CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046342	Burkholderia multivorans strain FDAARGOS_726 chromosome 2, complete sequence	0 crisprs	csa3	0	56
NZ_CP046343	Burkholderia multivorans strain FDAARGOS_726 chromosome 3, complete sequence	1 crisprs	DEDDh,csa3,WYL,cas3,DinG	0	3
NZ_CP046341	Burkholderia multivorans strain FDAARGOS_726 chromosome 1, complete sequence	1 crisprs	WYL,csa3,cas3,DinG	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 14050

uncultured_Mediterranean_phage(25.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818130.1\|1356_2217_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_155818132.1\|2371_8296_-	excinuclease ABC subunit A	A0A1B1IVR3	uncultured_Mediterranean_phage	1.4e-187	38.1
WP_155818134.1\|8468_9470_-	SDR family oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	1.0e-74	53.3
WP_155818136.1\|9592_9883_-	hypothetical protein	NA	NA	NA	NA
WP_060111290.1\|10407_12690_+	response regulator	Q8QKV4	Ectocarpus_siliculosus_virus	4.5e-14	26.4
WP_006413433.1\|13057_13222_-	hypothetical protein	NA	NA	NA	NA
WP_039224161.1\|13289_13625_-	DUF2934 domain-containing protein	NA	NA	NA	NA
WP_059874562.1\|13624_14050_-	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	7.1e-14	39.7

DBSCAN-SWA_2

29545 : 31138

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818158.1\|29545_31138_-	DHA2 family efflux MFS transporter permease subunit	A0A0M3UL24	Mycobacterium_phage	9.1e-30	30.1

DBSCAN-SWA_3

38357 : 42005

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039224194.1\|38357_39101_-	FRG domain-containing protein	A0A1S6KZX9	Salmonella_phage	3.3e-06	29.3
WP_155818166.1\|39142_40156_-	ubiquinol oxidase subunit II	NA	NA	NA	NA
WP_155818168.1\|40142_41570_-	cytochrome ubiquinol oxidase subunit I	NA	NA	NA	NA
WP_012217915.1\|41612_42005_-	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	8.8e-11	38.9

DBSCAN-SWA_4

45277 : 46378

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818174.1\|45277_46378_-	mandelate racemase	Q6A202	Oenococcus_phage	1.1e-13	24.0

DBSCAN-SWA_5

58720 : 59416

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405126.1\|58720_59416_+	MgtC/SapB family protein	G3MA03	Bacillus_virus	6.6e-17	44.2

DBSCAN-SWA_6

84021 : 90413

Yellowstone_lake_phycodnavirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398946.1\|84021_84591_-	type 1 glutamine amidotransferase	A0A0N7KVR4	Yellowstone_lake_phycodnavirus	5.8e-19	33.9
WP_006415261.1\|84911_85274_-	hypothetical protein	NA	NA	NA	NA
WP_155818223.1\|85360_85744_-	hypothetical protein	NA	NA	NA	NA
WP_155818226.1\|85898_86255_+	DUF3175 domain-containing protein	A0A0F6TH17	Sinorhizobium_phage	7.7e-22	62.8
WP_006398942.1\|86294_87614_+	cation transporter	NA	NA	NA	NA
WP_155818229.1\|87620_90413_-	DNA ligase D	A0A068CDF3	Rhizobium_phage	1.1e-54	40.1

DBSCAN-SWA_7

96700 : 99222

Macacine_betaherpesvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398926.1\|96700_97132_+	CBS domain-containing protein	A0A2I6B2H4	Macacine_betaherpesvirus	2.5e-14	38.0
WP_006398925.1\|97220_97706_+	PRC-barrel domain containing protein	NA	NA	NA	NA
WP_006398924.1\|97808_98357_-	response regulator	NA	NA	NA	NA
WP_155818239.1\|98445_99222_+	UdgX family uracil-DNA binding protein	A0A127AW33	Bacillus_phage	1.1e-12	29.9

DBSCAN-SWA_8

103088 : 103946

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088927612.1\|103088_103946_-	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	7.8e-52	43.0

DBSCAN-SWA_9

108077 : 111447

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006398911.1\|108077_109124_+	SDR family oxidoreductase	A0A2K9KZK0	Tupanvirus	1.6e-78	45.4
WP_155818245.1\|109143_111447_-	PAS domain-containing protein	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-20	26.3

DBSCAN-SWA_10

118994 : 123309

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818257.1\|118994_120740_-	carbamoyltransferase	A0A1B1ITZ5	uncultured_Mediterranean_phage	3.3e-49	29.5
WP_155818260.1\|120743_121961_-	glycosyl transferase	NA	NA	NA	NA
WP_006398899.1\|121957_122569_-	HAD-IIIA family hydrolase	NA	NA	NA	NA
WP_006398898.1\|122559_123309_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	9.9e-11	27.5

DBSCAN-SWA_11

128782 : 138469

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_105836577.1\|128782_130369_+	PAS domain S-box protein	W8CYF6	Bacillus_phage	6.5e-20	28.4
WP_012217865.1\|130379_130730_-	four-helix bundle copper-binding protein	NA	NA	NA	NA
WP_006398890.1\|130732_131938_-	glutathione-dependent formaldehyde dehydrogenase	NA	NA	NA	NA
WP_155818269.1\|131936_132308_+	hypothetical protein	NA	NA	NA	NA
WP_006398888.1\|132283_133120_-	ABC transporter permease	NA	NA	NA	NA
WP_155818272.1\|133150_134416_-	ABC transporter permease subunit	Q6GZ02	Mycoplasma_phage	2.1e-05	23.1
WP_006398886.1\|134546_135593_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_006398885.1\|135685_136792_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.6e-25	32.0
WP_088927603.1\|136996_138469_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	2.7e-20	24.1

DBSCAN-SWA_12

144074 : 145235

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818287.1\|144074_145235_+	NAD-dependent formate dehydrogenase	A0A1B1IVB5	uncultured_Mediterranean_phage	5.5e-16	26.1

DBSCAN-SWA_13

152167 : 155020

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818297.1\|152167_155020_+	AAA domain-containing protein	A0A223W0B1	Agrobacterium_phage	1.8e-124	35.2

DBSCAN-SWA_14

183381 : 184917

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818334.1\|183381_184917_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.1e-19	40.7

DBSCAN-SWA_15

193204 : 193726

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012217820.1\|193204_193726_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.6e-26	41.9

DBSCAN-SWA_16

200130 : 201273

Oenococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818352.1\|200130_201273_-	mandelate racemase/muconate lactonizing enzyme family protein	Q6A202	Oenococcus_phage	2.8e-12	26.1

DBSCAN-SWA_17

208795 : 210430

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818356.1\|208795_210430_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	2.7e-29	28.3

DBSCAN-SWA_18

213461 : 214181

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006402891.1\|213461_214181_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-33	34.1

DBSCAN-SWA_19

228583 : 231042

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818386.1\|228583_229351_-	SDR family NAD(P)-dependent oxidoreductase	F2NZ40	Diadromus_pulchellus_ascovirus	5.2e-07	30.5
WP_155818390.1\|229374_231042_-	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	7.5e-83	40.9

DBSCAN-SWA_20

240641 : 241166

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818396.1\|240641_241166_-	HD domain-containing protein	A0A1B1IUF0	uncultured_Mediterranean_phage	8.1e-44	53.1

DBSCAN-SWA_21

256864 : 258163

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818408.1\|256864_258163_-	adenylosuccinate synthase	A0A2P1EKE7	Megavirus	3.2e-57	33.8

DBSCAN-SWA_22

263764 : 264460

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006399349.1\|263764_264460_-	ParA family protein	D4HTX7	Vibrio_phage	9.8e-21	31.4

DBSCAN-SWA_23

280536 : 281541

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059873204.1\|280536_281541_+	cyclodeaminase	A0A1V0SL93	Klosneuvirus	1.4e-12	26.7

DBSCAN-SWA_24

285909 : 290531

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818421.1\|285909_287304_+	aminotransferase class III-fold pyridoxal phosphate-dependent enzyme	B5LM99	Mycobacterium_phage	1.6e-06	28.0
WP_155818422.1\|287499_288432_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_155818423.1\|288649_289660_-	multidrug transporter	NA	NA	NA	NA
WP_105835181.1\|289778_290531_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.3e-12	30.1

DBSCAN-SWA_25

304273 : 305596

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818432.1\|304273_305596_+	MFS transporter	Q6JIH2	Burkholderia_virus	1.4e-63	35.9

DBSCAN-SWA_26

316417 : 317236

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035956903.1\|316417_317236_-	alpha/beta fold hydrolase	A0A286MQ79	Mycobacterium_phage	6.0e-09	26.6

DBSCAN-SWA_27

323219 : 327394

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818440.1\|323219_324326_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	7.7e-28	35.3
WP_155818441.1\|324337_325045_+	FCD domain-containing protein	NA	NA	NA	NA
WP_006414453.1\|325089_325476_-	MerR family transcriptional regulator	NA	NA	NA	NA
WP_155818442.1\|325562_326507_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_035956884.1\|326596_327394_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.1e-20	33.2

DBSCAN-SWA_28

334165 : 335023

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818448.1\|334165_335023_+	SDR family NAD(P)-dependent oxidoreductase	W8CYX9	Bacillus_phage	1.0e-06	41.3

DBSCAN-SWA_29

342238 : 343804

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_059873236.1\|342238_343804_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	9.0e-14	33.8

DBSCAN-SWA_30

350956 : 351826

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_039223518.1\|350956_351826_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.2e-06	30.1

DBSCAN-SWA_31

359958 : 360846

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012464833.1\|359958_360846_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.0e-22	28.4

DBSCAN-SWA_32

374469 : 375291

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818469.1\|374469_375291_-	alpha/beta fold hydrolase	A0A249XU20	Mycobacterium_phage	4.4e-12	26.1

DBSCAN-SWA_33

398839 : 399340

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818481.1\|398839_399340_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	A0A0P0IVM8	Acinetobacter_phage	2.8e-09	28.9

DBSCAN-SWA_34

416944 : 421394

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818493.1\|416944_418798_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.0e-29	26.4
WP_039223640.1\|419075_419642_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006399225.1\|419874_420300_+	organic hydroperoxide resistance protein	NA	NA	NA	NA
WP_155818494.1\|420359_421394_+	alpha/beta hydrolase fold domain-containing protein	M1PGN2	Moumouvirus	5.1e-58	39.2

DBSCAN-SWA_35

434280 : 438057

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818502.1\|434280_435201_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.8e-33	40.7
WP_155818503.1\|435200_436079_+	ABC transporter permease subunit	NA	NA	NA	NA
WP_006416915.1\|436519_436933_+	DoxX family protein	NA	NA	NA	NA
WP_155818504.1\|437064_438057_+	sugar nucleotide-binding protein	K7QJU0	Escherichia_phage	3.5e-11	26.8

DBSCAN-SWA_36

465340 : 466756

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818521.1\|465340_466756_+	MFS transporter	A0A0M3UL24	Mycobacterium_phage	3.1e-37	32.3

DBSCAN-SWA_37

469867 : 471256

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818524.1\|469867_471256_+	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	9.1e-18	25.6

DBSCAN-SWA_38

484344 : 485415

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818533.1\|484344_485415_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	6.8e-29	34.0

DBSCAN-SWA_39

491625 : 492540

Lactobacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006405325.1\|491625_492540_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	5.3e-06	21.9

DBSCAN-SWA_40

508697 : 515945

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818543.1\|508697_510167_-	glycine betaine/L-proline transporter ProP	Q6JIH2	Burkholderia_virus	4.7e-57	31.5
WP_012218315.1\|510555_511626_-	porin	NA	NA	NA	NA
WP_155818544.1\|511875_513858_-	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.1e-80	44.1
WP_155818782.1\|514106_515945_-	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	1.6e-30	33.8

DBSCAN-SWA_41

529066 : 533037

Acanthamoeba_polyphaga_mimivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_088931537.1\|529066_530107_-	DNA topoisomerase IB	A0A0G2Y4T8	Acanthamoeba_polyphaga_mimivirus	5.2e-42	33.1
WP_006417273.1\|530501_531464_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_012218303.1\|531525_533037_+	sugar ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.2e-15	24.9

DBSCAN-SWA_42

538758 : 540093

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818554.1\|538758_540093_+	MFS transporter	Q6JIH2	Burkholderia_virus	2.7e-35	30.5

DBSCAN-SWA_43

567814 : 569680

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818578.1\|567814_569680_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	2.6e-15	30.3

DBSCAN-SWA_44

579585 : 585725

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060151712.1\|579585_580455_+	ankyrin repeat domain-containing protein	S4VQ12	Pandoravirus	9.5e-05	35.2
WP_155818584.1\|580498_580942_+	hypothetical protein	NA	NA	NA	NA
WP_012218404.1\|580997_581456_+	DUF1795 domain-containing protein	NA	NA	NA	NA
WP_155818587.1\|581477_585725_+	hypothetical protein	A0A2H4JFP5	uncultured_Caudovirales_phage	4.9e-30	49.3

DBSCAN-SWA_45

591518 : 594722

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818604.1\|591518_592274_-	SDR family oxidoreductase	F2NZ12	Diadromus_pulchellus_ascovirus	4.8e-05	29.6
WP_155818607.1\|592266_593037_-	enoyl-CoA hydratase	NA	NA	NA	NA
WP_155818610.1\|593039_594722_-	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.9e-24	25.1

DBSCAN-SWA_46

599089 : 600493

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818613.1\|599089_600493_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.1e-14	24.5

DBSCAN-SWA_47

603992 : 606250

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818615.1\|603992_604775_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.0e-10	24.1
WP_155818618.1\|604671_604935_+	hypothetical protein	NA	NA	NA	NA
WP_155818788.1\|605482_606250_+	di-trans,poly-cis-decaprenylcistransferase	R9W0U9	Flavobacterium_phage	2.6e-14	37.9

DBSCAN-SWA_48

611351 : 621817

Mollivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818630.1\|611351_612107_-	glucose 1-dehydrogenase	A0A0M4JSW6	Mollivirus	1.7e-05	35.5
WP_060044355.1\|612213_612597_-	VOC family protein	NA	NA	NA	NA
WP_155818789.1\|612627_613374_-	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	2.9e-10	39.2
WP_155818634.1\|613517_614270_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.8e-15	29.2
WP_155818636.1\|614454_616113_-	NAD(P)-binding protein	NA	NA	NA	NA
WP_146123643.1\|616152_616344_+	hypothetical protein	NA	NA	NA	NA
WP_060110952.1\|616401_616974_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_155818639.1\|617123_618062_+	alpha/beta hydrolase fold domain-containing protein	A0A2P1EM31	Moumouvirus	5.5e-35	30.6
WP_052096043.1\|618205_619075_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_059785645.1\|619123_619903_+	IclR family transcriptional regulator	NA	NA	NA	NA
WP_155818642.1\|619948_620854_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.4e-19	28.0
WP_155818790.1\|620893_621817_-	alpha/beta hydrolase fold domain-containing protein	A0A068F2G2	Mycobacterium_phage	2.6e-08	27.9

DBSCAN-SWA_49

625045 : 626668

Catovirus(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818648.1\|625045_626668_+\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	4.2e-46	28.1

DBSCAN-SWA_50

667353 : 668850

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818699.1\|667353_668850_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	1.2e-15	22.8

DBSCAN-SWA_51

693783 : 694497

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_060043956.1\|693783_694497_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	2.7e-18	30.3

DBSCAN-SWA_52

705180 : 707136

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818793.1\|705180_707136_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	8.8e-43	28.2

DBSCAN-SWA_53

710472 : 716541

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818739.1\|710472_712128_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-10	33.8
WP_155818742.1\|712461_713355_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_155818745.1\|713376_714873_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_155818748.1\|714876_716541_+	NAD(P)-binding protein	A0A1V0SI18	Klosneuvirus	5.9e-56	30.3

DBSCAN-SWA_54

731385 : 734373

Haemophilus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818764.1\|731385_734373_-	lytic transglycosylase domain-containing protein	Q7Y5V0	Haemophilus_phage	8.0e-11	27.6

DBSCAN-SWA_55

740586 : 743610

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818766.1\|740586_743610_-	response regulator	A0A1V0SGX0	Hokovirus	1.4e-39	29.9

DBSCAN-SWA_56

747240 : 748131

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818768.1\|747240_748131_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.0e-22	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046343

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046343_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046343_1

698610-698741

Orphan

Consensus_repeat	Method
GAGGCGGATTGAGATTCAGATTCCAATGTTGAATCGTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046343_1

>merge|NZ_CP046343|1|698610-698741|CRISPRCasFinder
GAGGCGGATTGAGATTCAGATTCCAATGTTGAATCGTTAGGGTAAAGCAGTGCGAACTGAGTCATGGCGCGGAGGTATCCGGAATTTCGTGTGTGAGGCGGGTTGAGATTCAGATTCCAATGTTGAATCGTT

>NZ_CP046343|1|1|698610-698741|CRISPRCasFinder
GAGGCGGATTGAGATTCAGATTCCAATGTTGAATCGTT	AGGGTAAAGCAGTGCGAACTGAGTCATGGCGCGGAGGTATCCGGAATTTCGTGTGT
GAGGCGGGTTGAGATTCAGATTCCAATGTTGAATCGTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046343.1\|WP_006415799.1\|708257_708515_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_155819004.1\|701048_703355_-\|NACHT-domain-containing-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_006406296.1\|703755_704520_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP046343.1\|WP_012213955.1\|685361_686309_-\|catechol-2,3-dioxygenase	unknown	unknown	gnl\|CDD\|319920
NZ_CP046343.1\|WP_155818992.1\|691034_692168_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|197715
NZ_CP046343.1\|WP_155818988.1\|686361_688149_-\|2,4-dichlorophenol-6-monooxygenase	unknown	unknown	gnl\|CDD\|366675
NZ_CP046343.1\|WP_155819008.1\|706783_708175_+\|oxygen-independent-coproporphyrinogen-III-oxidase	unknown	unknown	gnl\|CDD\|236430
NZ_CP046343.1\|WP_155818996.1\|693277_694765_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_006412081.1\|708617_709271_+\|protein-L-isoaspartate-O-methyltransferase	unknown	unknown	gnl\|CDD\|225316
NZ_CP046343.1\|WP_105808020.1\|704626_705457_-\|undecaprenyl-diphosphate-phosphatase	unknown	unknown	gnl\|CDD\|234712
NZ_CP046343.1\|WP_006400913.1\|709285_709609_+\|sulfurtransferase	unknown	unknown	gnl\|CDD\|238786
NZ_CP046343.1\|WP_155820209.1\|694785_696099_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_155818998.1\|696200_697832_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_155818990.1\|688189_689704_-\|AMP-binding-protein	unknown	unknown	gnl\|CDD\|341286
NZ_CP046343.1\|WP_035949544.1\|705533_706115_-\|DUF1439-domain-containing-protein	unknown	unknown	gnl\|CDD\|377799
NZ_CP046343.1\|WP_012213958.1\|689700_690867_-\|acetyl-CoA-acetyltransferase	unknown	unknown	gnl\|CDD\|181013
NZ_CP046343.1\|WP_155819006.1\|706285_706624_-\|YkgJ-family-cysteine-cluster-protein	unknown	unknown	gnl\|CDD\|308985
NZ_CP046343.1\|WP_054316833.1\|697878_698286_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_155819002.1\|700751_700979_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046343.1\|WP_155818994.1\|692379_693315_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|225117

Protein	Function_ID	Function_description	E-value
NZ_CP046343.1\|WP_006400913.1\|709285_709609_+\|sulfurtransferase	gnl\|CDD\|238786	cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2. Subgroup 2 includes uncharacterized putative rhodanese-related domains.	1.62332e-42
NZ_CP046343.1\|WP_012213955.1\|685361_686309_-\|catechol-2,3-dioxygenase	gnl\|CDD\|319920	cd07257, THT_oxygenase_C, The C-terminal domain of 2,4,5-trihydroxytoluene (THT) oxygenase. This subfamily contains the C-terminal, catalytic, domain of THT oxygenase. THT oxygenase is an extradiol dioxygenase in the 2,4-dinitrotoluene (DNT) degradation pathway. It catalyzes the conversion of 2,4,5-trihydroxytoluene to an unstable ring fission product, 2,4-dihydroxy-5-methyl-6-oxo-2,4-hexadienoic acid. The native protein was determined to be a dimer by gel filtration. The enzyme belongs to the type I family of extradiol dioxygenases which contains two structurally homologous barrel-shaped domains at the N- and C-terminus of each monomer. The active-site metal is located in the C-terminal barrel. Fe(II) is required for its catalytic activity.	1.99289e-45
NZ_CP046343.1\|WP_155818994.1\|692379_693315_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	2.37536e-25
NZ_CP046343.1\|WP_155818988.1\|686361_688149_-\|2,4-dichlorophenol-6-monooxygenase	gnl\|CDD\|366675	pfam01494, FAD_binding_3, FAD binding domain. This domain is involved in FAD binding in a number of enzymes.	1.0257e-110
NZ_CP046343.1\|WP_155819008.1\|706783_708175_+\|oxygen-independent-coproporphyrinogen-III-oxidase	gnl\|CDD\|236430	PRK09249, PRK09249, coproporphyrinogen dehydrogenase.	0
NZ_CP046343.1\|WP_155818992.1\|691034_692168_+\|PAS-domain-S-box-protein	gnl\|CDD\|197715	smart00421, HTH_LUXR, helix_turn_helix, Lux Regulon. lux regulon (activates the bioluminescence operon.	1.02261e-14
NZ_CP046343.1\|WP_155818990.1\|688189_689704_-\|AMP-binding-protein	gnl\|CDD\|341286	cd17631, FACL_FadD13-like, fatty acyl-CoA synthetase, including FadD13. This family contains fatty acyl-CoA synthetases, including Mycobacterium tuberculosis acid-induced operon MymA encoding the fatty acyl-CoA synthetase FadD13 which is essential for virulence and intracellular growth of the pathogen. The fatty acyl-CoA synthetase activates lipids before entering into the metabolic pathways and is also involved in transmembrane lipid transport. However, unlike soluble fatty acyl-CoA synthetases, but like the mammalian integral-membrane very-long-chain acyl-CoA synthetases, FadD13 accepts lipid substrates up to the maximum length of C26, and this is facilitated by an extensive hydrophobic tunnel from the active site to a positively charged patch. Also included is feruloyl-CoA synthetase (Fcs) in Rhodococcus strains where it is involved in biotechnological vanillin production from eugenol and ferulic acid via a non-beta-oxidative pathway.	4.06493e-165
NZ_CP046343.1\|WP_035949544.1\|705533_706115_-\|DUF1439-domain-containing-protein	gnl\|CDD\|377799	pfam07273, DUF1439, Protein of unknown function (DUF1439). This family consists of several hypothetical bacterial proteins of around 190 residues in length. Several members of this family are annotated as being putative lipoproteins and are often known as YceB. The function of this family is unknown.	7.53507e-16
NZ_CP046343.1\|WP_012213958.1\|689700_690867_-\|acetyl-CoA-acetyltransferase	gnl\|CDD\|181013	PRK07516, PRK07516, thiolase domain-containing protein.	0
NZ_CP046343.1\|WP_006412081.1\|708617_709271_+\|protein-L-isoaspartate-O-methyltransferase	gnl\|CDD\|225316	COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones].	7.69811e-71
NZ_CP046343.1\|WP_155819006.1\|706285_706624_-\|YkgJ-family-cysteine-cluster-protein	gnl\|CDD\|308985	pfam03692, CxxCxxCC, Putative zinc- or iron-chelating domain. This family of proteins contains 8 conserved cysteines. It has in the past been annotated as being one of the complex of proteins of the flagellar Fli complex. However this was due to a mis-annotation of the original Salmonella LT2 Genbank entry of 'fliB'. With all its conserved cysteines it is possibly a domain that chelates iron or zinc ions.	3.93038e-05
NZ_CP046343.1\|WP_105808020.1\|704626_705457_-\|undecaprenyl-diphosphate-phosphatase	gnl\|CDD\|234712	PRK00281, PRK00281, undecaprenyl-diphosphate phosphatase.	3.12434e-122
NZ_CP046343.1\|WP_006406296.1\|703755_704520_+\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	7.2877e-105

>NZ_CP046343.1|WP_054316833.1|697878_698286_-|hypothetical-protein
MEENSLRRRYRSVALIATVATLALAYGAARHLSWASTKPTAQQVFSVTVDRDKAPWERPVIAIREGQPVHIDVHSREAGVLMAHEIPGALATCASGANQSLDLLPVGITGRFSLHFHSQTGEQIEVAVIEIYPDN
>NZ_CP046343.1|WP_155818998.1|696200_697832_-|hypothetical-protein
MRFMTRVAIATSISTLVLAGCGGDDDTVSATPAVSVADYVVPRVPSCSPGDTPETALQGQVPAALRQSGFGGFNCNLKRVSQLQGEGASWSAATYTDKQGQTCFYHATIGATPIFNNPDAPPRVNPGVPVINISDPVHPVRVTSLTSTAMIDPWESLRVNVARGILAADNGLGSAGGPELDLYDIATDCTRPQLLASVPVGTGADGGVVPGTAPLGHEGAFSPDGLTYYIGSPTAKSYYAVDLTIPTRPKLISAISMAELGFGSGPHGLSVSQDGTRAYFVALGNAGAAAGMGPPPLDNLNSNGDNGFFVVDTSEVQHRRPNAQMHRIATVPVRDGSVAQHTIPFLVSGKPYLLEVDEGGAGGLQDPSATAVKAACNAGMTPFPLGHIYDMANEATPRLISELRLETHAPQNCSKVIPDLQGLSTFTYGSHYCSVDNRENATALACSYFNSGVRVFDIRDPSKPKEIAYYNPPSAKSPGAGSGHLMLGQYRPGGPDWCTARLDFDFDRHLLTTACSDNGLLVLSFENDSWPFPESTKAKEIGN
>NZ_CP046343.1|WP_155820209.1|694785_696099_-|hypothetical-protein
MLLTTALAIPLRCAGFESDVHFGLTYWLAKQAGFAAGEASAIALADQRIDAGSIEYMTTPLQFACLSRFAPDALDAQAAHYPGAAHAPAAAQTRTVLPDGPASQSSIDATLRRADGHAAFMLGEFGRSLHALQDAWAHQGTPSVPDWRRYGIECDANLAMSAPAARGGPSGHLADMTWRWPADVEAMAKSTYAQLSRYPAIDGVSRHARPWEQIRPMLAGFIDARTKRAKSDWFVAHGIADTAFLDGTSLPDGAGWKAVRWRGRRDIPTPVSPTAQTGVAPALVDFYTRFFDDWVTTSPVDRRWLPALAIDTETRKPDSALVDQLTGWRLRDHGTYLALANASPATGGARAVLRDRASFTVFKSLNDAVLPLFIEGDKPSPILPFVVFALPDSADGSKRAIALIKLLDAPYDTIGIVSEQGSEAGWKITGLISSSDY
>NZ_CP046343.1|WP_155818996.1|693277_694765_-|hypothetical-protein
MRDHIGRGVHRATIRAGLPRAAALLLALASTRADAHAWNIPYYLPVPLWLYAYAASGTLVVSFMILMFASGTRIADTRAPLHRSRREWRLPSAALVAAQAVGAIFVVMLMVAGLAGTQNPFQNLAMSGFWLWFYLGSVYVSAVVGDVYAFTNPFALLLRIAARCCPTIERGRYRYPHRAASYPALLAYVALIALELFGAARPRDAGLFLAGYAIYALAGALCFGRQVWLDHFDAFGVLCRLCARLSPLAWRRLPTRDVAIVLRNPVADIASAPPFDTSVVMFLSFMLSSTAYDGLRDTATWSTFFWRGIYPLIVGLFPALKNDYAISGELVRAAQWATFVAVGFAYYGLYRAFCALGALGTRSAVDGRTFARQFCLLLLPIALFYNVCHYFTLFMDQGRQIFALLSDPLGIGWNLLSLPPADYSPTSLLLNVAYIWHAQVLLILFGHILSVYFTHAIAVRNRVLAGTVVANQLPLLALTIVLTISGLWILSLPLA
>NZ_CP046343.1|WP_155818994.1|692379_693315_+|helix-turn-helix-domain-containing-protein
MRNQPTMRDVCAIGRDGHRVAWTLPAQWKKQSAAPLFAGVATDRYTACASEIIDVETTGPIFGLHLRPPAAIEMRIDDSGWTPYTVRAPLAYVPPGFAFSSRWSSDIEWITVHFDPSWLARAGLHAGGQTMPTVPHLDVNDDLLMQIVRSIHEDAVAGAPLGPTYVETLGAAALRRMAYLESTRQAREYTHARAMHAAVEYIRDNFREPLTLVALAEAVGYPGDLYAFIRSFKKAHGVTPHQYIIETRLQAARDLIERGRSDVTEAALACGFSTTSHFSSTFRKRWGISPSELKPRSTSVRRAAGKESTDR
>NZ_CP046343.1|WP_155818992.1|691034_692168_+|PAS-domain-S-box-protein
MQRGRPKIGLVLSDEERAALQAMERRHDTQAALALRARIVLGCADSLDNKVVAERNAVTPHTVAKWRARFIESGVDGLSDAQRTGAPRSIPDSVAATIIAEKQAAPPSGTSIRRIARRANVSASSVVRILKSADRRATADGADQPAEFQSRAGGSPAAAGASVRTSKAEAALKERKKTPRQIRDLPTEAQAPATSDPLADLSFAFQMAPVGLLVTRQRVIVSCNQAFSEMFGYSAEDLAGKSVEYLYPTRDEFQHVGKRAMVVMQQHGFYSDDRIMRKVDGSFFWCHVSGRSFNRDDPFAAATWCFEDLSKVRPVTTKLTPREREVAQFLVTGKSSKQIARDLHISHRTVEAHRVRLMRKYAVATVGELIAKLIGRG
>NZ_CP046343.1|WP_012213958.1|689700_690867_-|acetyl-CoA-acetyltransferase
MTVAIVGWGHLPFGRLDALSLEDLIVGAGRAALSDAGMPADSVDGIWLGNLNGGFVPDIFAAPLALNCDAGLRWKPAVRVENACASGSAAVYAACDAIEAGRARIALVIGAEKMTSVSGAEVTRILGNCGYSGEAGNPPGGFPGIFAEVARDYFEQYGDHSATLAAIAAKNHANGVANPWAHMRRDLGFDFCNTVSEKNPLIAPPLRKTDCSLVSDGAAALVLVAQELAADFAKAVSIRARVQVNDYLPLAQRRAIEFNGPKRAWKHALSEAGCTIDDLSFAEVHDCFTIAELLSYEAMGLAPAGQGHRLIEDGTVARDGRFPVNASGGLKAKGHPIGATGVSMHVLAAMQLAGQAGEMQIPDATLGGVFNMGGAAVASYVSILERSR
>NZ_CP046343.1|WP_155818990.1|688189_689704_-|AMP-binding-protein
MNIAQLLVRTASAFADRLAVLHGEQPWLDYGSLAKRTAALAGFLRDQCGVKPGARVAIYSENCPEYLEALHSIYWGGAVSVPVNFKLHPKELAFILANAEADVLFVSEALLATLWDAAIELPASCLVFGSSAYAQALEHAPIAIEHREPDDIASLFYTSGTTGRPKGVMQTHRNLLTMTACYFMDVDDVRPEDAMVYAAPMSHGAGLYNFPYIARGARHVVPRSGGLDCAELVELASRVGRLSMFAAPTMVKRLVDHVRAARADVSGFKTIIYGGGPMYANDLHEALEVFGPRLVQVYGQGESPMTITALDRRHLADTQHPRWAQRATSVGIAQSLVEVQVVDDRGRRVPNGEIGEVIVRGDTVMPGYWRNPEATASTIRDGWLYTGDTGYMDDDGFLTLKDRSKDLIISGGSNIYPREIEEVLLAHPSVSEVAVVGWRDAEWGEVPVAFVVFKEGCHATQHELDDWCLQSLARFKRPKRYEFVLRLPKNSYGKVLKTALRSPD
>NZ_CP046343.1|WP_155818988.1|686361_688149_-|2,4-dichlorophenol-6-monooxygenase
METLKRMKTSVLIVGAGPAGLTASAILARNGIDALTICRYSGTANSPRAHITNQRTMEVFRDMGIEERMVALSTPNRLMGNTTWMTSFTGIELARLPSWGTGIDRRTDYERASPSAMCNLPQHILEPALLDAARAAGARVRFDTVLVAIRQTKDAVYATLLDRLTGAKFEVESEYVIGADGANSLVASELGFEMEGHRGVAEQVNCWVEVDLSKYVSHRPSSLYVIAQPGNNFWIGSGVWICVKPWSEWVLLFAFRSADGTPDLSEQAVVEYARSTIGDPDIDVKVKSVSTWAINHMFAKEMRKGRAFIAGDAAHRHPPANGLGSNTSIQDSFNLAWKLAMVLKGQASDALLDSYSAERQPVARQVVERANKSVELMQPMSAAFGFSHGQSIEAGWASIAELRGDSPRGRERRKQLARALKGLQHHFNAHGVELGQHYTSSAIVDDGTPEFTPERDPELYVTPTTRPGAHVPHAWVEQGQKLVSTLDLVGKNGFTVVTGIGGQRWCEAAERLSLEFGMPVRHVAIGPGLDAEDIYGQWSALREIEENGCLLVRPDMHVAFRAMAMSDRPFEDLLAAMEHIVGRRLVSLQPFASHA
>NZ_CP046343.1|WP_012213955.1|685361_686309_-|catechol-2,3-dioxygenase
MSKIVVRELAYVRLRSPDLDLAEQFLTDFGLSRSARTANALYMRGTDPAHHIHVTEQGEAKVVGFAFEVASEADLERATLIEGASAVHDIDEPGGGRRVILTEPNGYQIELVHGIQRLPSVPVERTIYNTGEEPRRRAGVLQRLPASPTRIKRIGHCVLASTKWTETTRWFHENLGLVTTDSIYAAEPSNVIATFSRLDQGAEYVDHHVFMCFKGDESGLNHVSFEMNDIDAVFADHHWLMGTGKYEHMWGPGRHYLGSQVFDYWADPWGRIHEHWADSDRVNAAYESRQCSAEEGFVSQWGEHPPEKFLTRVSK
>NZ_CP046343.1|WP_155819002.1|700751_700979_-|hypothetical-protein
MDDIQHPAEFYPSTTEQICDLADAVRGDLAASSREQLRGRSADLLEGVSGFRQRNVDTRLIELARPAYSDRPANS
>NZ_CP046343.1|WP_155819004.1|701048_703355_-|NACHT-domain-containing-protein
MGWTDDKAFEAEVLRIARAKWPSSAMAGAAMLDGRERDGIFETEESVHFIEATTSRSQDKARHDSKKLHQAVTQQTKLTPMKGSRGWFVTAEEPTADQRKEVERTGKGQVVAVSFAQFQQSVIDVGAYLSARVNHVFGSVLDPKTRQPDPTTEYVPINLQDKASSAQWQVRQICSALQRGERFTLTGQFGAGKSMTLRQIFRELRDDYLRGRTALFPVYVNLREHTGQVDAVEVLERHARKIGFESPSSLVRAWRAKFCILLLDGFDELTALGVQRATFGRLRTIRKRALEAVRQLVMETPPGVGVIIAGRDHFFADNTEAEDSLGLSGPVTHLTTSEFTEEQVKQFLRQQPSNGQGQLPPWLPTKPLFVSYLASAGLISAVVDSEKFPDAAAGWDYLVDQVCEREARIDSRYLDGPTIRKILGRLATYARASDDGLGPLRPDQLKRAYSDVCGFEPDDQAWLILQRLPGLVIYEVEEDSRKFLDGEMVGVYRAGDLVDFVHDPMGSLSSHDFTDALSQCGTVIGHYAIAIATRKLQYELNTGALQSLMTAIPDTSGLNVLRADLLSLAVSLGVAVPFPVLIEGVFFQPDPLELDERLPDMRGVTFQDCYFEELHVESVGAHIPQFRDCVVQRLLGKSSYADLPADRFVNPSVNDFEVAANTNASIRATTNLTTGEKVLLTLLRKLFVQSLGGRSEPALYRGLDTAERQFVDPIVRFLAQQQLITLMNRGDGTVWIPVRRKLDYIRKLLANPSAPGDILMAEARRLSA
>NZ_CP046343.1|WP_006406296.1|703755_704520_+|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MMHDDPNEAGLPPHDDALSDEAADGTEVNPLHRRRIRSFVTRAGRVSTGQRRALDELGPRFVVPYAPETPDWNAIFGRSAPRILEIGFGMGASTAEIAANRPGDDFLGVEVHEPGVGALLKLIGEQDLSNIRIIQHDAVEVLEHMLTPESLDGVHIFFPDPWHKARHHKRRLIQPPLVAQLASRLKPGAYLHCATDWQNYAEQMLEVLSAEPTLENTADGYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKRAG
>NZ_CP046343.1|WP_105808020.1|704626_705457_-|undecaprenyl-diphosphate-phosphatase
MDWILICKALILGVVEGLTEFLPVSSTGHLIVAGSFLNFNDAHAKTFDVVIQFGAILAVCWEYRQRIASVVTGLPSRPDARRFALNVVIATIPAIALGLLLEKKIKAVLFSPVPVAFALVVGGAIILWAEARQRERREPPRVQSIEELTPLDALKVGVAQCFALIPGMSRSGSTIIGGMLFGLERRVATEFSFFLAIPIIFGATLYETVKDWHAFTVDALGLFVLGLVSAFVSAFVCVRWLLRYVATHDFTVFAWYRIVFGLFVLLVGYSGWLNWA
>NZ_CP046343.1|WP_035949544.1|705533_706115_-|DUF1439-domain-containing-protein
MTASRAPGRRRFLAACAAAVGVSVSLVACASTFPFIPDHYTFSRGDVQKAVARKFPYQKTVAQVVDVSLANPAVSLLPDQNRIAVQLDAHFESPFLRMPVSGRFTVSGQLAYDAPSRSVVLKAPAVDNLVLDGDAQMYTQQVGAAAGLLATQLLTNYPIYTFKPEQLQFGGVNYEPGTITILTNGIRVAIVEK
>NZ_CP046343.1|WP_155819006.1|706285_706624_-|YkgJ-family-cysteine-cluster-protein
MPAETAVRPASADVLPPHACREGCGACCIAPSISSPIPGMPDGKPAGVRCVQLGDDLRCRIFGRPERPACCSGLQPSAEMCGASRDEALAWLTQLEAATQPVGACPGGSVRR
>NZ_CP046343.1|WP_155819008.1|706783_708175_+|oxygen-independent-coproporphyrinogen-III-oxidase
MTSGSADTLFRPDLLAKYGANGPRYTSYPTALQFRDDFPHSDYVRAASDPGASSSELSLYFHIPFCNTACFYCGCNRIATNNHRRARPYLDQLKREIALQATLFDRSRPVTQLHWGGGTPTFLSDDETAELMAATREHFLLAPDADAEYSIEIDPRTVTPATLVHLRTIGFNRLSLGVQDFDPEVQRAINRIQPLAQTADLLRAARTTGFHSTSVDLIYGLPHQTVATFARTLETIIELAPDRLSVFGYAHMPHLFKMQRRIDDATLPPPETRIALLGLAIDMLTSAGYVYIGMDHFARPSDELVRAQRNGTLQRNFQGYSTRADTDLIGIGVSSIGKVGDVYAQNAKDLPAYSAALDAGRLPIARGVRLTADDRLRRDVIAQLMCNLELPFSPIEAAHGIRFADRFARELDALRPFERDGLLTIAADRLTIHPPGRMVVRNIAMAFDAYLGRTPAQRYSRTV
>NZ_CP046343.1|WP_006415799.1|708257_708515_+|hypothetical-protein
MRTTKATHAVERLKARSGNPQYAAVAMPGGLFYLVDRSGGTAEKRCEPLPLDEFVKFVDEFGPKKPRKVSKLDLAFEAQINKRKG
>NZ_CP046343.1|WP_006412081.1|708617_709271_+|protein-L-isoaspartate-O-methyltransferase
MNIEKARFNMIEQQIRPWDVLDLDVLGLLSIVKRENFVPAEYRDLAFADLELPLPGGRKMLFPRVEARVLQELAVKKHENVLVIGAGSGYLTALIAHRALHVTAVEIDPTIAKFAADNLRENAVTNAEVVLGDGSLGWPDKAPYDVICVAGGLPVVPQQMLEQLKIGGRLSAFVGGRPVMKAQVITRIDEKQYRVADVFETYVDHLVNAMEPSRFKF
>NZ_CP046343.1|WP_006400913.1|709285_709609_+|sulfurtransferase
MQILTPAMLAEWLRDPARPAPVVLDVREPWEVATAQIDGSVSIPMQQIPARSEELDDEAEIVCVCHHGMRSAQVAMFLESRGFTKLYNLQGGIDAWSRDVDPSVPRY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

510682 : 518949

Yaba_monkey_tumor_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155818953.1\|510682_511591_+	alpha/beta fold hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	6.2e-15	26.4
WP_006400715.1\|511615_512539_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	2.3e-41	34.0
WP_105776994.1\|512585_513917_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_006413203.1\|513998_514901_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-52	39.5
WP_155818954.1\|515111_515474_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_006400719.1\|515549_516542_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	6.9e-28	30.9
WP_006413209.1\|516590_517541_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.2e-16	27.5
WP_155818955.1\|517548_518949_-	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	3.0e-77	37.7

DBSCAN-SWA_2

849042 : 858012

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155819159.1\|849042_850581_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	4.7e-23	30.7
WP_006417097.1\|850616_851156_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_035949388.1\|851152_851839_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	2.7e-07	30.1
WP_155819162.1\|851885_852701_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	6.7e-37	33.7
WP_155819164.1\|852804_854667_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	4.0e-61	38.1
WP_039224554.1\|854670_855801_-	molecular chaperone DnaJ	A0A1V0SBY2	Catovirus	2.6e-23	30.0
WP_006401601.1\|856065_858012_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	51.2

DBSCAN-SWA_3

1138729 : 1205107

Pseudomonas_phage(25.0%)

integrase,tail,tRNA,plate

attL 1157493:1157517|attR 1213389:1213413

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006400498.1\|1138729_1140028_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006400499.1\|1140110_1141193_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	8.7e-08	44.8
WP_155819289.1\|1141203_1142046_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006400503.1\|1142113_1142425_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_155819290.1\|1142438_1143035_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_006406932.1\|1143253_1144045_+	dioxygenase	NA	NA	NA	NA
WP_006400506.1\|1144199_1145798_-	APC family permease	NA	NA	NA	NA
WP_006400508.1\|1146220_1146424_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_155819291.1\|1146535_1147786_-	Hsp70 family protein	NA	NA	NA	NA
WP_006400510.1\|1147942_1148548_-	nitroreductase family protein	NA	NA	NA	NA
WP_006400511.1\|1148694_1149978_-	MFS transporter	NA	NA	NA	NA
WP_107998995.1\|1150190_1150811_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_105779389.1\|1150866_1151439_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_054315500.1\|1151489_1152380_-	methyltransferase	NA	NA	NA	NA
WP_039226063.1\|1152469_1153603_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_060097787.1\|1153712_1154210_-	Water stress and hypersensitive response domain-containing protein	NA	NA	NA	NA
WP_059786772.1\|1154853_1157025_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	2.2e-50	26.6
WP_035949163.1\|1157151_1158180_-	transporter	NA	NA	NA	NA
1157493:1157517	attL	NA	NA	NA	NA
WP_155819292.1\|1158391_1159384_-\|tail	phage tail protein	NA	NA	NA	NA
WP_006400523.1\|1159505_1160351_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_012214233.1\|1160649_1164597_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_155819293.1\|1164593_1165583_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_155819294.1\|1165587_1166538_+	OmpA family protein	NA	NA	NA	NA
WP_059786781.1\|1166636_1167758_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_155819295.1\|1167796_1170466_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	6.5e-89	30.6
WP_155819296.1\|1170510_1171611_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_006400544.1\|1171574_1173410_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_155819297.1\|1173488_1173974_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006400546.1\|1174036_1174540_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006400547.1\|1174611_1176102_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_155819298.1\|1176117_1176633_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_006406961.1\|1176668_1177301_-	hypothetical protein	NA	NA	NA	NA
WP_012214251.1\|1177676_1178288_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006400551.1\|1178390_1179737_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_155819299.1\|1179733_1180516_+	DotU family type IV/VI secretion system protein	NA	NA	NA	NA
WP_059786788.1\|1180620_1180938_-	hypothetical protein	NA	NA	NA	NA
WP_006400561.1\|1181238_1182039_+	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_006400562.1\|1182151_1182355_-	hypothetical protein	NA	NA	NA	NA
WP_155820221.1\|1183799_1186448_+	hypothetical protein	NA	NA	NA	NA
WP_155819300.1\|1186431_1186854_+	hypothetical protein	NA	NA	NA	NA
WP_155819301.1\|1187133_1190265_-	HsdR family type I site-specific deoxyribonuclease	A0A220A398	Liberibacter_phage	7.2e-71	30.1
WP_155819302.1\|1190261_1191596_-	restriction endonuclease subunit S	NA	NA	NA	NA
WP_155819303.1\|1191585_1193172_-	N-6 DNA methylase	A0A220A2U5	Liberibacter_phage	2.7e-42	28.5
WP_105843239.1\|1193995_1194403_+	hypothetical protein	NA	NA	NA	NA
WP_155819304.1\|1194953_1195160_-	hypothetical protein	NA	NA	NA	NA
WP_155819305.1\|1195149_1195665_-	hypothetical protein	NA	NA	NA	NA
WP_155819306.1\|1195731_1198419_-	S8 family serine peptidase	NA	NA	NA	NA
WP_069219929.1\|1198430_1199426_-	ATP-binding protein	A0A2H4UTU5	Bodo_saltans_virus	8.6e-10	28.1
WP_069219928.1\|1199574_1199901_-	transcriptional regulator	NA	NA	NA	NA
WP_155819307.1\|1200110_1200662_-	plasmid mobilization relaxosome protein MobC	NA	NA	NA	NA
WP_155819308.1\|1201152_1201434_-	hypothetical protein	NA	NA	NA	NA
WP_155819309.1\|1201467_1202529_-	hypothetical protein	NA	NA	NA	NA
WP_155819310.1\|1202919_1203546_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_081068816.1\|1203542_1203779_-	plasmid-related protein	NA	NA	NA	NA
WP_155819311.1\|1204069_1205107_-\|integrase	tyrosine-type recombinase/integrase	W6MYA3	Pseudomonas_phage	2.8e-48	39.8
1213389:1213413	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046341

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046341_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046341_1

188850-189064

Orphan

Consensus_repeat	Method
CCACCGCCGAGCGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP046341_1

>merge|NZ_CP046341|1|188850-189064|CRISPRCasFinder
CCGCCGCCGACGGCCGCGCCGAGCAGGCCGCCCGTACGGCCGCCCATGGCGTTGCCGGCCGCGGTGCCTGCACCACCGCCGAGCGCGCCGCCGATGATCGCGCCGGTACGCTCGCGACGGTTCGACGTGATCGCGCCACCCGCGCCGCCGCCGAGCGCGCCGCCGATCACGGAACCCGTGCTGCCGCCGACCGCGCCGCCGACCGCCGCGCCGGC

>NZ_CP046341|1|1|188850-189064|CRISPRCasFinder
CCGCCGCCGACGGCCGCGCCGAG	CAGGCCGCCCGTACGGCCGCCCATGGCGTTGCCGGCCGCGGTGCCTGCA
CCACCGCCGAGCGCGCCGCCGAT	GATCGCGCCGGTACGCTCGCGACGGTTCGACGTGATCGCGCCACCCGCG
CCGCCGCCGAGCGCGCCGCCGAT	CACGGAACCCGTGCTGCCGCCGACC
GCGCCGCCGACCGCCGCGCCGGC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046341.1\|WP_155816923.1\|181288_182380_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP046341.1\|WP_006397317.1\|192887_194090_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP046341.1\|WP_039223209.1\|195046_195577_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP046341.1\|WP_155816931.1\|195591_196044_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046341.1\|WP_155816932.1\|196543_196693_+\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176904
NZ_CP046341.1\|WP_155816933.1\|196710_196860_+\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176904
NZ_CP046341.1\|WP_155816921.1\|179283_180366_+\|hemin-degrading-factor	unknown	unknown	gnl\|CDD\|226243
NZ_CP046341.1\|WP_155816920.1\|176968_179236_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	unknown	unknown	gnl\|CDD\|273808
NZ_CP046341.1\|WP_059781385.1\|196042_196525_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP046341.1\|WP_155816926.1\|184064_186209_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP046341.1\|WP_155816929.1\|191966_192602_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP046341.1\|WP_105811400.1\|189890_190310_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP046341.1\|WP_155816924.1\|182399_183242_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP046341.1\|WP_035956177.1\|176500_176728_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046341.1\|WP_155816922.1\|180362_181277_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|226928
NZ_CP046341.1\|WP_155816930.1\|194396_194975_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046341.1\|WP_155816928.1\|190502_191942_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP046341.1\|WP_006415909.1\|187302_188139_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP046341.1\|WP_155816927.1\|186422_187220_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP046341.1\|WP_155816925.1\|183441_184053_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415

Protein	Function_ID	Function_description	E-value
NZ_CP046341.1\|WP_155816923.1\|181288_182380_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.16339e-76
NZ_CP046341.1\|WP_006397317.1\|192887_194090_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP046341.1\|WP_039223209.1\|195046_195577_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	5.64898e-10
NZ_CP046341.1\|WP_155816933.1\|196710_196860_+\|polyketide-cyclase	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.85249e-10
NZ_CP046341.1\|WP_155816921.1\|179283_180366_+\|hemin-degrading-factor	gnl\|CDD\|226243	COG3720, HemS, Putative heme degradation protein [Inorganic ion transport and metabolism].	3.43822e-138
NZ_CP046341.1\|WP_155816920.1\|176968_179236_+\|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor	gnl\|CDD\|273808	TIGR01786, hemoglobin-haptoglobin-binding_protein, TonB-dependent hemoglobin/transferrin/lactoferrin receptor family protein. This model represents a family of TonB-dependent outer membrane receptor/transporters acting on iron-containing proteins such as hemoglobin, transferrin and lactoferrin. Two subfamily models with a narrower scope are contained within this model, the heme/hemoglobin receptor family protein model (TIGR01785) and the transferrin/lactoferrin receptor family model (TIGR01776). Accessions which score above trusted to this model while not scoring above trusted to the more specific models are most likely to be hemoglobin transporters. Nearly all of the species containing trusted hits to this model have access to hemoglobin, transferrin or lactoferrin or related proteins in their biological niche. [Transport and binding proteins, Cations and iron carrying compounds, Transport and binding proteins, Porins].	1.23292e-114
NZ_CP046341.1\|WP_059781385.1\|196042_196525_+\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	3.62996e-69
NZ_CP046341.1\|WP_155816926.1\|184064_186209_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP046341.1\|WP_155816929.1\|191966_192602_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	8.60537e-48
NZ_CP046341.1\|WP_105811400.1\|189890_190310_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.65495e-47
NZ_CP046341.1\|WP_155816924.1\|182399_183242_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	9.47842e-158
NZ_CP046341.1\|WP_155816922.1\|180362_181277_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|226928	COG4558, ChuT, ABC-type hemin transport system, periplasmic component [Inorganic ion transport and metabolism].	5.72028e-76
NZ_CP046341.1\|WP_155816932.1\|196543_196693_+\|polyketide-cyclase	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.27194e-10
NZ_CP046341.1\|WP_155816928.1\|190502_191942_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	8.77798e-38
NZ_CP046341.1\|WP_006415909.1\|187302_188139_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP046341.1\|WP_155816927.1\|186422_187220_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	9.80475e-83
NZ_CP046341.1\|WP_155816925.1\|183441_184053_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	8.38299e-65

>NZ_CP046341.1|WP_006415909.1|187302_188139_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTHTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGTKHTLTPGGYAFIPPGADWTLHNVSDAAVRFHWIRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP046341.1|WP_155816927.1|186422_187220_+|3'-kinase
MFAAHLRSWNLTPDGGPILTASGGVLPVVWRGRPAMLKIATCEEERRGNALMTWWDGHGAAQVWAHDDDAILLERAEPQPALADFSAAGHDDDAIRIACDVVAQLHAYRAPDPPPLVALRDWFASLLASEAADAILRRSQATAAALLAEPPVDEAVLHGDIHHRNVLHFGDRGWRAIDPKALRGARAFDYANLFCNPSHDIAVDRTRFERRVAIVADAARLDPRTLLRWILAWSGLSAIWLIEDDEPADTRLQVAALAAHALDSR
>NZ_CP046341.1|WP_155816926.1|184064_186209_-|PBP1A-family-penicillin-binding-protein
MTDRTDSRPTPPAPPPRRRVWRMLAGALLGLTLAGAGIAGWTIHRIWTQLPSVEQLAVYRPALPLRIFSRDGELLAEYGVERREFVPLERMPARMRDALLAAEDAQFYRHGAIDIGGLARATFANVVTGQPAQGGSTITMQVARNFYLTRDKVLSRKLAEILMAIKLERAYGKDKLLELYMNEIYLGERAYGFAAAAHVYFGKPLDALSVGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMLALGQLDDATYRAGVDAPIALSPQAPPGIVAAPYVAERARQMMVERFRDDAYTLGLDVTTTISMRDQRAAEAALERTLRRQRTTRDAQRTLEGALVSLDAATGDMLALVGGADFSRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTPAETGARPWRPRNYGNHYEGFIAVRRGLVRSKNLVAVSLMQAAEPQYVQQHAMRFGFDARRNPASLPLALGAGAVTPLELASAYGVFANGGTRVEPRLILSVKQRHGGVLYDAPAPSGTRVVSARNAFVMDSMLRDVVRAGTARGALALRRDDTAGKTGTSNGSKDVWFAGYSSGVVAVAWLGYDTPRSMGRATGATLALPVWLDYMKTAIDGRTPAEAVEPLDVARVDGDFVYAEYTRGACTADVPAFVRSRFACDGAARAEAASAGFAASAASTAANGGAMPVAPTPAPVDAAERARVLDLFRTED
>NZ_CP046341.1|WP_155816925.1|183441_184053_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPQYLVITLVAATVASRIARHVARMKTLFVTVDALGLAAFTIIGCDVGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILRRELYASVAFFSGALYVALQHVGIDPRVATVVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP046341.1|WP_155816924.1|182399_183242_+|heme-ABC-transporter-ATP-binding-protein
MLTVQHLRVARRHRVILHDLSLTIEPGRVTALLGRNGAGKSTLLKALAGELTGSAAPTGVRVTGRIALNGEPLAQIDAQQLARLRAVLPQAAQPAFPFSVDEIVLLGRYPHARGRGGALSRRDRGIAWHALARAGADTLLGRDVTTLSGGELARVQFARVLAQLWPSDDEAGRDARDASPTRYLLLDEPTAALDLAHQHRLLDTVRTIAREWRLGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPHDVMTPEHIARCYGFAVKRIDSGDGTPPVMVPA
>NZ_CP046341.1|WP_155816923.1|181288_182380_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MSARLSSIHASSAAAAAHGARRIGTQRRFAPVALGVLAVLVGAMSVVALCVGAYRISPADAWAALAGDPAAQQARAVLLGIRAPRVVLALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATAAIVLGPALFAAHAGAAALPAAAFVGALAIAALVYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWSTLAAVAPCAVLGCALLVRERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIVGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTLAAPAEIPLGVLTALLGAPFFLALLWKSRGSLGA
>NZ_CP046341.1|WP_155816922.1|180362_181277_+|ABC-transporter-substrate-binding-protein
MSARTFDPRRRAVLAAAAASALAATAPARAIAAVQSAPKRVVVIGGALAETAFALGGEHARGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAAIAQVARAGVAVQTFDEHHDADSVRAKIAGIAQALDMRDAGVALLRQFDRDWQAARDSVAAHVPRGAQPPRVLFVLNHTGNQALVAGRRTAADAMIRYAGARNAMQGFDHYKPLTSEALAAAAPDVVLISDEGLAAVGGRAALLAAPGFAATPAGRAQRIVSLDALLLLGFGPRLPLAVTTLHRRLSDTLA
>NZ_CP046341.1|WP_155816921.1|179283_180366_+|hemin-degrading-factor
MMQSPVSASSVRTSTSLRDAFVKLKRERRLRNRDVAQALGVSEGEALAAFVGEHVVRLDARFPDLFEEMPRLGRVMALTRNDAAVHEKDGAYAQMSHDGPVGLALGDIDLRIFYRQWASAFAVRDDTPHGPLKSLQFFNAQGHAIHKVYLRAHSDHAEYDAFVARWRAASQQPGLDVAPAAPKKPERADSAIDVAGFRAAWHAMTDTHQFFGITQRFGVSRLQALRLADPQHAYPLDAAHALRHVLERAAQSGQPIMVFVGNAGMIQIHTGPIANVREVGAWINVLDPGFNLHVREDMIATAWVVKKPTSDGIVTSVELFDRNGEHVALLFGERKPGQPERDDWRALVASLAPAARGDAR
>NZ_CP046341.1|WP_155816920.1|176968_179236_+|TonB-dependent-hemoglobin/transferrin/lactoferrin-family-receptor
MHRSTLARQPIFAALIGAVGLSAATAHADSSPSHASASSVTADAAAARANSALLDPVTVTATRTATAASRTAASVSVIDADDLDEQQATNIKDALRYEPGITVRRTAYRPGNAALGGGRDGDSSINIRGLEGNRVMLMEDGIRLPNAFSFGPLEAGRGDYTDLDTLKRIEIVRGPASALYGSDGLTGAVNFITKDPQDLLSIYRKPTYFSVRPSYDSTDRSIGATVSAAGGNDRIQGMIIADGRRGHEIDTRGSDNSAGKLRTTSNPQHVYSESLLGKLVLMPTVRDTIRLTAETVQRRVGTDVLSAIVAPATLGLTTSDRLERDRFSADYAFRDDASRWLQNAHVQFYYQEATQDQYAFETRGTLPSRSRDNRYRERTFGGSAFAESGFSTGPLAHKLLGGIDGSLSRITNLRDGTVPGVGETFPNKAFPDTDYTLFGAFVQDQIGYGRLLVTPGLRFDTYRLKPSGNDPLFTGRAVSTHANELSPRVAVLYEIAPALIPYLQYAHGFRAPTPDQVNSSFSNPVQGYTSIGNPNLKPETSDTFEAGLRGRAGTGYGTIRYSAAAFTGRYRNFIARTTIAGSGRPTDPFVFQYVNFADARVHGIEGRADWAMPNGITLRTALALTRGSTQNDGAASQPLNTVNPFSAVFGVRYEPTERWFVQTDLLFQAAKRDKDIDRSDCSKRACFAPPSSFVVDLRGGYRFNKHVSATVGIRNLFDRKYWNWSDVRGIAADSPVLDAYTSPGRTVAVSMKVDF
>NZ_CP046341.1|WP_035956177.1|176500_176728_+|hypothetical-protein
MNAQSLSGMLRAQELLLVSMVRTLPVDARGALVDLFTEQIAFAEQAGLESRADRDVHDAFVAHARNLLIRLESLA
>NZ_CP046341.1|WP_105811400.1|189890_190310_-|HIT-family-protein
MSYDDNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAASIRMTQRVATAVRAALAPDGLFIGQFNGAAAGQTVPHVHFHVIPRTEGVALRMHARDVADAATLESIAQRIRVHIA
>NZ_CP046341.1|WP_155816928.1|190502_191942_+|serine-hydrolase
MTIPLKPLIRRGVALALIAAIGYAGYQLSRLAPIATGYAAKALCSGVFVSGRPAASVIDVDIMAGVHPLLKLVRPSIDAEHHRAHATFAGFAARDAKFRPGLGCTLALGPAAAALPAALPPLPPAPAATAVPASLAIASASASSAATAPNGVDMRKLHAALDRAFDEPDPARPRRTRAVVVMWRGHVIAERYAPGFTGDTPLPGWSMTKTVTAVLIGMLVGQHRLSPDTAALLPEWRGAGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVAVMLFTQRDTARFASNKPLAAPPGTRWDYSSGTSEIIARVMRVALGGSTDDYLSFPRRALFAPLGMRSAVFEPDASGTLAAASFMYASARDWARFGQFLLQDGVWNGQRLLPEGWVRYLARATPQSSRAAFGAHLWVKVPEPFDDRDPHAPALPADAFHAVGHEGQFVSVVPSRDLVVVRLGLSRPESAWNHEAFLARVLDAIPASGT
>NZ_CP046341.1|WP_155816929.1|191966_192602_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEREDWGAGFRSTDDPAYLALNPNGLVPVIRDGDFVLWESNAILRYLANGYGDRYGDASLYPTDPQARARVDQWIDWQGTDLNRSWVGAFLGLVRKSPDHQDPAAIAQSIANWTKHMRVLNGQLEATGAFVAGEHFTIADIAIGLSVNRWFGTPFERPELPAVKRYAERLATREGFKTYAGSANP
>NZ_CP046341.1|WP_006397317.1|192887_194090_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGAGADTLGVFFERPGSETKPGTAGWYNSAAFERFATEKGLYARSINGDAFSDQVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGIDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLFKDSLYGATPHLDDEGRLRADYKELDPQIQKKVVELWDQVTNENLYELTDFAGYKTDFLRLFGFEIAGVDYDADVNPDVKIPRIIDTTA
>NZ_CP046341.1|WP_155816930.1|194396_194975_-|hypothetical-protein
MKRTHVVTGCAALLVALPIAAYALIKPLRVAVPALVPGMSCAHAPICIDDASKLADAQQLYRDGYARAAAAVGAFGDAPRVVFCSTRTCADAFGLGERAALTFGTVGVVIAPRGWHAYFVAHELIHHRQAETLGNLAVLTKPRWLIEGMAYSLSGDPRHPLKEPFEGWRARFDAWHAALGTRPLWDAARAVE
>NZ_CP046341.1|WP_039223209.1|195046_195577_-|GNAT-family-N-acetyltransferase
MTESVTVRRVGANEAIAYVDALSDVLIDCVEGGASVSFMLPIARSTAVAFWTGVAESVANGERILLVAEDASGRIVGTVQIVTAQPENQPHRADIAKMLVARHARRQGVAARLLAAADAAARDAGKTVLVLDTVTGGDAERLYERAGWQRVGVVPNYALMPDGAPCATTFFHKQLA
>NZ_CP046341.1|WP_155816931.1|195591_196044_-|hypothetical-protein
MVASFGRASARVACRCARRLFRNRRRARGASQCREGRGRCCDAAYGARAARRPAEAARRPPVARLRRCGNYFHRVAWRMRDRRSLWAQHPLALQLSLMLMLTPSAERRAPTPNAERRTPNAERRTPNAERRTPTIRTPADREPARAAHPT
>NZ_CP046341.1|WP_059781385.1|196042_196525_+|SRPBCC-family-protein
MMHSHTTRISRHVNAPRNRVYRALLDPHAVEQWKVPDGMTCHVHAFDAREGGALRVSLTADAAAPAGKTDAHTDTYHGRFVTLVPDRQVVEIDVFETDDPMLRGAMTITITLSDEDGGTRVDAVHDGVPPGVPAADNETGWRMALARLAALVEDGGRPHA
>NZ_CP046341.1|WP_155816932.1|196543_196693_+|polyketide-cyclase
MSDEDAGTRVDAVHDGVPPSVPAADNETGWRMARARLAALVEDGSRPHA
>NZ_CP046341.1|WP_155816933.1|196710_196860_+|polyketide-cyclase
MSDEDAGTRVDTVHGGVPPGVPAADNETGWRTALARLAALVEDGGRPHA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NC_015377	Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence	95186-95210	2	0.92
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP050106	Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence	483657-483681	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP025506	Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence	473988-474012	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP007050	Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence	137934-137958	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP050111	Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence	483841-483865	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP054025	Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence	38149-38173	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP030264	Ensifer adhaerens strain Corn53 plasmid AB, complete sequence	603995-604019	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP022668	Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence	362095-362119	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP054034	Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence	1162-1186	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP022569	Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence	96046-96070	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP029232	Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence	1337174-1337198	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP050088	Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence	38175-38199	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	MT708550	Achromobacter phage Mano, complete genome	39318-39342	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP050094	Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence	87328-87352	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NC_008379	Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence	70309-70333	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP018233	Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence	186867-186891	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NZ_CP048283	Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence	27894-27918	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	KJ944841	Mycobacterium phage Cheetobro, complete genome	16587-16611	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	KY087992	Mycobacterium phage Mitti, complete genome	16500-16524	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	MF140402	Mycobacterium phage Chancellor, complete genome	16587-16611	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	KT361920	Mycobacterium phage Slarp, complete genome	16587-16611	4	0.84
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	NC_016115	Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence	75744-75768	5	0.8
NZ_CP046341_1	1.3\|189017\|25\|NZ_CP046341\|CRISPRCasFinder	189017-189041	25	MN234216	Streptomyces phage Gilgamesh, complete genome	17479-17503	5	0.8

1. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NC_015377 (Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence) position: , mismatch: 2, identity: 0.92

cacggaacccgtgctgccgccgacc	CRISPR spacer
catcgaacccgtgctgccgccgacc	Protospacer
**. *********************

2. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP050106 (Rhizobium leguminosarum bv. trifolii strain 4B plasmid pRL4b5, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

3. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP025506 (Rhizobium leguminosarum bv. viciae strain UPM791 plasmid pRlvE, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

4. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP007050 (Rhizobium leguminosarum bv. trifolii WSM1689 plasmid unnamed, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

5. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP050111 (Rhizobium leguminosarum bv. trifolii strain 3B plasmid pRL3b1, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

6. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP054025 (Rhizobium sp. JKLM12A2 plasmid pPR12A204, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

7. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP030264 (Ensifer adhaerens strain Corn53 plasmid AB, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
tgcggaaaccgtgctgccgccgaac	Protospacer
..***** *************** *

8. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP022668 (Rhizobium leguminosarum bv. viciae strain BIHB 1217 plasmid pPR3, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

9. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP054034 (Rhizobium sp. JKLM13E plasmid pPR13E03, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

10. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP022569 (Rhizobium leguminosarum bv. viciae strain BIHB 1148 plasmid pSK05, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

11. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP029232 (Sinorhizobium fredii CCBAU 45436 plasmid pSF45436b, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
ggcggaacccttgctgccggcgacc	Protospacer
 .******** ******** *****

12. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP050088 (Rhizobium leguminosarum bv. trifolii strain 23B plasmid pRL23b6, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

13. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to MT708550 (Achromobacter phage Mano, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
ggcggaacgcctgctgccgccgacc	Protospacer
 .****** * **************

14. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP050094 (Rhizobium leguminosarum bv. trifolii strain 22B plasmid pRL22b4, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

15. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NC_008379 (Rhizobium leguminosarum bv. viciae 3841 plasmid pRL9, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

16. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP018233 (Rhizobium leguminosarum strain Vaf-108 plasmid unnamed5, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

17. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NZ_CP048283 (Rhizobium leguminosarum bv. viciae 248 plasmid pRle248c, complete sequence) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
cacgtaacccgtgccgccgccgata	Protospacer
**** *********.********.

18. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to KJ944841 (Mycobacterium phage Cheetobro, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

19. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to KY087992 (Mycobacterium phage Mitti, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

20. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to MF140402 (Mycobacterium phage Chancellor, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

21. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to KT361920 (Mycobacterium phage Slarp, complete genome) position: , mismatch: 4, identity: 0.84

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccggcacccgtgctgccgccgatc	Protospacer
  *** *****************.*

22. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to NC_016115 (Streptomyces pratensis ATCC 33331 plasmid pSFLA02, complete sequence) position: , mismatch: 5, identity: 0.8

cacggaacccgtgctgccgccgacc	CRISPR spacer
gccctcacccgtgctgccgccgacc	Protospacer
  *   *******************

23. spacer 1.3|189017|25|NZ_CP046341|CRISPRCasFinder matches to MN234216 (Streptomyces phage Gilgamesh, complete genome) position: , mismatch: 5, identity: 0.8

cacggaacccgtgctgccgccgacc	CRISPR spacer
gacggaaaccgtgctgccgccggag	Protospacer
 ****** **************.

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046342

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046343

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046341

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection