1.6e-33	37.3
WP_058652222.1\|2341352_2341751_+	hypothetical protein	NA	NA	NA	NA
WP_117308969.1\|2341750_2342416_+	hypothetical protein	NA	NA	NA	NA
WP_058652224.1\|2342449_2343718_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	5.3e-230	91.7
WP_058652225.1\|2343720_2344140_-	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1W6JNS2	Morganella_phage	5.5e-35	55.9
WP_000343760.1\|2344236_2345457_+\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_039272126.1\|2345636_2346194_-	recombinase family protein	A0A1S6L009	Salmonella_phage	3.5e-77	78.7
WP_058652226.1\|2347006_2348332_-	hypothetical protein	K7P6I4	Enterobacteria_phage	6.4e-138	60.3
WP_017382566.1\|2348390_2348624_-	hypothetical protein	E4WL42	Enterobacteria_phage	3.9e-30	78.9
WP_045892418.1\|2348731_2349403_-	hypothetical protein	A0A2P0WA07	Enterobacter_phage	1.2e-87	73.5
WP_022651029.1\|2349403_2349718_-	hypothetical protein	A0A2P0WA17	Enterobacter_phage	1.5e-32	64.7
WP_117308972.1\|2349761_2353313_-\|tail	phage tail protein	K7P7D9	Enterobacteria_phage	0.0e+00	89.4
WP_058652901.1\|2353365_2353995_-\|tail	tail assembly protein	K7PGY0	Enterobacteria_phage	1.6e-54	57.9
WP_058652902.1\|2354027_2354738_-	peptidase P60	K7PJX1	Enterobacterial_phage	1.5e-141	95.7
WP_058652903.1\|2354739_2355495_-\|tail	phage minor tail protein L	G8C7J7	Escherichia_phage	5.2e-116	77.6
WP_058652904.1\|2355491_2355839_-\|tail	phage tail protein	I6PBN7	Cronobacter_phage	2.6e-38	63.5
WP_045336370.1\|2355913_2356597_-	hypothetical protein	A0A0R6PJY5	Moraxella_phage	2.4e-40	42.8
WP_058652905.1\|2356710_2359641_-\|tail	phage tail tape measure protein	I6PCW3	Cronobacter_phage	2.6e-131	35.6
WP_080399018.1\|2359637_2359952_-	hypothetical protein	I6PD79	Cronobacter_phage	1.1e-16	65.0
WP_023344275.1\|2359948_2360260_-	hypothetical protein	I6PDG2	Cronobacter_phage	2.4e-35	68.0
WP_058652907.1\|2360322_2360994_-\|tail	phage tail protein	I6PBN6	Cronobacter_phage	4.4e-50	48.4
WP_058652908.1\|2361063_2361474_-	hypothetical protein	I6PDJ8	Cronobacter_phage	1.7e-33	53.6
WP_058652909.1\|2361470_2362055_-	hypothetical protein	G8C7Q1	Escherichia_phage	8.5e-50	55.8
WP_117308973.1\|2362056_2362407_-	hypothetical protein	I6PD77	Cronobacter_phage	8.1e-32	55.2
WP_058652911.1\|2362408_2362891_-	hypothetical protein	A0A2I7RQ74	Vibrio_phage	2.3e-08	31.3
WP_162339398.1\|2362927_2363227_-	hypothetical protein	NA	NA	NA	NA
WP_117308974.1\|2363208_2364162_-	Ig domain-containing protein	A0A1B0VMF8	Pseudomonas_phage	9.0e-134	74.7
WP_058652913.1\|2364173_2364944_-	hypothetical protein	A0A1B0VMG1	Pseudomonas_phage	2.2e-66	59.1
WP_058652914.1\|2365024_2366122_-	hypothetical protein	I6PD76	Cronobacter_phage	9.5e-119	59.1
WP_058652915.1\|2366123_2367512_-	DUF4055 domain-containing protein	A0A1B0VMH0	Pseudomonas_phage	3.3e-124	49.7
WP_058652916.1\|2367513_2368821_-\|terminase	terminase	A0A1B1P9C9	Acinetobacter_phage	5.0e-143	57.3
WP_022651282.1\|2368798_2369797_-\|terminase	terminase small subunit	I6X6R5	Burkholderia_virus	1.1e-38	43.4
WP_057059589.1\|2369843_2370293_-	hypothetical protein	NA	NA	NA	NA
WP_058652968.1\|2372013_2372289_-	hypothetical protein	G8C7W1	Escherichia_phage	2.4e-31	83.3
WP_058652917.1\|2372296_2372926_-	glycoside hydrolase family 19 protein	G8C7W0	Escherichia_phage	4.6e-102	87.6
WP_022651286.1\|2372925_2373207_-\|holin	phage holin family protein	K7PKN9	Enterobacterial_phage	1.3e-19	46.2
WP_015570936.1\|2373193_2373580_-	hypothetical protein	A0A192Y8P2	Salmonella_phage	3.2e-45	78.1
WP_058652918.1\|2374365_2374557_-	hypothetical protein	NA	NA	NA	NA
WP_058652919.1\|2375082_2375916_-	antitermination protein	K7PKS8	Enterobacteria_phage	1.4e-122	78.7
WP_032645711.1\|2375912_2376275_-	RusA family crossover junction endodeoxyribonuclease	K7PM48	Enterobacteria_phage	5.2e-50	83.1
WP_058652920.1\|2376482_2377085_-	DUF1367 family protein	A0A0M4QX23	Salmonella_phage	3.1e-95	83.0
WP_028013336.1\|2377472_2377697_-	DinI family protein	K7PM44	Enterobacteria_phage	4.7e-25	71.4
WP_000343760.1\|2377797_2379018_+\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_058652921.1\|2379386_2379836_-	VOC family protein	NA	NA	NA	NA
WP_117308975.1\|2380323_2381505_+	diguanylate phosphodiesterase	NA	NA	NA	NA
WP_045903081.1\|2381776_2382433_+	TetR family transcriptional regulator	NA	NA	NA	NA
WP_058652923.1\|2382494_2383478_-	oxidoreductase	NA	NA	NA	NA
2382857:2382873	attL	NA	NA	NA	NA
WP_058652924.1\|2383921_2384140_-	hypothetical protein	NA	NA	NA	NA
WP_014832179.1\|2384443_2384893_-	carboxymuconolactone decarboxylase family protein	NA	NA	NA	NA
WP_058652926.1\|2385169_2385856_-	phage replication protein	G8C7U6	Escherichia_phage	6.4e-81	63.4
WP_080399019.1\|2385852_2386710_-	hypothetical protein	K7PGZ0	Enterobacteria_phage	2.9e-99	70.1
WP_058652928.1\|2386854_2387406_-	hypothetical protein	K7PJT7	Enterobacteria_phage	5.7e-32	46.4
WP_058652929.1\|2387408_2387627_-	Rha family transcriptional regulator	K7PKS2	Enterobacteria_phage	9.2e-18	57.7
WP_058652930.1\|2387724_2388108_+	hypothetical protein	K7PHG0	Enterobacteria_phage	1.7e-46	76.4
WP_058652931.1\|2388275_2389415_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_058652932.1\|2389411_2389924_+	DUF4411 family protein	NA	NA	NA	NA
WP_058652934.1\|2390700_2393973_+	exodeoxyribonuclease	K7P6V4	Enterobacteria_phage	0.0e+00	68.4
WP_058652935.1\|2393983_2395069_+	recombinase RecT	K7PKR8	Enterobacteria_phage	2.0e-121	63.1
WP_020882485.1\|2395107_2395350_+	DUF4060 family protein	K7PHF4	Enterobacteria_phage	1.3e-33	93.6
WP_014884030.1\|2395414_2395627_+	DUF1233 family excisionase	A0A0U2RY08	Escherichia_phage	4.3e-20	64.8
WP_058652936.1\|2395628_2396867_+\|integrase	site-specific integrase	A0A0U2JGI6	Escherichia_phage	1.0e-169	70.5
WP_155961080.1\|2396905_2397841_+\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	5.2e-142	95.3
WP_003856922.1\|2397884_2399258_-	ATP-dependent RNA helicase DbpA	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.1e-50	31.6
WP_003856916.1\|2399742_2400726_-	zinc transporter ZntB	NA	NA	NA	NA
WP_080399020.1\|2400816_2401947_-	chemoreceptor protein	A0A2H4J162	uncultured_Caudovirales_phage	2.6e-10	28.6
WP_058652938.1\|2402263_2402752_-	hypothetical protein	NA	NA	NA	NA
WP_022651307.1\|2402780_2404097_-	type VI secretion system protein VasL	NA	NA	NA	NA
WP_022651308.1\|2404120_2404576_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_003856903.1\|2405721_2406246_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_126519048.1\|2406809_2407085_-	hypothetical protein	NA	NA	NA	NA
WP_003856902.1\|2407130_2407604_-	hypothetical protein	NA	NA	NA	NA
WP_022651313.1\|2410233_2411241_-	hypothetical protein	NA	NA	NA	NA
WP_039268915.1\|2411230_2413693_-	type VI secretion system tip protein VgrG	NA	NA	NA	NA
WP_022651315.1\|2413697_2414222_-	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_022651316.1\|2414257_2415340_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
2420940:2420956	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2795822 : 2831157

Escherichia_phage(30.77%)

integrase,holin,transposase

attL 2788990:2789003|attR 2831382:2831395

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2788990:2789003	attL	NA	NA	NA	NA
WP_044704326.1\|2795822_2797091_-	Y-family DNA polymerase	I6RSM4	Salmonella_phage	6.9e-230	91.7
WP_044704327.1\|2797090_2797396_-	hypothetical protein	K7PGV5	Enterobacterial_phage	2.3e-14	42.6
WP_044704329.1\|2797506_2797869_+	GtrA family protein	U5P0S6	Shigella_phage	9.9e-49	83.3
WP_044704331.1\|2797865_2798792_+	glycosyltransferase family 2 protein	U5P087	Shigella_phage	3.9e-158	91.4
WP_001310555.1\|2799084_2800101_+\|transposase	IS5-like element IS5 family transposase	Q38213	Escherichia_phage	9.8e-187	99.7
WP_155961082.1\|2800304_2801450_+	hypothetical protein	NA	NA	NA	NA
WP_155961083.1\|2801914_2804338_-	hypothetical protein	G0XNW5	Escherichia_phage	3.2e-143	40.0
WP_155961084.1\|2804393_2806871_-	MoaD/ThiS family protein	F1C5A7	Cronobacter_phage	0.0e+00	92.8
WP_032677284.1\|2806857_2807223_-	C40 family peptidase	F1C5F2	Cronobacter_phage	1.6e-62	90.8
WP_015571561.1\|2807236_2807707_-	hypothetical protein	F1C5F1	Cronobacter_phage	1.0e-66	80.1
WP_038416175.1\|2807706_2808204_-	hypothetical protein	F1C5F0	Cronobacter_phage	4.6e-89	90.9
WP_087451024.1\|2808448_2809569_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_003859853.1\|2809871_2810102_-	hypothetical protein	NA	NA	NA	NA
WP_003859849.1\|2810701_2811220_-	Rha family transcriptional regulator	Q38450	Enterobacteria_phage	6.1e-92	98.2
WP_003859846.1\|2811689_2811968_-	hypothetical protein	NA	NA	NA	NA
WP_003859844.1\|2811964_2812507_-	glycoside hydrolase family 108 protein	A0A0U2S643	Escherichia_phage	1.2e-74	70.4
WP_001514184.1\|2812509_2812785_-\|holin	phage holin family protein	S4TNV9	Salmonella_phage	5.8e-09	41.0
WP_155961086.1\|2812781_2813183_-	hypothetical protein	NA	NA	NA	NA
WP_155961087.1\|2813512_2814013_-	antiterminator	G8C7V7	Escherichia_phage	7.2e-90	95.7
WP_155961088.1\|2814312_2814954_-	NinG family protein	M9NYX8	Enterobacteria_phage	3.5e-105	93.9
WP_044704910.1\|2814946_2815117_-	NinE family protein	G8C7V4	Escherichia_phage	1.2e-20	85.7
WP_032647533.1\|2815109_2815559_-	recombination protein NinB	I6R9D0	Salmonella_phage	2.5e-33	47.2
WP_013095965.1\|2815743_2815965_-	hypothetical protein	G8C7V2	Escherichia_phage	6.4e-35	100.0
WP_013095964.1\|2815967_2816210_-	DNA polymerase III subunit theta	G8C7V1	Escherichia_phage	1.5e-37	96.2
WP_044704913.1\|2816209_2816536_-	hypothetical protein	NA	NA	NA	NA
WP_130027228.1\|2816607_2816799_-	hypothetical protein	NA	NA	NA	NA
WP_047736909.1\|2816795_2817419_-	DUF551 domain-containing protein	S4TSR6	Salmonella_phage	1.5e-33	36.9
WP_044704916.1\|2817415_2817613_-	hypothetical protein	K7PKS4	Enterobacteria_phage	1.8e-25	92.3
WP_044704918.1\|2817609_2817954_-	winged helix-turn-helix transcriptional regulator	G8C7U7	Escherichia_phage	2.2e-50	88.5
WP_044704919.1\|2817950_2818826_-	ATP-binding protein	K7PLU3	Enterobacteria_phage	5.8e-103	66.2
WP_044704922.1\|2818810_2819680_-	replication protein	K7PGT1	Enterobacteria_phage	3.9e-67	51.2
WP_044704924.1\|2819765_2820308_-	hypothetical protein	M9NZI6	Enterobacteria_phage	6.6e-89	92.2
WP_022650973.1\|2820338_2820557_-	helix-turn-helix transcriptional regulator	A0A0N7C2U7	Escherichia_phage	1.9e-10	47.0
WP_155961089.1\|2820665_2821325_+	helix-turn-helix domain-containing protein	F1C599	Cronobacter_phage	1.2e-71	65.6
WP_044704986.1\|2821437_2821851_+	hypothetical protein	NA	NA	NA	NA
WP_155961090.1\|2821860_2822340_+	hypothetical protein	NA	NA	NA	NA
WP_044704990.1\|2822341_2822581_+	hypothetical protein	NA	NA	NA	NA
WP_046695766.1\|2822713_2822911_-	hypothetical protein	G8C7T7	Escherichia_phage	3.5e-24	90.6
WP_154816751.1\|2823247_2823424_+	hypothetical protein	NA	NA	NA	NA
WP_072056244.1\|2823804_2824110_+	superinfection exclusion protein	Q76H37	Enterobacteria_phage	2.7e-39	76.3
WP_044856894.1\|2824261_2824468_+	cell division protein FtsZ	G8C7T2	Escherichia_phage	1.1e-31	98.5
WP_155961091.1\|2824546_2824831_+	host nuclease inhibitor GamL	G8C7T1	Escherichia_phage	5.0e-48	94.7
WP_063840721.1\|2824849_2825695_+	phage recombination protein Bet	A0A1I9KF88	Aeromonas_phage	1.8e-69	61.2
WP_047028426.1\|2825691_2826372_+	YqaJ viral recombinase family protein	M9NZE1	Enterobacteria_phage	8.4e-126	94.2
WP_063840722.1\|2826368_2826797_+	hypothetical protein	M9NYX4	Enterobacteria_phage	1.5e-72	96.5
WP_059360873.1\|2826793_2826946_+	DUF1317 family protein	T1SAR0	Salmonella_phage	2.1e-05	44.2
WP_155961098.1\|2827755_2828316_+	phage N-6-adenine-methyltransferase	E5AGF8	Erwinia_phage	4.9e-55	58.3
WP_155961092.1\|2828312_2828531_+	hypothetical protein	NA	NA	NA	NA
WP_017693148.1\|2829036_2829510_+	hypothetical protein	NA	NA	NA	NA
WP_014070846.1\|2829570_2829816_+	excisionase family protein	Q8W657	Enterobacteria_phage	9.4e-27	67.9
WP_044704474.1\|2829861_2831157_+\|integrase	site-specific integrase	Q20GI2	Phage_258-320	8.7e-180	68.6
2831382:2831395	attR	NA	NA	NA	NA

DBSCAN-SWA_6

2915058 : 2922804

Bodo_saltans_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003859480.1\|2915058_2915670_+	bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE	A0A2H4UVM0	Bodo_saltans_virus	2.1e-14	29.3
WP_003859479.1\|2915708_2916689_-	LPS O-antigen chain length determinant protein WzzB	NA	NA	NA	NA
WP_003859478.1\|2916881_2917886_+	NAD-dependent epimerase	A0A2K9L0I7	Tupanvirus	1.1e-33	29.3
WP_003859477.1\|2917934_2919101_-	UDP-glucose 6-dehydrogenase	A0A1J0FA55	Only_Syngen_Nebraska_virus	4.1e-112	54.0
WP_058652854.1\|2919340_2920222_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	5.8e-103	62.0
WP_003859475.1\|2920222_2921308_-	dTDP-glucose 4,6-dehydratase	A0A291LAD7	Escherichia_phage	3.7e-99	52.6
WP_003859473.1\|2921397_2922804_-	NADP-dependent phosphogluconate dehydrogenase	M4QQM4	Ostreococcus_lucimarinus_virus	3.1e-37	28.3

DBSCAN-SWA_7

4008166 : 4107222

uncultured_Caudovirales_phage(40.0%)

transposase,capsid,tRNA,integrase,protease,head,portal,terminase,tail

attL 4068835:4068882|attR 4086932:4086979

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_058652661.1\|4008166_4011022_+\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	1.6e-141	36.9
WP_003861887.1\|4011145_4011649_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_003861889.1\|4011732_4012752_+	NAD(P)-dependent alcohol dehydrogenase	A0A0G2Y405	Acanthamoeba_polyphaga_mimivirus	5.4e-44	30.7
WP_022651917.1\|4012899_4014546_-	DAK2 domain-containing protein	NA	NA	NA	NA
WP_022651918.1\|4014683_4016186_+	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	5.7e-82	43.6
WP_096888951.1\|4016165_4017107_-	TIGR01212 family radical SAM protein	A0A2H4PQV5	Staphylococcus_phage	6.8e-17	34.4
WP_058652662.1\|4017794_4022255_+	glutamate synthase large subunit	NA	NA	NA	NA
WP_003860453.1\|4022264_4023683_+	glutamate synthase subunit GltD	NA	NA	NA	NA
WP_003860450.1\|4023739_4024411_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_003860449.1\|4024609_4025275_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_103883337.1\|4025443_4026016_-	hypothetical protein	NA	NA	NA	NA
WP_058652663.1\|4026006_4028424_-	fimbrial biogenesis outer membrane usher protein	NA	NA	NA	NA
WP_003860443.1\|4028438_4029143_-	fimbria/pilus periplasmic chaperone	NA	NA	NA	NA
WP_023323800.1\|4029271_4029949_-	DUF1120 domain-containing protein	NA	NA	NA	NA
WP_003860440.1\|4030319_4030817_-\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	2.9e-27	54.6
WP_003860438.1\|4030822_4031461_-	stringent starvation protein A	NA	NA	NA	NA
WP_003860436.1\|4031768_4032161_-	30S ribosomal protein S9	NA	NA	NA	NA
WP_003860434.1\|4032176_4032605_-	50S ribosomal protein L13	NA	NA	NA	NA
WP_003860433.1\|4032897_4034022_-	cell division protein ZapE	NA	NA	NA	NA
WP_003860432.1\|4034211_4034610_+	DUF1043 family protein	NA	NA	NA	NA
WP_003860431.1\|4034780_4036148_+\|protease	serine endoprotease DegQ	A0A1B1IT49	uncultured_Mediterranean_phage	5.1e-21	26.4
WP_003860430.1\|4036240_4037308_+	outer membrane-stress sensor serine endopeptidase DegS	NA	NA	NA	NA
WP_003860429.1\|4037359_4038298_-	malate dehydrogenase	NA	NA	NA	NA
WP_003860428.1\|4038695_4039166_+	transcriptional regulator ArgR	NA	NA	NA	NA
WP_003860426.1\|4039544_4039808_+	peroxide/acid stress response protein YhcN	NA	NA	NA	NA
WP_003860424.1\|4039867_4040140_-	hypothetical protein	NA	NA	NA	NA
WP_003860422.1\|4040185_4041640_-	NAD-dependent succinate-semialdehyde dehydrogenase	NA	NA	NA	NA
WP_058648370.1\|4041726_4043694_-	p-hydroxybenzoic acid efflux pump subunit AaeB	NA	NA	NA	NA
WP_048209694.1\|4043699_4044632_-	p-hydroxybenzoic acid efflux pump subunit AaeA	NA	NA	NA	NA
WP_003860416.1\|4044639_4044843_-	AaeX family protein	NA	NA	NA	NA
WP_003860415.1\|4045022_4045949_+	HTH-type transcriptional activator AaeR	NA	NA	NA	NA
WP_003860414.1\|4045998_4047444_-\|protease	metalloprotease TldD	NA	NA	NA	NA
WP_058652664.1\|4047527_4051334_-	AsmA2 domain-containing protein	NA	NA	NA	NA
WP_003860405.1\|4051376_4052846_-	ribonuclease G	NA	NA	NA	NA
WP_003860403.1\|4052835_4053429_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_003860402.1\|4053438_4053927_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_003860400.1\|4053926_4054943_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000913396.1\|4055005_4056049_-	rod shape-determining protein MreB	F2Y0P3	Organic_Lake_phycodnavirus	6.7e-05	22.3
WP_003860399.1\|4056331_4058272_-	RNase E specificity factor CsrD	NA	NA	NA	NA
WP_003860398.1\|4058454_4059429_+	oxidoreductase	NA	NA	NA	NA
WP_003860395.1\|4059506_4060508_+	protein-methionine-sulfoxide reductase catalytic subunit MsrP	NA	NA	NA	NA
WP_003860393.1\|4060508_4061108_+	protein-methionine-sulfoxide reductase heme-binding subunit MsrQ	NA	NA	NA	NA
WP_003860391.1\|4061342_4061795_+	type II 3-dehydroquinate dehydratase	NA	NA	NA	NA
WP_003860389.1\|4061816_4062281_+	acetyl-CoA carboxylase biotin carboxyl carrier protein	NA	NA	NA	NA
WP_003860388.1\|4062291_4063641_+	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_003860385.1\|4063749_4063992_+	YhdT family protein	NA	NA	NA	NA
WP_058652665.1\|4063981_4065433_+	sodium/pantothenate symporter	NA	NA	NA	NA
WP_003860381.1\|4065444_4066326_+	50S ribosomal protein L11 methyltransferase	NA	NA	NA	NA
WP_003860379.1\|4066463_4067204_+	carbonic anhydrase family protein	NA	NA	NA	NA
WP_003860376.1\|4067533_4068499_+\|tRNA	tRNA dihydrouridine synthase DusB	NA	NA	NA	NA
WP_000462905.1\|4068522_4068819_+	DNA-binding transcriptional regulator Fis	NA	NA	NA	NA
4068835:4068882	attL	NA	NA	NA	NA
WP_072206014.1\|4069170_4069764_-\|tail	tail assembly protein	F1C572	Cronobacter_phage	5.9e-51	51.8
WP_023309412.1\|4069796_4071458_-\|terminase	terminase large subunit	A0A2H4JB64	uncultured_Caudovirales_phage	0.0e+00	97.8
WP_023326190.1\|4071441_4071798_-\|terminase	phage terminase small subunit P27 family	A0A2H4JHS3	uncultured_Caudovirales_phage	4.6e-59	95.8
WP_001145894.1\|4072071_4072515_-	HNH endonuclease	A0A2H4JAS8	uncultured_Caudovirales_phage	1.1e-49	63.3
WP_000123150.1\|4072514_4072808_-\|head,tail	phage gp6-like head-tail connector protein	A0A2H4JD08	uncultured_Caudovirales_phage	2.7e-44	85.6
WP_001201224.1\|4072804_4073143_-\|head	phage head closure protein	A0A2H4JHK5	uncultured_Caudovirales_phage	1.8e-52	90.2
WP_023326191.1\|4073139_4074375_-\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	1.5e-237	97.3
WP_019077813.1\|4074376_4074937_-\|head,protease	HK97 family phage prohead protease	A0A2H4JB68	uncultured_Caudovirales_phage	3.5e-101	98.9
WP_019077814.1\|4074988_4076155_-\|capsid	phage major capsid protein	A0A2H4JED2	uncultured_Caudovirales_phage	4.4e-215	99.5
WP_032660547.1\|4076397_4076880_-	hypothetical protein	NA	NA	NA	NA
WP_032672061.1\|4076881_4077943_-	hypothetical protein	U5P4L0	Shigella_phage	6.6e-69	40.1
WP_032672062.1\|4078083_4078344_-	hypothetical protein	NA	NA	NA	NA
WP_087451024.1\|4078424_4079545_-\|transposase	IS3-like element ISSen4 family transposase	S5WIU1	Leptospira_phage	1.7e-51	42.8
WP_032672063.1\|4079844_4081614_-	DNA primase	Q7M2A8	Enterobacteria_phage	6.2e-128	51.6
WP_021538179.1\|4081597_4081789_-	DUF4222 domain-containing protein	NA	NA	NA	NA
WP_021538180.1\|4081775_4081991_-	hypothetical protein	NA	NA	NA	NA
WP_058652666.1\|4081987_4082182_-	hypothetical protein	NA	NA	NA	NA
WP_161646063.1\|4082160_4082667_-	host cell division inhibitor Icd-like protein	A0A2H4JGN8	uncultured_Caudovirales_phage	2.9e-06	42.0
WP_019077824.1\|4083955_4084240_-	AlpA family phage regulatory protein	NA	NA	NA	NA
WP_019077825.1\|4084860_4085511_-	hypothetical protein	NA	NA	NA	NA
WP_023326200.1\|4085510_4086731_-\|integrase	site-specific integrase	A0A2H4JB45	uncultured_Caudovirales_phage	1.6e-154	63.0
WP_003860373.1\|4087094_4087259_+	DUF2556 family protein	NA	NA	NA	NA
4086932:4086979	attR	NA	NA	NA	NA
WP_003860371.1\|4087399_4089484_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	7.0e-22	34.8
WP_003860370.1\|4089478_4090126_-	acrEF/envCD operon transcriptional regulator	NA	NA	NA	NA
WP_003860367.1\|4090524_4091664_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_003860366.1\|4091675_4094789_+	multidrug efflux RND transporter permease subunit	NA	NA	NA	NA
WP_003860364.1\|4095037_4095259_+	lipoprotein	NA	NA	NA	NA
WP_003863357.1\|4101299_4101854_+	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_022651937.1\|4101829_4102078_-	DUF1488 domain-containing protein	NA	NA	NA	NA
WP_022651938.1\|4102074_4102893_-	shikimate dehydrogenase	NA	NA	NA	NA
WP_003863353.1\|4102897_4103470_-	L-threonylcarbamoyladenylate synthase type 1 TsaC	S4VW33	Pandoravirus	1.9e-09	25.7
WP_003863351.1\|4103462_4104017_-	hypothetical protein	NA	NA	NA	NA
WP_000460665.1\|4104043_4104517_-	DUF494 domain-containing protein	NA	NA	NA	NA
WP_003863350.1\|4104488_4105613_-	DNA-protecting protein DprA	NA	NA	NA	NA
WP_006812188.1\|4105740_4106250_+	peptide deformylase	E3SLL2	Synechococcus_phage	3.3e-18	40.3
WP_003863341.1\|4106274_4107222_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	1.1e-06	30.5

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP046274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

36834 : 44611

Escherichia_phage(57.14%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001067855.1\|36834_37539_-\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_002904004.1\|37675_38536_+	class A extended-spectrum beta-lactamase SHV-12	A0A077SL40	Escherichia_phage	2.2e-155	99.3
WP_002210513.1\|38556_39318_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.9e-134	100.0
WP_001067855.1\|40158_40863_+\|transposase	IS6-like element IS26 family transposase	A0A077SL39	Escherichia_phage	1.8e-139	100.0
WP_001549892.1\|41255_41495_-	hypothetical protein	I6PD82	Cronobacter_phage	4.4e-21	55.1
WP_000343760.1\|41596_42817_+\|transposase	ISL3-like element ISKox3 family transposase	NA	NA	NA	NA
WP_001549893.1\|42905_43568_-	recombinase family protein	M9Q1K0	Clostridium_phage	9.7e-10	29.1
WP_000516402.1\|43948_44611_+	peptidyl-arginine deiminase	E5FFJ3	Burkholderia_phage	2.6e-07	25.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046273

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046272

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046271

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP046274

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection