CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046346	Burkholderia multivorans strain FDAARGOS_722 chromosome 3, complete sequence	1 crisprs	DinG,DEDDh,csa3,cas3,WYL	0	5
NZ_CP046344	Burkholderia multivorans strain FDAARGOS_722 chromosome 1, complete sequence	3 crisprs	cas3,csa3,DinG	1	0
NZ_CP046345	Burkholderia multivorans strain FDAARGOS_722 chromosome 2, complete sequence	0 crisprs	csa3	0	1

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046346_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046346_1

1253182-1253267

Orphan

Consensus_repeat	Method
GTCGGATTGTTCGCGCCGCCAAG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046346_1

>merge|NZ_CP046346|1|1253182-1253267|CRISPRCasFinder
GTCGGATTGTTCGCGCCGCCAAGGGCGCCGGTAACCGTACCGACCACGCCGTTCAATGCGCCCGTCGGATTGTTCGCACCGCCAAG

>NZ_CP046346|1|1|1253182-1253267|CRISPRCasFinder
GTCGGATTGTTCGCGCCGCCAAG	GGCGCCGGTAACCGTACCGACCACGCCGTTCAATGCGCCC
GTCGGATTGTTCGCACCGCCAAG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046346.1\|WP_006400971.1\|1241706_1241877_-\|rubredoxin	unknown	unknown	gnl\|CDD\|224687
NZ_CP046346.1\|WP_059783835.1\|1255953_1256733_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270421
NZ_CP046346.1\|WP_012467504.1\|1242128_1242995_+\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	unknown	unknown	gnl\|CDD\|238574
NZ_CP046346.1\|WP_054316334.1\|1247908_1248424_-\|sigma-70-family-RNA-polymerase-sigma-factor	unknown	unknown	gnl\|CDD\|237123
NZ_CP046346.1\|WP_012214014.1\|1265641_1267069_+\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270238
NZ_CP046346.1\|WP_155822406.1\|1245508_1246018_-\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176866
NZ_CP046346.1\|WP_006406359.1\|1248451_1248811_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|226765
NZ_CP046346.1\|WP_006400973.1\|1243154_1244795_-\|chaperonin-GroEL	unknown	unknown	gnl\|CDD\|234573
NZ_CP046346.1\|WP_105793286.1\|1246057_1246648_-\|DUF1571-domain-containing-protein	unknown	unknown	gnl\|CDD\|377879
NZ_CP046346.1\|WP_006400977.1\|1246686_1247106_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|259881
NZ_CP046346.1\|WP_155822408.1\|1254641_1255886_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP046346.1\|WP_006401521.1\|1264863_1265226_-\|BON-domain-containing-protein	unknown	unknown	gnl\|CDD\|335963
NZ_CP046346.1\|WP_060144090.1\|1258968_1259700_+\|DsbA-family-oxidoreductase	unknown	unknown	gnl\|CDD\|239322
NZ_CP046346.1\|WP_006417068.1\|1261582_1262371_+\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|376667
NZ_CP046346.1\|WP_006400974.1\|1244840_1245134_-\|co-chaperone-GroES	unknown	unknown	gnl\|CDD\|178988
NZ_CP046346.1\|WP_081065736.1\|1247129_1247909_-\|anti-sigma-factor	unknown	unknown	gnl\|CDD\|227949
NZ_CP046346.1\|WP_155822410.1\|1259881_1261324_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|129794
NZ_CP046346.1\|WP_006400988.1\|1258073_1258865_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225512
NZ_CP046346.1\|WP_105782589.1\|1262620_1264714_-\|D-(-)-3-hydroxybutyrate-oligomer-hydrolase	unknown	unknown	gnl\|CDD\|313759
NZ_CP046346.1\|WP_155822409.1\|1257105_1258077_+\|ornithine-cyclodeaminase-family-protein	unknown	unknown	gnl\|CDD\|225280

Protein	Function_ID	Function_description	E-value
NZ_CP046346.1\|WP_006400971.1\|1241706_1241877_-\|rubredoxin	gnl\|CDD\|224687	COG1773, COG1773, Rubredoxin [Energy production and conversion].	8.3297e-21
NZ_CP046346.1\|WP_059783835.1\|1255953_1256733_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|270421	cd13703, PBP2_HisJ_LAO, Substrate binding domain of ABC-type histidine- and lysine/arginine/ornithine transporters; the type 2 periplasmic-binding protein fold. This subgroup includes the periplasmic-binding proteins, HisJ and LAO, that serve as initial receptors in the ABC transport of histidine and lysine-arginine-ornithine amino acids. They are belong to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two receptor cytoplasmically-located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.13247e-116
NZ_CP046346.1\|WP_012467504.1\|1242128_1242995_+\|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase	gnl\|CDD\|238574	cd01169, HMPP_kinase, 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate kinase (HMPP-kinase) catalyzes two consecutive phosphorylation steps in the thiamine phosphate biosynthesis pathway, leading to the synthesis of vitamin B1. The first step is the phosphorylation of the hydroxyl group of HMP to form 4-amino-5-hydroxymethyl-2-methyl-pyrimidine phosphate (HMP-P) and then the phophorylation of HMP-P to form 4-amino-5-hydroxymethyl-2-methyl-pyrimidine pyrophosphate (HMP-PP), which is the substrate for the thiamine synthase coupling reaction.	5.78023e-71
NZ_CP046346.1\|WP_054316334.1\|1247908_1248424_-\|sigma-70-family-RNA-polymerase-sigma-factor	gnl\|CDD\|237123	PRK12511, PRK12511, RNA polymerase sigma factor; Provisional.	1.08515e-39
NZ_CP046346.1\|WP_012214014.1\|1265641_1267069_+\|C4-dicarboxylate-ABC-transporter-substrate-binding-protein	gnl\|CDD\|270238	cd13520, PBP2_TAXI_TRAP, Substrate binding domain of TAXI proteins of the tripartite ATP-independent periplasmic transporters; the type 2 periplasmic binding protein fold. This group includes Thermus thermophilus GluBP (TtGluBP) of TAXI-TRAP family and closely related proteins. TRAP transporters are ubiquitous in prokaryotes, but absent from eukaryotes. They are comprised of an SBP (substrate-binding protein) of the DctP or TAXI families and two unequally sized integral membrane components. Although TtGluBP is predicted to be an L-glutamate and/or an L-glutamine-binding protein, the substrate spectrum of TAXI proteins remains to be defined. A sequence-homology search also shows that TtGluBP shares low sequence homology with putative immunogenic proteins of uncharacterized function. The substrate-binding domain of TAXI proteins belongs to the type 2 periplasmic-binding fold protein (PBP2) superfamily, whose members are involved in chemotaxis and uptake of nutrients and other small molecules from the extracellular space as a primary receptor. PBP2 typically comprises of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and tworeceptor cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	2.67961e-29
NZ_CP046346.1\|WP_155822406.1\|1245508_1246018_-\|polyketide-cyclase	gnl\|CDD\|176866	cd07824, SRPBCC_6, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	1.90305e-70
NZ_CP046346.1\|WP_006406359.1\|1248451_1248811_-\|hypothetical-protein	gnl\|CDD\|226765	COG4315, COG4315, Uncharacterized protein conserved in bacteria [Function unknown].	1.9019e-38
NZ_CP046346.1\|WP_006400973.1\|1243154_1244795_-\|chaperonin-GroEL	gnl\|CDD\|234573	PRK00013, groEL, chaperonin GroEL; Reviewed.	0
NZ_CP046346.1\|WP_105793286.1\|1246057_1246648_-\|DUF1571-domain-containing-protein	gnl\|CDD\|377879	pfam07608, DUF1571, Protein of unknown function (DUF1571). A family of paralogous proteins in Rhodopirellula baltica.	6.23704e-08
NZ_CP046346.1\|WP_006400977.1\|1246686_1247106_-\|hypothetical-protein	gnl\|CDD\|259881	cd04219, Plastocyanin, Plastocyanin is a type I copper protein and functions in the electron transfer from PSII to PSI. Plastocyanin is a small copper-containing protein found in cyanobacteria, higher plants, and some algae, where it plays a role in photosynthesis. The two photosystems that are primarily responsible for photosynthesis are photosystem I (PSI) and photosystem II (PSII). The flow of electrons begins in PSII, which acts as a proton pump. Plastocyanin is responsible for transporting electrons from PSII to PSI.	0.000904151
NZ_CP046346.1\|WP_155822408.1\|1254641_1255886_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.47887e-51
NZ_CP046346.1\|WP_006401521.1\|1264863_1265226_-\|BON-domain-containing-protein	gnl\|CDD\|335963	pfam04972, BON, BON domain. This domain is found in a family of osmotic shock protection proteins. It is also found in some Secretins and a group of potential haemolysins. Its likely function is attachment to phospholipid membranes.	3.48062e-11
NZ_CP046346.1\|WP_060144090.1\|1258968_1259700_+\|DsbA-family-oxidoreductase	gnl\|CDD\|239322	cd03024, DsbA_FrnE, DsbA family, FrnE subfamily; FrnE is a DsbA-like protein containing a CXXC motif. It is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	2.99903e-81
NZ_CP046346.1\|WP_006417068.1\|1261582_1262371_+\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|376667	pfam01925, TauE, Sulfite exporter TauE/SafE. This is a family of integral membrane proteins where the alignment appears to contain two duplicated modules of three transmembrane helices. The proteins are involved in the transport of anions across the cytoplasmic membrane during taurine metabolism as an exporter of sulfoacetate. This family used to be known as DUF81.	8.11157e-24
NZ_CP046346.1\|WP_006400974.1\|1244840_1245134_-\|co-chaperone-GroES	gnl\|CDD\|178988	PRK00364, groES, co-chaperonin GroES; Reviewed.	7.84817e-55
NZ_CP046346.1\|WP_081065736.1\|1247129_1247909_-\|anti-sigma-factor	gnl\|CDD\|227949	COG5662, COG5662, Predicted transmembrane transcriptional regulator (anti-sigma factor) [Transcription].	5.36994e-22
NZ_CP046346.1\|WP_155822410.1\|1259881_1261324_+\|DHA2-family-efflux-MFS-transporter-permease-subunit	gnl\|CDD\|129794	TIGR00711, Uncharacterized_MFS-type_transporter_YhcA, drug resistance transporter, EmrB/QacA subfamily. This subfamily of drug efflux proteins, a part of the major faciliator family, is predicted to have 14 potential membrane-spanning regions. Members with known activities include EmrB (multiple drug resistance efflux pump) in E. coli, FarB (antibacterial fatty acid resistance) in Neisseria gonorrhoeae, TcmA (tetracenomycin C resistance) in Streptomyces glaucescens, etc. In most cases, the efflux pump is described as having a second component encoded in the same operon, such as EmrA of E. coli. [Cellular processes, Toxin production and resistance, Transport and binding proteins, Other].	2.74682e-66
NZ_CP046346.1\|WP_006400988.1\|1258073_1258865_+\|hypothetical-protein	gnl\|CDD\|225512	COG2964, COG2964, Uncharacterized protein conserved in bacteria [Function unknown].	1.26717e-68
NZ_CP046346.1\|WP_105782589.1\|1262620_1264714_-\|D-(-)-3-hydroxybutyrate-oligomer-hydrolase	gnl\|CDD\|313759	pfam10605, 3HBOH, 3HB-oligomer hydrolase (3HBOH). D-(-)-3-hydroxybutyrate oligomer hydrolase (also known as 3HB-oligomer hydrolase) functions in the degradation of poly-3-hydroxybutyrate (PHB). It catalyzes the hydrolysis of D(-)-3-hydroxybutyrate oligomers (3HB-oligomers) into 3HB-monomers.	0
NZ_CP046346.1\|WP_155822409.1\|1257105_1258077_+\|ornithine-cyclodeaminase-family-protein	gnl\|CDD\|225280	COG2423, COG2423, Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism].	5.32906e-65

>NZ_CP046346.1|WP_006406359.1|1248451_1248811_-|hypothetical-protein
MKTMLFAVALTAAIARPAAAEPPQVGDGKLVDDEHMTLYVFDRDAPGKSACTGTCAANWPPALADAYDKPSGALSVVARDDGKMQWAYNGRPLYRWKMDRKAGDAGGDGVGGVWHVAHP
>NZ_CP046346.1|WP_054316334.1|1247908_1248424_-|sigma-70-family-RNA-polymerase-sigma-factor
MSYESDLLVWLPHLTRYARALTGDRAWADDLVQDTLERALNRPPRDAGNLRAWLLTLLRHRFIDQLRARHEVAVDDATAPWQTLAAPPGDVGGLMLRDVQRALYRLPVEQREVLLLVALEELSYRDAAQVLGVPVGTVMSRLSRAREQMRALLSGEPATHGTAALRVIGKT
>NZ_CP046346.1|WP_081065736.1|1247129_1247909_-|anti-sigma-factor
MDESRTPSDDRDDEASAQLLSALLDGELSAHERREVLERLQSDPREADRFAHYRAQRDALHALFPLPPATSALFVQRRASRRPRFAYAFAGLAAGLLIGIALHAGWTALGAAPEFATRADAAYAVYAADRDHPVEVDARDPERLAAWLSARLGRPVRAPSLGEYGYALLGGRLLPGDAGPAAQLMYQRADGDRVTLYMTAYDARRVAPQPLSADGRYTYFWSDRGMGYALSGGGDERRVRELAIEACGALGGPVGAWSG
>NZ_CP046346.1|WP_006400977.1|1246686_1247106_-|hypothetical-protein
MKAMAAVWAGLVVLAAGTGFAYADDDAPVRVPIDPDGVQRVTIVGGSYFFRPNHVIVTAQAPVELTVSAEPGIVPHSFRIDAPQAGIDVRTELATTPRTFRFTPTQPGRFAYYCTHRLPLFGSHRARGMEGVLDVEAAP
>NZ_CP046346.1|WP_105793286.1|1246057_1246648_-|DUF1571-domain-containing-protein
MTADPVTVAQSQFDHVHSYRATIRSTARSGEHTEIRYAYLKPGFVRMDFVSPHHGAVLAYDPDDGKVRLRPFGVHMPPALTLSPDNPMVRDRSGHRVDRSDIGQLLRNVHALQQGGATVSEGEETVGGRTTLRVSVTGAPAQAVDGVHRYRLWLDTEDGFPRKVVSFADDDGEPLETVTLDDIELDVAFPERFFAP
>NZ_CP046346.1|WP_155822406.1|1245508_1246018_-|polyketide-cyclase
MAEYRFSTTWHVDAPLMAVWDAIYQVDRWPDWWKGAVRTVELEAGDARGVGALHRYTWKGALPYRLTFDMRVRRVEPPHVLEGRASGAIEGDGRWSFVADGARTLVRYDWHIRTHARWMKWLEPIARPLFTWNHDVVMRDGAKGLARLLGATVETDGRTFRPLEGCPEA
>NZ_CP046346.1|WP_006400974.1|1244840_1245134_-|co-chaperone-GroES
MNLRPLHDRVIVKRLDQETKTASGIVIPDAAAEKPDQGEVLAVGPGKRDDKGAPIALDVKVGDRVLFGKYAGQTVKVDGQELLVMREEDIMAVVNAK
>NZ_CP046346.1|WP_006400973.1|1243154_1244795_-|chaperonin-GroEL
MAAKDVVFGDSARAKMVEGVNILANAVKVTLGPKGRNVVLERSFGGPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGMKYVASGMNPMDLKRGIDKAVAAAVEELKKISKPCTTNKEIAQVGAISANSDSSIGDRIAEAMDKVGKEGVITVEDGKSLADELDVVEGMQFDRGYLSPYFINNPDKQVAVLENPFVLLHDKKVSNIRDLLPVLEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPGFGDRRKAMLEDIAILTGGQVIAEETGLTLEKATLAELGQAKRIEVGKENTTIIDGAGEAANIEARVKQIRTQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGIVPGGGVALIRARTAIASLTGANADQNAGIKIVLRAMEEPLRQIVTNGGEEASVVVAAVAAGKGNYGYNAATGEYVDMVEAGVVDPTKVTRTALQNAASVAGLLLTTDAAVAELPKEDAPMPGGMPGGMGGMGMDM
>NZ_CP046346.1|WP_012467504.1|1242128_1242995_+|hydroxymethylpyrimidine/phosphomethylpyrimidine-kinase
MSSNAPPIVLTFGLSDPTGGSGLQADLMTLASMGCHGVSVLTGYTVRDSAACDEVTGLDPDIVAAQARMLLEDMPVAAFKIGAATRAEVVSAIAEVVADYDGVPLVLAPDFTLDDEHVLAADDLRESIADLLAPQTTLLVADHATLIALAQPDGDAEAPNLDAAVSHLLSQGCEYILSSETGSHRLVNTLYGEEGQLREDMWDRSPHRLMGITDTLGAAIAALLANGQEPPEAVREAQEYLYQAVRDAFRPGMGAYLPDRFFWARSNEDADAPPAAAVEPLPRTSHRH
>NZ_CP046346.1|WP_006400971.1|1241706_1241877_-|rubredoxin
MEYKSWMCLICGWIYDEEAGLPDEGIAPGTRWEDVPINWTCPECGARKEDFEMVQI
>NZ_CP046346.1|WP_155822408.1|1254641_1255886_-|FAD-dependent-oxidoreductase
MDFDVIVLGAGIVGVSSALHLQDRGLRVALVDRRDPGEETSHGNAGLIERSSVVPYAFPRRLGTLLRYARNRSVDLYWDYRALPTYAGWLARFWRESSPKRLAAAARDMLPLVAASVVEHDVLLARTDAQPLVHDGGWIEAFRSPALFDEEASAQQRIAHAHGLRMTVLDARALRAREPGIGEAFCGAFHWQDPKTVSSPGGLTKAYARLFERDGGTFVHGDAATLAQIRDGWQVATAHGSMSARSVVVALGPWSERVFGPLGYRIPLRAKRGYHMHYRPTRAPLRVPVCDTEQGFVVAPMDGGRLRLTTGVEIALPDAPPTGVQLARAEPLAREAFGLGERLDAEPWLGLRPCTPDMRPVIGPAPRHRGLWFAFGHCHHGLTLGPATGRLLAEMMTGTPTYIDPRPYRPERFG
>NZ_CP046346.1|WP_059783835.1|1255953_1256733_-|ABC-transporter-substrate-binding-protein
MNWKLSLCAAAALACAAVTVHAEPTTLRFGIEAAYPPFESKTPAGQLQGFDVDIGNAVCAKLNMKCVWVENAFDGLIPALQARKFDVINSAMNITAKRKQSIDFTPPIYVVPIVMIAKRGSPLRPEVASVRGKRVGVLQGSSQEDFLKAHWANAGVSVVSYQDQDQIYADLVAGRLDAAVQEAQTAQEGFLDKPAGHDYQIVGEPLKDPATLGEGTGFGLRKGDKALQAKVVGALDALKKDGTLSALSQKYFKRDIIAK
>NZ_CP046346.1|WP_155822409.1|1257105_1258077_+|ornithine-cyclodeaminase-family-protein
MNPTAPTLPLTVDDAMVRAALPSLDVLGTLRRMFASLASARAVQPPQTLTLFPEQAGDFITYLGALADEQVFGAKLSPYIVGGGPDGKPVVTAWTALMSMRTGQPLMWCDAGQLTVERTAGTTALAVDCLAPRDARRLAIVGAGAVGLAHLRHAAALREWDAISVYSPTLADDRALQAAVAGTDPRARPAADIAACVRDADVVMLCTSSGTPVLGDGMLTRPALVTSISTNVAQAHEIPPAWLPDMDVYCDYRHTTPASAGEMRLAAAEHGWTPEHIVGDLPALVAGTCAAPSRTRHAFFRSIGLGLEDIAIAYALYTHLTRA
>NZ_CP046346.1|WP_006400988.1|1258073_1258865_+|hypothetical-protein
MSIVRTRRRYNGATATAARGRTGTTTAGAPADRPDPRPASRSPDIAIPMRKKPSPVKDLLLTRYAPIADGIAALFFPYAEVVIHDLHDQTVLYLANNLSKREVGDDSALEEIDHSARERVIGPYEKLNWDGRRMRCVSNVLFDDDGRPAGMMCINFNIAVFDEVRTTLDLFIKGAGVVAQPDELFRDDWQERINTFLHGWLRERQIGLNGLTREHRRELVEALHAQGAFRGKSAANYVANVLGMGRATVYKHLKHLKDTQGDA
>NZ_CP046346.1|WP_060144090.1|1258968_1259700_+|DsbA-family-oxidoreductase
MPTAPAPTARPTLTVEIWSDLICPWCWIGKRRFDEALAAFAHADRVDVALRAYRLMPGQPVEPVEAMLAGKYRMSAAQVDQMLRQVTDAAASVGLRYDLPGTLVGDTLDAHRLVKLAEATGRAHALTERLYRAYFCEHGSLFDHTALADFAVEAGLERAAVEAALRGDAYRDEVEADGARAAQIVGRGVPLFVFGGRYAVSGAQPADVFAQALEQAWRDGVVEAGGDAAAACGPDGCALPPRE
>NZ_CP046346.1|WP_155822410.1|1259881_1261324_+|DHA2-family-efflux-MFS-transporter-permease-subunit
MTHGIHGEKRWYALIVLCLGVLMIVLDSTIVNVALPSIGTDLHFTETALVWVVNAYLLTFGGCLLLGGRLGDLYGQRRMFLAGLVVFTLASLACGLAPSQTMLIAARAVQGLGGAVVSAVSLSLIMNLFTEPGERARAMGVYGFVCAGGGSIGVLLGGLLTSALSWHWIFLVNLPIGIAVYALCAALLPRTRAPAGAGRLDVAGAITVTASLMLAVYGIVGGNEAGWLSAQTVALIGAAVVLLALFVAIEMRVAHPLMPLTLFAARNVALANVISVLWAAAMFAWFFLSALYLQRVLGYGPLQVGLAFLPANLIMAAFSLGLSARIVMRFGIRGPIAAGLLIAACGLALFARAPVDGGFVWHVLPGMTLLGIGAGIAFNPVLLAAMSDVDPADSGLASGIVNTAFMMGGALGLAVLASVAAARTDALAVAQVAPLGALNGGYHAAFAFGAAFAALAAAIGIALRVSPPAPADSGVGASLH
>NZ_CP046346.1|WP_006417068.1|1261582_1262371_+|sulfite-exporter-TauE/SafE-family-protein
MSLPHIDLLYSLSGLFVGILVGLTGVGGGSLMTPILVLLFGVHPATAVGTDLLYAAATKATGTLVHGLKGSIDWRVTGRLAAGSVPAAAVTLWVLHSHGMNAPGTARLIQLVLGIALLLTSVALIFRPQLAAFAARNPLAPSPGRTLWSTVLTGAVLGVLVSMTSVGAGAIGVTVLLLLYPALATTRIVGSDIAHAVPLTLVAGMGHWLLGSVDWSMLLSLLLGSLPGIVIGSLLSARAPERLLRNLLAATLVAVGVRLVLA
>NZ_CP046346.1|WP_105782589.1|1262620_1264714_-|D-(-)-3-hydroxybutyrate-oligomer-hydrolase
MTMHGWGRWMLVGTALAGIAVLLGACNGDETSERNRLPGFVSGDVRTTAYDGTSDDLLTAGLGKTGLASATAPAFANPSRPTSAELRRLAIWSNYRALVDMSANGGYGRFWGPNVDVDGNATLGEGKIAGTEYLAYSDDGSGRKNVTLLVQVPASFNPAQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYNDKGGGNGAHELGSDTVTLIDGTLANAVLAGNASLFTANLTSGDLAAFNSRFPNRYAFKHAHSQQNPEQDWGRSTLQAVEFAYWALNEQFAPLVDGSHRGVRYRAGDITTIAASVSNGGGASLAAAEQDDRGWITAVVVGEPQINVRLAPNAVVRSGGQPVPSFGRPLADYATLANLLQPCAAASASLAGEPYLSALPLATTQSIRTQRCATLAAAGLVSGADTQSQAADALAQLHAAGYLADSDLLHASMWDSQAIPAIAVTYANAYTRSRVTDNLCNFSFATTQAGTGAVAPPAASPMPAVFGAGNGIPPTAGIDLVFNTGAGVDHRLATPDASFAGALCLRQLWTNAMLGMPANVEAVRVNANLHGKPAIIVQGRSDALVPVNHASRAYVAQNSLTEGSRSGLVFYEVTNGQHFDAFLPVAGYDTRFVPVHYYNLQALNLMWQHLKQGAPLPPSQVIRTVPRGGTPGAAPALTTANLPPIAGAPGANAISAAAGTIDVPL
>NZ_CP046346.1|WP_006401521.1|1264863_1265226_-|BON-domain-containing-protein
MKSIVLRALGIAAVAACLSGSAYAQSSEPAAAEAPAAATQSKSAAKTAKHANRKLGYAVRKAITKAGGIDVSNLVVRSKGGAITLEGTVPDQAQIDKAGEAAKGVKGVTSVTNKLTVQQQ
>NZ_CP046346.1|WP_012214014.1|1265641_1267069_+|C4-dicarboxylate-ABC-transporter-substrate-binding-protein
MKPTRPQRPPPRILARFVAVSWRDLALSIGPTVLLAAAAVWLAIRMIQPAPPSTLVISAGPPGSTYWNAAQKYKAILAKNGVTLDVESSEGSAQNLARLQNPNATVDVGFVQSGIGPKERDDHLASLGSIGYVPLAIMYRGPVVARLSDFNGKRLAIGAEGSGARELSLALLKMNGIEPGGTTRLLPTSGEDAAAALLDGKIDAAFLSGDSTQIPVMAKLFRTPGVHMYSFTQAEAYARRFPYLTAITLPMGVYDLGRNLPPEDLHTVAPTIELVARDTLHPALSDLLIEAAREVHGHATILQHAGEFPSPVTRGFPLSDDAARYYKSGKTFLYRRLPFWVASLVDRLLVVVVPLIVVLIPGLRLVPSLYGWRVRSRIYRWYGALIAIERRALGEHTAEERVALLDELDDIEEAVNRMKMPLAYAGQFYVLREHIGFVRERLAAHEADTPAGAASRAADAAPRVADAPRATPGSA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

702775 : 742075

Burkholderia_phage(57.5%)

terminase,head,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155822199.1\|702775_703273_-	glycoside hydrolase family protein	Q3HQU9	Burkholderia_phage	1.5e-84	94.5
WP_048996401.1\|703265_703448_-	hypothetical protein	NA	NA	NA	NA
WP_155822200.1\|703567_704353_+	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_155822201.1\|704684_704873_-	hypothetical protein	NA	NA	NA	NA
WP_155822978.1\|704881_705565_-\|tail	phage tail protein	A9YX14	Burkholderia_phage	1.4e-43	59.0
WP_155822202.1\|705935_707447_-	DUF2612 domain-containing protein	A9YX13	Burkholderia_phage	3.1e-72	37.7
WP_155822203.1\|707446_708628_-	hypothetical protein	A9YX12	Burkholderia_phage	2.0e-199	93.4
WP_155822204.1\|708624_708978_-	hypothetical protein	A9YX11	Burkholderia_phage	4.3e-57	95.7
WP_155822205.1\|708985_709735_-	hypothetical protein	A9YX06	Burkholderia_phage	6.0e-125	92.8
WP_105839657.1\|709738_710116_+	hypothetical protein	A9YX05	Burkholderia_phage	8.1e-54	83.2
WP_155822206.1\|710112_711078_-	hypothetical protein	A9YX04	Burkholderia_phage	4.2e-155	94.5
WP_155822207.1\|711124_711958_-	DNA-binding protein	Q8SBE6	Shigella_phage	1.8e-29	61.1
WP_077056345.1\|711957_712221_-	hypothetical protein	NA	NA	NA	NA
WP_125902729.1\|712241_712433_-	Arc family DNA-binding protein	NA	NA	NA	NA
WP_125902728.1\|712514_712847_+	Arc family DNA-binding protein	NA	NA	NA	NA
WP_155822208.1\|712847_713162_-	hypothetical protein	NA	NA	NA	NA
WP_155822209.1\|713161_713737_-	hypothetical protein	I3PGV3	Xanthomonas_phage	7.4e-06	25.7
WP_155822210.1\|713733_715788_-	mannosyl-glycoprotein endo-beta-N-acetylglucosamidase	A0A0M4REK7	Salmonella_phage	1.1e-38	36.2
WP_155822211.1\|715971_716526_-	hypothetical protein	A0A0N7IRF3	Acinetobacter_phage	3.1e-17	35.6
WP_069220302.1\|716528_716969_-	DUF3277 family protein	A0A2H4J619	uncultured_Caudovirales_phage	6.8e-44	58.9
WP_155822212.1\|716983_718459_-	DUF3383 family protein	A0A0P0I492	Acinetobacter_phage	1.3e-110	47.1
WP_155822213.1\|718468_719059_-	hypothetical protein	A9YX29	Burkholderia_phage	1.6e-104	94.9
WP_155822214.1\|719063_719435_-	hypothetical protein	A9YX28	Burkholderia_phage	1.9e-63	95.1
WP_155822215.1\|719496_719979_-	hypothetical protein	A9YX26	Burkholderia_phage	3.8e-72	88.7
WP_155822216.1\|720007_720391_-	DUF4054 domain-containing protein	A9YX25	Burkholderia_phage	3.5e-60	90.6
WP_155822217.1\|720399_720663_-	hypothetical protein	A9YX24	Burkholderia_phage	5.2e-15	74.0
WP_155822218.1\|720664_721702_-	DUF2184 domain-containing protein	A0A0N7IRF2	Acinetobacter_phage	9.9e-126	67.2
WP_059594712.1\|721712_722201_-	hypothetical protein	A0A0P0I8F3	Acinetobacter_phage	1.9e-39	56.8
WP_155822219.1\|722213_723497_-	DUF2213 domain-containing protein	A0A0P0IRE1	Acinetobacter_phage	1.0e-68	44.7
WP_088924405.1\|723498_723720_-	hypothetical protein	NA	NA	NA	NA
WP_088925826.1\|723721_724399_-\|head	phage head morphogenesis protein	A9YWZ8	Burkholderia_phage	2.2e-73	65.6
WP_088925827.1\|724292_725879_-	DUF1073 domain-containing protein	A0A0P0I486	Acinetobacter_phage	7.9e-151	60.3
WP_155822220.1\|725875_727471_-	TerL protein	A9YWZ6	Burkholderia_phage	1.4e-293	90.4
WP_105775875.1\|727472_728036_-\|terminase	terminase small subunit	H2BD75	Pseudomonas_phage	9.6e-59	66.5
WP_155822221.1\|728122_728302_-	hypothetical protein	NA	NA	NA	NA
WP_155822222.1\|728300_728447_+	hypothetical protein	NA	NA	NA	NA
WP_155822223.1\|728582_729014_-	hypothetical protein	NA	NA	NA	NA
WP_081336772.1\|729010_729304_-	hypothetical protein	A9YWZ0	Burkholderia_phage	2.2e-22	62.2
WP_155822224.1\|729350_729821_-	RusA family crossover junction endodeoxyribonuclease	A9YWY9	Burkholderia_phage	2.4e-63	80.8
WP_155822225.1\|729817_730078_-	hypothetical protein	NA	NA	NA	NA
WP_155822226.1\|730074_730821_-	hypothetical protein	A0A0U1UNR3	Pseudomonas_phage	5.1e-23	42.6
WP_155822979.1\|730823_731786_-	DUF1376 domain-containing protein	H2BD69	Pseudomonas_phage	8.0e-29	47.3
WP_155822980.1\|731842_732049_-	hypothetical protein	A9YWY0	Burkholderia_phage	6.0e-27	82.4
WP_155822227.1\|732051_732426_-	hypothetical protein	A9YWX9	Burkholderia_phage	1.6e-57	85.5
WP_155822228.1\|732592_732844_+	hypothetical protein	NA	NA	NA	NA
WP_155822229.1\|733245_734019_+	helix-turn-helix domain-containing protein	A0A0R6PHL1	Moraxella_phage	5.4e-36	37.1
WP_155822230.1\|734313_734586_+	hypothetical protein	NA	NA	NA	NA
WP_155822231.1\|734629_734827_-	hypothetical protein	NA	NA	NA	NA
WP_155822232.1\|735320_735764_+	hypothetical protein	NA	NA	NA	NA
WP_155822233.1\|735792_736062_+	hypothetical protein	A0A2R2YAV1	Pseudomonas_phage	3.7e-16	53.0
WP_054316253.1\|736191_736461_+	hypothetical protein	NA	NA	NA	NA
WP_155822234.1\|736658_737414_+	hypothetical protein	Q3HQX1	Burkholderia_phage	4.9e-58	90.1
WP_155822235.1\|737442_737787_+	hypothetical protein	Q3HQX0	Burkholderia_phage	3.7e-53	94.7
WP_155822236.1\|737817_738168_+	hypothetical protein	I6NP76	Burkholderia_phage	1.7e-37	67.2
WP_155822237.1\|738222_738486_+	hypothetical protein	NA	NA	NA	NA
WP_155822238.1\|738517_738853_+	hypothetical protein	NA	NA	NA	NA
WP_155822239.1\|738878_739145_+	hypothetical protein	NA	NA	NA	NA
WP_155822240.1\|739141_739618_+	hypothetical protein	Q3HQW8	Burkholderia_phage	5.0e-08	66.0
WP_105767472.1\|739610_739889_+	hypothetical protein	NA	NA	NA	NA
WP_105775887.1\|740204_741017_+	exonuclease VIII	G8CLD3	Synechococcus_phage	1.6e-46	40.8
WP_155822981.1\|741022_742075_+	recombinase RecT	Q858E1	Salmonella_phage	4.7e-59	48.8

DBSCAN-SWA_2

1015509 : 1023796

Yaba_monkey_tumor_virus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155822320.1\|1015509_1016415_+	alpha/beta fold hydrolase	Q6TUZ7	Yaba_monkey_tumor_virus	2.8e-15	26.4
WP_155822321.1\|1016439_1017363_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	3.9e-41	34.0
WP_155822322.1\|1017406_1018750_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_006413203.1\|1018830_1019733_-	cysteine synthase CysM	A0A1X9I5F1	Streptococcus_phage	4.8e-52	39.5
WP_059783473.1\|1019943_1020321_-	competence protein ComE	NA	NA	NA	NA
WP_006400719.1\|1020396_1021389_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	6.9e-28	30.9
WP_050804771.1\|1021437_1022403_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	1.2e-16	27.5
WP_155822323.1\|1022395_1023796_-	nucleotide sugar dehydrogenase	A0A127AXI2	Bacillus_phage	3.0e-77	37.7

DBSCAN-SWA_3

1356889 : 1365861

unidentified_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035949390.1\|1356889_1358428_+	polynucleotide adenylyltransferase PcnB	H7BUW3	unidentified_phage	6.1e-23	30.7
WP_006417097.1\|1358463_1359003_+	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_035949388.1\|1358999_1359686_+	deoxynucleoside kinase	A0A0M3UL55	Enterococcus_phage	2.7e-07	30.1
WP_039224558.1\|1359732_1360548_+	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0N7HVJ8	Ostreococcus_lucimarinus_virus	3.9e-37	33.7
WP_155822440.1\|1360653_1362516_-	aminodeoxychorismate synthase component I	S4VNU7	Pandoravirus	2.6e-60	38.9
WP_006417099.1\|1362519_1363650_-	molecular chaperone DnaJ	E3T4P7	Cafeteria_roenbergensis_virus	2.8e-25	39.0
WP_006401601.1\|1363914_1365861_-	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	2.7e-148	51.2

DBSCAN-SWA_4

1651787 : 1709660

Acinetobacter_phage(33.33%)

plate,integrase,tRNA,tail

attL 1639726:1639743|attR 1723418:1723435

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1639726:1639743	attL	NA	NA	NA	NA
WP_105857383.1\|1651787_1653035_-\|integrase	integrase family protein	NA	NA	NA	NA
WP_006406916.1\|1653091_1654186_+	redox-regulated ATPase YchF	NA	NA	NA	NA
WP_155822516.1\|1654255_1655125_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_146121200.1\|1655766_1656087_+	hypothetical protein	NA	NA	NA	NA
WP_155822517.1\|1656153_1657308_+	cupin	NA	NA	NA	NA
WP_006400482.1\|1657448_1658840_-	GABA permease	NA	NA	NA	NA
WP_060151448.1\|1659209_1659548_-	hypothetical protein	NA	NA	NA	NA
WP_155822518.1\|1659616_1660996_-	MFS transporter	NA	NA	NA	NA
WP_155822519.1\|1661134_1662052_+	transcriptional regulator GcvA	NA	NA	NA	NA
WP_006400487.1\|1662161_1662470_+	DUF3761 domain-containing protein	NA	NA	NA	NA
WP_006400488.1\|1662653_1664321_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	4.4e-43	28.1
WP_060097768.1\|1664394_1665018_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_006414118.1\|1665014_1665566_-	isochorismatase family protein	NA	NA	NA	NA
WP_060145277.1\|1665624_1667439_-	aminopeptidase P family protein	A0A0P0I8D7	Acinetobacter_phage	3.8e-173	50.6
WP_006406928.1\|1667457_1667712_-	hypothetical protein	NA	NA	NA	NA
WP_035949183.1\|1667880_1668642_+	response regulator transcription factor	NA	NA	NA	NA
WP_006400498.1\|1668668_1669967_+\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_006400499.1\|1670049_1671132_+	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	8.7e-08	44.8
WP_035949180.1\|1671142_1671985_+	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_006400503.1\|1672052_1672364_+	Grx4 family monothiol glutaredoxin	NA	NA	NA	NA
WP_006414108.1\|1672377_1672974_+	UbiX family flavin prenyltransferase	NA	NA	NA	NA
WP_006406932.1\|1673192_1673984_+	dioxygenase	NA	NA	NA	NA
WP_006400506.1\|1674138_1675737_-	APC family permease	NA	NA	NA	NA
WP_006400508.1\|1676159_1676363_+	cold-shock protein	A0A2H4N7Y6	Lake_Baikal_phage	1.4e-20	71.6
WP_155822520.1\|1676474_1677725_-	Hsp70 family protein	NA	NA	NA	NA
WP_006400510.1\|1677881_1678487_-	nitroreductase family protein	NA	NA	NA	NA
WP_054315501.1\|1678633_1679917_-	MFS transporter	NA	NA	NA	NA
WP_006400513.1\|1680129_1680750_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_006400514.1\|1680805_1681378_+	DUF1415 domain-containing protein	NA	NA	NA	NA
WP_035949172.1\|1681428_1682319_-	methyltransferase	NA	NA	NA	NA
WP_155822521.1\|1682408_1683542_-	methyltransferase	NA	NA	NA	NA
WP_155822522.1\|1683651_1684149_-	Water stress and hypersensitive response domain-containing protein	NA	NA	NA	NA
WP_006414124.1\|1684792_1686964_+	peptidase M1	A0A0P0IY26	Acinetobacter_phage	2.9e-50	26.6
WP_012467450.1\|1687090_1688119_-	transporter	NA	NA	NA	NA
WP_155822523.1\|1688331_1689306_-\|tail	phage tail protein	NA	NA	NA	NA
WP_006415101.1\|1689427_1690273_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_155822524.1\|1690571_1694519_+	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_155822525.1\|1694515_1695505_+	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_155822526.1\|1695509_1696460_+	OmpA family protein	NA	NA	NA	NA
WP_155822527.1\|1696559_1697681_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_155822528.1\|1697719_1700389_-	type VI secretion system ATPase TssH	A0A223W0B1	Agrobacterium_phage	1.3e-89	30.7
WP_006400543.1\|1700433_1701534_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_155822529.1\|1701497_1703333_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_006400545.1\|1703411_1703897_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_006400546.1\|1703959_1704463_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_006400547.1\|1704534_1706025_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_006406960.1\|1706040_1706556_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_155822996.1\|1706591_1707224_-	hypothetical protein	NA	NA	NA	NA
WP_012214251.1\|1707599_1708211_+	type VI secretion system lipoprotein TssJ	NA	NA	NA	NA
WP_006400551.1\|1708313_1709660_+\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
1723418:1723435	attR	NA	NA	NA	NA

DBSCAN-SWA_5

3184488 : 3294012

107

uncultured_Caudovirales_phage(29.27%)

holin,tRNA,tail,integrase,head,plate,terminase,capsid,portal,protease

attL 3218652:3218681|attR 3260633:3260662

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006401946.1\|3184488_3186015_-\|tRNA	lysine--tRNA ligase	A0A1V0SAC0	Catovirus	4.3e-85	36.2
WP_100085614.1\|3186087_3187192_-	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.2e-06	37.1
WP_155822892.1\|3187327_3189025_-	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	1.2e-56	30.6
WP_088931510.1\|3189042_3190107_-	regulator	NA	NA	NA	NA
WP_006401942.1\|3190271_3191525_+	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_006401941.1\|3191580_3192276_+	lipoprotein-releasing ABC transporter ATP-binding protein LolD	G9BWD6	Planktothrix_phage	6.6e-33	40.6
WP_155822893.1\|3192355_3193144_+	TatD family deoxyribonuclease	NA	NA	NA	NA
WP_155822894.1\|3193207_3195682_+	DNA internalization-related competence protein ComEC/Rec2	NA	NA	NA	NA
WP_155822895.1\|3195733_3196564_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_006401937.1\|3196725_3198387_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	1.9e-150	52.2
WP_006401936.1\|3198383_3199238_+	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-47	40.2
WP_006401935.1\|3199344_3200628_+	phosphopyruvate hydratase	W6LP63	Streptococcus_phage	2.4e-150	62.1
WP_006401934.1\|3200709_3201135_+	cell division protein FtsB	NA	NA	NA	NA
WP_006401933.1\|3201227_3201575_-	hypothetical protein	NA	NA	NA	NA
WP_155822896.1\|3201699_3202650_-	Hsp33 family molecular chaperone HslO	NA	NA	NA	NA
WP_006412160.1\|3202675_3203200_-	gamma carbonic anhydrase family protein	NA	NA	NA	NA
WP_105823231.1\|3203349_3204207_+	ferritin-like domain-containing protein	NA	NA	NA	NA
WP_012213092.1\|3204338_3205229_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_006401928.1\|3205347_3206187_+	PHP domain-containing protein	NA	NA	NA	NA
WP_006401927.1\|3206262_3206895_+	threonylcarbamoyl-AMP synthase	NA	NA	NA	NA
WP_006401926.1\|3206942_3207605_+\|protease	site-2 protease family protein	NA	NA	NA	NA
WP_006401925.1\|3207613_3208816_+\|tRNA	tryptophan--tRNA ligase	NA	NA	NA	NA
WP_155822897.1\|3208820_3209423_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_035951216.1\|3209469_3210375_+	4-hydroxy-tetrahydrodipicolinate synthase	NA	NA	NA	NA
WP_006408193.1\|3210486_3211632_+	outer membrane protein assembly factor BamC	NA	NA	NA	NA
WP_155822898.1\|3211636_3212413_+	MBL fold metallo-hydrolase	U5PVD0	Bacillus_phage	1.6e-11	27.5
WP_035488361.1\|3212527_3212791_-	hypothetical protein	NA	NA	NA	NA
WP_105790626.1\|3213016_3214243_-	cupin domain-containing protein	NA	NA	NA	NA
WP_006401918.1\|3214275_3214833_+	peptidylprolyl isomerase	NA	NA	NA	NA
WP_155822899.1\|3214812_3216075_-	hypothetical protein	NA	NA	NA	NA
WP_155822900.1\|3216055_3218743_-	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	7.9e-26	23.6
3218652:3218681	attL	NA	NA	NA	NA
WP_105854874.1\|3218902_3220207_+\|integrase	integrase family protein	C7BGE7	Burkholderia_phage	4.8e-146	57.3
WP_105855590.1\|3220489_3221569_-	RelA/SpoT domain-containing protein	NA	NA	NA	NA
WP_105855592.1\|3221720_3221966_-	AlpA family phage regulatory protein	C7BGF0	Burkholderia_phage	7.2e-19	63.0
WP_105855589.1\|3222079_3222394_-	hypothetical protein	NA	NA	NA	NA
WP_155822901.1\|3222495_3223845_-	pyridoxal phosphate biosynthetic protein PdxJ	NA	NA	NA	NA
WP_105813145.1\|3223844_3224444_-	hypothetical protein	NA	NA	NA	NA
WP_105813144.1\|3224440_3224803_-	beta-hexosaminidase	NA	NA	NA	NA
WP_088930393.1\|3224853_3225072_-	hypothetical protein	NA	NA	NA	NA
WP_143281453.1\|3225386_3225929_-	hypothetical protein	NA	NA	NA	NA
WP_088930423.1\|3226011_3226245_+	hypothetical protein	A0A2H4JCB6	uncultured_Caudovirales_phage	3.8e-09	57.4
WP_080594107.1\|3226560_3226833_-	hypothetical protein	NA	NA	NA	NA
WP_043281023.1\|3226962_3227490_+	hypothetical protein	C7BGG0	Burkholderia_phage	3.9e-30	47.6
WP_053297112.1\|3227491_3227875_+	hypothetical protein	NA	NA	NA	NA
WP_043281031.1\|3227908_3228349_-	hypothetical protein	NA	NA	NA	NA
WP_125902534.1\|3228350_3228824_+	hypothetical protein	NA	NA	NA	NA
WP_155822902.1\|3228966_3231462_+	virulence protein E	A0A2D1GN57	Marinobacter_phage	2.9e-99	41.1
WP_060097135.1\|3231677_3232265_+	hypothetical protein	NA	NA	NA	NA
WP_105813143.1\|3232523_3233135_+	hypothetical protein	NA	NA	NA	NA
WP_125902822.1\|3233404_3233656_-	hypothetical protein	NA	NA	NA	NA
WP_105807744.1\|3234275_3236390_+\|terminase	phage terminase large subunit family protein	A0A2D1GMT1	Marinobacter_phage	4.4e-181	53.5
WP_105807745.1\|3236399_3236606_+	hypothetical protein	NA	NA	NA	NA
WP_105807746.1\|3236602_3238093_+\|portal	phage portal protein	A0A2H4JFL5	uncultured_Caudovirales_phage	2.1e-137	52.6
WP_105807747.1\|3238089_3239163_+\|protease	Clp protease ClpP	A0A2H4JDI2	uncultured_Caudovirales_phage	1.4e-50	38.3
WP_105807748.1\|3239187_3239532_+\|head	head decoration protein	NA	NA	NA	NA
WP_088930400.1\|3239605_3240601_+\|capsid	major capsid protein	A0A2H4J890	uncultured_Caudovirales_phage	3.4e-115	61.8
WP_006411281.1\|3240602_3240893_+	hypothetical protein	NA	NA	NA	NA
WP_105807749.1\|3240898_3241426_+\|tail	phage tail protein	K7R9K2	Vibrio_phage	3.0e-22	31.6
WP_105807750.1\|3241418_3241946_+	hypothetical protein	Q9JML9	Wolbachia_phage	2.5e-24	40.3
WP_105807751.1\|3241942_3242623_+\|plate	phage baseplate assembly protein V	Q9JML8	Wolbachia_phage	2.6e-18	30.7
WP_105807752.1\|3242686_3242893_+	hypothetical protein	NA	NA	NA	NA
WP_105807753.1\|3242889_3243234_+\|plate	phage baseplate protein	A0A2H4JA09	uncultured_Caudovirales_phage	1.6e-24	49.1
WP_105807754.1\|3243230_3244124_+\|plate	baseplate J protein	A0A2H4JFK9	uncultured_Caudovirales_phage	2.7e-47	39.4
WP_105807755.1\|3244116_3244683_+\|tail	phage tail protein I	A4JWL7	Burkholderia_virus	1.4e-33	54.1
WP_105807756.1\|3244679_3245777_+	hypothetical protein	A4JWL8	Burkholderia_virus	8.2e-54	44.3
WP_105807757.1\|3245778_3246234_+\|tail	phage tail protein	A4JWL9	Burkholderia_virus	5.3e-07	32.7
WP_105807758.1\|3246308_3247478_+\|tail	phage tail sheath family protein	A0A2H4J869	uncultured_Caudovirales_phage	4.9e-158	72.4
WP_105807759.1\|3247488_3247992_+\|tail	phage major tail tube protein	Q7M2A5	Pseudomonas_phage	1.0e-43	49.4
WP_105807760.1\|3248074_3248404_+\|tail	phage tail assembly protein	NA	NA	NA	NA
WP_105807761.1\|3248459_3250877_+\|tail	phage tail tape measure protein	A0A2H4JG00	uncultured_Caudovirales_phage	2.9e-59	33.3
WP_006411280.1\|3250887_3251769_+\|tail	phage tail protein	A0A2H4J875	uncultured_Caudovirales_phage	2.7e-31	37.2
WP_105807762.1\|3251743_3251950_+\|tail	phage tail protein	A0A2H4J9Z9	uncultured_Caudovirales_phage	2.6e-14	55.2
WP_105807763.1\|3251960_3253013_+	late control protein	A0A2H4JBF6	uncultured_Caudovirales_phage	3.5e-86	49.6
WP_006410008.1\|3253087_3253372_+\|holin	holin	C7BGD7	Burkholderia_phage	1.0e-40	94.7
WP_105807764.1\|3253374_3253869_+	glycoside hydrolase family 104 protein	Q6J1Q5	Burkholderia_virus	4.8e-78	87.8
WP_155822903.1\|3253865_3254360_+	DUF2514 family protein	C7BGD9	Burkholderia_phage	2.4e-29	49.4
WP_006414243.1\|3255691_3255934_+	hypothetical protein	NA	NA	NA	NA
WP_080594100.1\|3256120_3256375_+	hypothetical protein	NA	NA	NA	NA
WP_065494964.1\|3257111_3257429_+	hypothetical protein	NA	NA	NA	NA
WP_080594106.1\|3257879_3258164_+	hypothetical protein	NA	NA	NA	NA
WP_065494651.1\|3258216_3258456_-	hypothetical protein	NA	NA	NA	NA
WP_080594099.1\|3258848_3259301_-	response regulator	NA	NA	NA	NA
WP_006414250.1\|3259517_3260432_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_155822904.1\|3261532_3264316_+	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	4.3e-83	33.0
3260633:3260662	attR	NA	NA	NA	NA
WP_155822905.1\|3264335_3266654_+	DUF3274 domain-containing protein	A0A077K801	Ralstonia_phage	1.2e-22	28.6
WP_155822906.1\|3266650_3268345_+	DUF2875 domain-containing protein	NA	NA	NA	NA
WP_080743868.1\|3268408_3268669_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_006408202.1\|3269194_3269998_-	inositol monophosphatase	NA	NA	NA	NA
WP_044055276.1\|3270274_3271099_+	RNA methyltransferase	NA	NA	NA	NA
WP_006401899.1\|3271275_3272049_+	serine O-acetyltransferase	NA	NA	NA	NA
WP_006401898.1\|3272083_3272884_-	UDP-2,3-diacylglucosamine diphosphatase	NA	NA	NA	NA
WP_006401897.1\|3272907_3273399_-	peptidyl-prolyl cis-trans isomerase	A0A2H4UTF4	Bodo_saltans_virus	9.7e-07	29.6
WP_006408206.1\|3273487_3274063_-	peptidyl-prolyl cis-trans isomerase	A0A1V0SCU1	Indivirus	1.4e-12	39.3
WP_155823012.1\|3274104_3274770_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_012213111.1\|3275059_3276457_+\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	1.0e-40	30.1
WP_060184124.1\|3276500_3277382_+	DNA-3-methyladenine glycosylase 2 family protein	NA	NA	NA	NA
WP_006401892.1\|3277484_3278456_+	acetyl-CoA carboxylase carboxyltransferase subunit alpha	NA	NA	NA	NA
WP_155822907.1\|3278502_3279909_+\|tRNA	tRNA lysidine(34) synthetase TilS	NA	NA	NA	NA
WP_006408212.1\|3280251_3281502_+	aspartate kinase	NA	NA	NA	NA
WP_123876363.1\|3282761_3283226_+	hypothetical protein	NA	NA	NA	NA
WP_105773477.1\|3283732_3286204_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.0e-152	43.8
WP_105773479.1\|3286266_3286968_+	DUF4123 domain-containing protein	NA	NA	NA	NA
WP_105773476.1\|3287008_3289576_+	hypothetical protein	NA	NA	NA	NA
WP_105773475.1\|3289579_3290668_+	hypothetical protein	NA	NA	NA	NA
WP_123876362.1\|3290677_3291169_+	hypothetical protein	NA	NA	NA	NA
WP_105773474.1\|3291238_3291499_+	PAAR domain-containing protein	NA	NA	NA	NA
WP_155822908.1\|3292134_3294012_+\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046344

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046344_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046344_1

797787-797881

Orphan

Consensus_repeat	Method
GCATGCGGACGCGAAGCCGCGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046344_1

>merge|NZ_CP046344|1|797787-797881|CRISPRCasFinder
GCATGCGGACGCGAAGCCGCGGGTGCGGCCGAAGCAGCCGGCGCGCCGGATGCACCCGACGCTCCGGTTTCGGCATGCGGACGCGAAGCCGCGGG

>NZ_CP046344|1|1|797787-797881|CRISPRCasFinder
GCATGCGGACGCGAAGCCGCGGG	TGCGGCCGAAGCAGCCGGCGCGCCGGATGCACCCGACGCTCCGGTTTCG
GCATGCGGACGCGAAGCCGCGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046344.1\|WP_155821084.1\|792107_792746_-\|FMN-binding-negative-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225366
NZ_CP046344.1\|WP_035956164.1\|802769_804281_-\|aldehyde-dehydrogenase-family-protein	unknown	unknown	gnl\|CDD\|143448
NZ_CP046344.1\|WP_155821096.1\|812014_812890_+\|EamA-family-transporter	unknown	unknown	gnl\|CDD\|183067
NZ_CP046344.1\|WP_155821094.1\|808647_810483_-\|phospholipase	unknown	unknown	gnl\|CDD\|197270
NZ_CP046344.1\|WP_039226758.1\|810708_811467_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268
NZ_CP046344.1\|WP_155821086.1\|792902_794408_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	unknown	unknown	gnl\|CDD\|224089
NZ_CP046344.1\|WP_155821082.1\|791443_792025_+\|redoxin-family-protein	unknown	unknown	gnl\|CDD\|239310
NZ_CP046344.1\|WP_006405936.1\|798355_799774_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340929
NZ_CP046344.1\|WP_155821076.1\|783601_785524_-\|SMP-30/gluconolaconase/LRE-like-region-family-protein	unknown	unknown	gnl\|CDD\|271320
NZ_CP046344.1\|WP_155821092.1\|804872_806453_+\|amino-acid-permease	unknown	unknown	gnl\|CDD\|182767
NZ_CP046344.1\|WP_155821936.1\|787674_788211_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP046344.1\|WP_012468043.1\|807988_808663_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380064
NZ_CP046344.1\|WP_006405926.1\|811674_811860_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_060181489.1\|806594_807863_+\|FAD-binding-oxidoreductase	unknown	unknown	gnl\|CDD\|223737
NZ_CP046344.1\|WP_155821080.1\|789149_790478_-\|HAMP-domain-containing-protein	unknown	unknown	gnl\|CDD\|236531
NZ_CP046344.1\|WP_155821088.1\|794571_796803_+\|penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP046344.1\|WP_006414216.1\|788309_789044_+\|metallophosphoesterase-family-protein	unknown	unknown	gnl\|CDD\|378975
NZ_CP046344.1\|WP_155821078.1\|786058_787252_-\|porin	unknown	unknown	gnl\|CDD\|238208
NZ_CP046344.1\|WP_012216406.1\|790474_791215_-\|response-regulator	unknown	unknown	gnl\|CDD\|223816
NZ_CP046344.1\|WP_059843085.1\|800204_802655_+\|mechanosensitive-ion-channel-family-protein	unknown	unknown	gnl\|CDD\|225803

Protein	Function_ID	Function_description	E-value
NZ_CP046344.1\|WP_155821084.1\|792107_792746_-\|FMN-binding-negative-transcriptional-regulator	gnl\|CDD\|225366	COG2808, PaiB, Transcriptional regulator [Transcription].	2.06541e-93
NZ_CP046344.1\|WP_035956164.1\|802769_804281_-\|aldehyde-dehydrogenase-family-protein	gnl\|CDD\|143448	cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B. Alpha-aminoadipic semialdehyde dehydrogenase (AASADH, EC=1.2.1.31), also known as ALDH7A1, Antiquitin-1, ALDH7B, or delta-1-piperideine-6-carboxylate dehydrogenase (P6CDH), is a NAD+-dependent ALDH. Human ALDH7A1 is involved in the pipecolic acid pathway of lysine catabolism, catalyzing the oxidation of alpha-aminoadipic semialdehyde to alpha-aminoadipate. Arabidopsis thaliana ALDH7B4 appears to be an osmotic-stress-inducible ALDH gene encoding a turgor-responsive or stress-inducible ALDH. The Streptomyces clavuligerus P6CDH appears to be involved in cephamycin biosynthesis, catalyzing the second stage of the two-step conversion of lysine to alpha-aminoadipic acid. The ALDH7A1 enzyme and others in this group have been observed as tetramers, yet the bacterial P6CDH enzyme has been reported as a monomer.	0
NZ_CP046344.1\|WP_155821096.1\|812014_812890_+\|EamA-family-transporter	gnl\|CDD\|183067	PRK11272, PRK11272, putative DMT superfamily transporter inner membrane protein; Provisional.	1.31353e-10
NZ_CP046344.1\|WP_155821094.1\|808647_810483_-\|phospholipase	gnl\|CDD\|197270	cd09173, PLDc_Nuc_like_unchar1_2, Putative catalytic domain, repeat 2, of uncharacterized hypothetical proteins similar to Nuc, an endonuclease from Salmonella typhimurium. Putative catalytic domain, repeat 2, of uncharacterized hypothetical proteins, which show high sequence homology to the endonuclease from Salmonella typhimurium and vertebrate phospholipase D6. Nuc and PLD6 belong to the phospholipase D (PLD) superfamily. They contain a short conserved sequence motif, the HKD motif (H-x-K-x(4)-D, where x represents any amino acid residue), which characterizes the PLD superfamily and is essential for catalysis. Nuc and PLD6 utilize a two-step mechanism to cleave phosphodiester bonds: Upon substrate binding, the bond is first attacked by a histidine residue from one HKD motif to form a covalent phosphohistidine intermediate, which is then hydrolyzed by water with the aid of a second histidine residue from the other HKD motif in the opposite subunit. However, proteins in this subfamily have two HKD motifs in a single polypeptide chain.	3.51685e-46
NZ_CP046344.1\|WP_039226758.1\|810708_811467_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	3.0724e-81
NZ_CP046344.1\|WP_155821086.1\|792902_794408_+\|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme	gnl\|CDD\|224089	COG1167, ARO8, Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism].	7.74932e-133
NZ_CP046344.1\|WP_155821082.1\|791443_792025_+\|redoxin-family-protein	gnl\|CDD\|239310	cd03012, TlpA_like_DipZ_like, TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.	3.82462e-80
NZ_CP046344.1\|WP_006405936.1\|798355_799774_-\|MFS-transporter	gnl\|CDD\|340929	cd17371, MFS_MucK, Cis,cis-muconate transport protein and similar proteins of the Major Facilitator Superfamily. This subfamily is composed of Acinetobacter sp. Cis,cis-muconate transport protein (MucK), Escherichia coli putative sialic acid transporter 1, and similar proteins. MucK functions in the uptake of muconate and allows Acinetobacter calcoaceticus ADP1 (BD413) to grow on exogenous cis,cis-muconate as the sole carbon source. The MucK subfamily belongs to the Metazoan Synaptic Vesicle Glycoprotein 2 (SV2) and related small molecule transporter family (SV2-like) of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	8.21379e-43
NZ_CP046344.1\|WP_155821076.1\|783601_785524_-\|SMP-30/gluconolaconase/LRE-like-region-family-protein	gnl\|CDD\|271320	cd05819, NHL, NHL repeat unit of beta-propeller proteins. The NHL(NCL-1, HT2A and LIN-41)-repeat is found in multiple tandem copies, typically as 6 instances. It is about 40 residues long and resembles the WD repeat and other beta-propeller structures. The repeats have a catalytic activity in Peptidyl-glycine alpha-amidating monooxygenase; proteolysis has shown that the Peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL) activity is localized to the repeats. Tripartite motif-containing protein 32 interacts with the activation domain of Tat. This interaction is mediated by the NHL repeats.	5.10978e-10
NZ_CP046344.1\|WP_155821092.1\|804872_806453_+\|amino-acid-permease	gnl\|CDD\|182767	PRK10836, PRK10836, lysine transporter; Provisional.	0
NZ_CP046344.1\|WP_155821936.1\|787674_788211_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	1.10906e-27
NZ_CP046344.1\|WP_012468043.1\|807988_808663_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|380064	pfam17938, TetR_C_29, Tetracyclin repressor-like, C-terminal domain. This domain is found in the C-terminal region of putative TetR-family regulatory proteins.	1.82774e-58
NZ_CP046344.1\|WP_060181489.1\|806594_807863_+\|FAD-binding-oxidoreductase	gnl\|CDD\|223737	COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism].	2.89187e-58
NZ_CP046344.1\|WP_155821080.1\|789149_790478_-\|HAMP-domain-containing-protein	gnl\|CDD\|236531	PRK09467, envZ, osmolarity sensor protein; Provisional.	1.98818e-45
NZ_CP046344.1\|WP_155821088.1\|794571_796803_+\|penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	3.3208e-169
NZ_CP046344.1\|WP_006414216.1\|788309_789044_+\|metallophosphoesterase-family-protein	gnl\|CDD\|378975	pfam12850, Metallophos_2, Calcineurin-like phosphoesterase superfamily domain. Members of this family are part of the Calcineurin-like phosphoesterase superfamily.	7.39064e-18
NZ_CP046344.1\|WP_155821078.1\|786058_787252_-\|porin	gnl\|CDD\|238208	cd00342, gram_neg_porins, Porins form aqueous channels for the diffusion of small hydrophillic molecules across the outer membrane. Individual 16-strand anti-parallel beta-barrels form a central pore, and trimerizes thru mainly hydrophobic interactions at the interface. Trimers are stabilized by hytrophillic clamping of Loop L2. Loop 3 bends into the pore, creating an elliptical constriction of about 7 x 11A, large enough to allow passage of a glucose molecule without steric hindrance. Removal of the C-terminal residue (usuallly F) destabilizes the trimer and removal of the 16th beta-sheet abolishes trimerization. Unlike typical membrane proteins, porins lack long hydrophobic stretches. Short turns are found at the smooth, periplasmic end, longer irregular loops are found at the rough, extracellular end. C-terminal residue forms salt bridge with N-terminus.	1.85368e-92
NZ_CP046344.1\|WP_012216406.1\|790474_791215_-\|response-regulator	gnl\|CDD\|223816	COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription].	3.74495e-78
NZ_CP046344.1\|WP_059843085.1\|800204_802655_+\|mechanosensitive-ion-channel-family-protein	gnl\|CDD\|225803	COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane].	1.62198e-114

>NZ_CP046344.1|WP_155821088.1|794571_796803_+|penicillin-binding-protein
MNRFVSFLRLALARCRARVAPFAAGCAARLRAALRGAAHALRHPTRRGIALTLAAIPTLAVLVLLAFVPFTPSIGDIRKARIERPARVLSADGKLIAEFRPVNREWVPLKLISPHTVDALIATEDRRFYAHHGIDWRRTLAAALHTFGGERQGGSTITQQLARNLYPDEVGRAPTLTRKLKELVTAFKIEMVYSKAEILETYLNTVPFLYNAYGVEMAARTYFGKSADQLDVVESATLVGMLKGNSYYNPVLNPERALQRRNVVLEQMAKAGMLSASELARLQRRPLRVDFERQTAEPGLAPHFAVQVRKWLIAWADSHDYDLYSDGLVIRTTLDARLQQMATRALVQQTDRLQAVADAAWRGPSGCGLRNALFRGFMRQTPDYRDARDAGLTDAAALTQLGANRAFVRALCERKTQVQAGFVAIDPRNGAIRAWVGSPDFGDEPFDHVEQARRQPGSTFKPFVYGAAFADGARPSDTFVDRDVAIPLGDRSVWRPTDAEPPTGAPMTLRDALALSRNRITAQLMQREGAAKVARLARAMGVRDSPLEAVPSLALGTSPVTLKEMVSAYATIANRGVYVAPQAITQIEDRNGKVLARFADAPPQRALPANAALTLVDVMRDVVDRGTGADIRTRYGIRGDVAGKTGTTQDNADGWFILMHPQLVAGAWVGFDDGSVTLRSDYWGAGAHSALPIVGAFYVDALRARAIDPHAQLSPDFRPRAAPAPAPKRRAHPGLFDWLRLFR
>NZ_CP046344.1|WP_155821086.1|792902_794408_+|aminotransferase-class-I/II-fold-pyridoxal-phosphate-dependent-enzyme
MARTARIVDIPSLGALDRAAGDLSRQLAQALREAVRRGDVRPGDTLPSTRLLAASLQVARGTVVDAYAQLVAEGFLESRAGAGTRVAHALAAPPPARSAVRRPRTRTGLPEPAATFARIAQEFRPLPPAPFAISVPAGLTAPDDVWRRLGNRLRARGAGAPSGYADPQGALPLREAIADYVRRSRSVRCEADQVVITSGTQQGLHLATQVLLGAHDRAWVENPAYRGITALLDSTGRRDAMVRVPVDADGIDVDAGMRAAADARVAFVTPSHQYPLGMPMSMARRNALLAWARAHRAWIVEDDYDSELRYEGHPFPSLQGLDPERVVYLGTFSKVLFPSLRLGYVIAPDDLVPAFCGARVLMDRHAPTADQYVLAAFIAEGHLDRHIRRVRGVYAEQRMLLIDTLGTRLPRALAWVQPGDQGMHVVLWLADGIDDLDVVARAADAGIAVRAVSPMFAPGTARPGLVLGFGGFGRARMEAAAQRLAEVIVEAAGAARRRRTR
>NZ_CP046344.1|WP_155821084.1|792107_792746_-|FMN-binding-negative-transcriptional-regulator
MYVPADFAESRPDVLRELIVRHPFGSLITHGKDGLDANHLPFEWLPADGGLGELHAHVARANPVWQAVANGDDVLVIFHAGDAYISPNWYPSKHATHRQVPTWNYVVVHAHGRITVRDDEKFVRGVVARLTRTHEASQPAPWKMGDAPPDYLEAMLQSIVGLQIEITRLVGKRKLGQNKAAADIRGAGEALVASGNVAIGGAMLAAADAKRE
>NZ_CP046344.1|WP_155821082.1|791443_792025_+|redoxin-family-protein
MLPRFRTAAFVFALAATAGLAAFAGTRDEAGTMTSLAGSRAPEFAGIERWHNGAPLTLDRLRGKVVLVDFWTYSCINCIHTIPYVNDWYRKYRDQGLVVVGVHTPEYPFERDAKNVADAIARFGIRYPVAQDNRYDTWRAYGNQYWPALYLIDANGKIVYTRYGEGAYDKTEAAIRAALAQAGEPAKDATRTQ
>NZ_CP046344.1|WP_012216406.1|790474_791215_-|response-regulator
MDKPDHVLIVDDDRAIRELIADYLEKNGMRVSLAANGREMRSVLDDGAPDLIVLDLMLPGEDGLTLCRDLRAGKFRTVPVLMLTARSEETDRIVGLEMGADDYLAKPFAVRELLARIRSVLRRARMLPPGMQVTETAGMLAFGEWRLDTTGRHLLDAEGTLVALSGAEYRLLRVFLDHPQRVLTRDQLLNLTQGRQSDPFDRSIDLLVSRLRQRLRDGAREPRYIKTLRNEGYVFSSAVTAIEGTS
>NZ_CP046344.1|WP_155821080.1|789149_790478_-|HAMP-domain-containing-protein
MNARIAWHWPRSLFARLALILCVGLALAQTLSFWLTVTERDQATTNLMMGYIEREVASSVALLDHLPPDERAAWLPRLARRSYAFILGPGETGTPPEARLSARVERSISDGIGGRYPLTANAIPGDREHLQVHLRLTDGSPLTIDVHPMSTVPLSDWLPVVLALQLAVLAACCWLAVRLATRPLKQLALAADALGPDLKGERLSEDGPSEVARAARAFNAMQDRIAQYMTERMQILASISHDLQTPITRMRLRVDVMDDDAQGAKLRQDLLEMEHLVKEGVAYARTLHGSDEAARRIDLDALLDSIVCDYVDAGQDVALHSRAPLALVTRPKALRRIVGNLVDNALKFAGAAEIDVQPAPDGGAVIVVRDRGPGIPDDQLDAVFEPFRRVETSRNRETGGTGLGLAIARQLALAMGGTLTLSNRQDGGGGLDARLTLVNAAA
>NZ_CP046344.1|WP_006414216.1|788309_789044_+|metallophosphoesterase-family-protein
MKIAALSDIHGNLAALDAVLADIRRRGADVIVNLGDIVSGALHPAETADRLIALDLPTIKGNHERQLLSGDRESLRLSDRWARDTLRDAHLAWIAALPPRLMLDDDVLMVHGTPASDLAYFLETVTPDGCRAATPDEIAQRAGNETASLILCGHTHVPRAATLEDGRLIVNPGSVGLQAYADDHPHPHRIENGTPHARYAMVSRTAAGWHAEFHAVDYDWDTAAATAAARGRDDWTVALRTGRC
>NZ_CP046344.1|WP_155821936.1|787674_788211_+|GNAT-family-N-acetyltransferase
MDTPPAAGFPGLSVRQLDRADLDAWFAYLSMPDVVRHTSWNLRSRDDLLPLFDGLESSDPDSIRRLAIVDDASGALVGTIGLHTVSTANRCAEIAYDLAPTHWGRGIARAVCASVTAWAFAEGGFVRMQGVVLTDNVRSARVLEKCGYRYEGLLRAYRMVRGVPGDFAMYARLATDTA
>NZ_CP046344.1|WP_155821078.1|786058_787252_-|porin
MNKQLIAAPLLLSLAGLVSAQSSVTLYGIVDAGVTYRSNERVGTAGAYTGHSNVGLTTGNLSGSRWGIKGSEDLGGGLRALFVLENGFDITNGTSGQGGRQFGRQAFVGVGSDRYGSITLGRQYTSLDDFVSPVGPSSFIGGFGAHPGDIDDLDQTARVDSSIKYTSANYAGFTFGALYGFGGQPGSMKQRNTWSVGAAYAAGPLRVGVGYERSDNSKTGATDTTLGKWQSTDDGLFNSSINEGYASAQSQQIIATGATYDFGPAVVGVNYSNVQYRSGDRSLFSGHATFNVAGVFARWNVRPQTQLFAGYSYTRGSDVDGIDDRAQYHNVTLGAVYDLSKRTSVYLLGAYQHASGMTLDALGRPVAATASVSDKANGHSSDTQSQAIVSLGLRQRF
>NZ_CP046344.1|WP_155821076.1|783601_785524_-|SMP-30/gluconolaconase/LRE-like-region-family-protein
MSMKQIRAALLGMCMILLAPVAQAQAQYTTDWLANTFGTLAAHVGNGARSMWVAPEGVIYTASRWDENAGGVAIYQNGQSLGTIGIHDEFQGGAITGNATSLFVALGYNRTFGSGSVGRYNRSTNARDLRIPVSTWTGIQYADVITGLATAGNLLYASDFYGNRVRVYTTDGVWQRDISVQGPGALAIDAAGNLWVARMSAGVVVQFSPTGTQMNTIQMAAGARPSSLYFDASTGQLMVGDQGPDMNIKIYALIGVPLQIGTFGVQGGYLNTTTGIKGQVGDKRFTRVVGIGKDAAGNLYVLNNAWGGGWDLGRNGSTDIHAYSPIGALQWKLQALNFEGAAAPDPATDGAFFYSGNNIYTGTAGGTFVANTIDPFTYPKDPRLDMNDYQRGQHFGQLVTVGGNRILVASGQNPGNFNFYHFNPASGYIAIPDGSIPGKPFNTSLQVTAGFAIDGNGDVWAGLDRTNNISHYPMTGFDANGKPSWGAPEQIQIPRSVLPLTRIIYQSDSDTMILAQGISGSWDWTAMNGHIEIYRGWKAGNKTTPSLAIDLTSANPKSIAAAGHYLFVGYVHTVPNIDVYDLNTGGLVTTLTNSNPSAMDVGNDVDSMYGIRAYLRSTGEYVITKDNYNGSSLVVYRWRP
>NZ_CP046344.1|WP_006405936.1|798355_799774_-|MFS-transporter
MASTDSIPQAPARSPLIDAGTISARLDRLPPTRSVWKLVVLLSLGFFFELYDLLYSGYVAPGLVKSGILSATTHGLFGTTGVASFIAALFSGLFVGTIACGFLADRFGRRAIFTWSLLWYTAANVVMAFQDTATGLNFWRFVVGLGLGVEMVTIGTYISELVPKQIRGRAFACEQAVGFVAVPVVAFLAYLLVPRAPFGLDGWRWVVLIGAHGAIFVWWIRRELPESPRWLAQQGRLDEADRVMRALEAKVEAEYGRPLPAPAPAEPVAERGSFRDMWVPPYRSRTIMMTIFNVFQTVGFYGFANWVPTLLIKQGITITSSLMYSSVIALAAPIGPLIGLVIADRFERKSVIVAMAATVLVCGLLFSQTTIGALLIVLGIGLTLASNIMSYSFHAYQAELFPTSIRARAVGFVYSWSRFSAIFSSFVIAAVLKGFGTVGVFAFIAGAMAIVMAAIGIMGPRTKGIALEAISR
>NZ_CP046344.1|WP_059843085.1|800204_802655_+|mechanosensitive-ion-channel-family-protein
MFIQRLSHFARRIALIALLQFAVVATASAFPAAASAPSASAVGAAPVPMISLSDALAQLKQMQAEQDRIKQKTSTSTTSKELDALEDATQQLSAAVEKLQGELTPQRVQLQAQLDVLGPPPAPGAAPETPAVAQQRATLNARKAQIEAALKQAADQKTNLANLSDQFAKLHRSLLRNQLAFRSASIFSAQFWLPLFHLPPDDVQRLGDFQRELRDMLGSSWTPGQRATTVLLLIAAFAAWLGGRRLLEYGLAWICLNRLPPTRLRRSALALSTAVATLVATAIAVQILYLALARHYTPTPAMSDLWDQFVKLAATCALIAGLGRALLCTKHPSWRLPALADPVALAMRPFPGVLAALLLISGTLESIDRIADTSLSVTLLGRGFVSLVVALTVGASLLRANRVRSALAAAGESPEQRSTLAGLIHAGVTLAIVVSLIALAIGYITVARFITYELVWFEIVLCSVYVLTQLTRDASESLFSVNLSTGKQIKHLFALDDRHLEQAHTVVSGIGTSLLMLVAAIALLTGGFGTTPSDLLDSAIAMIGGQRLQSLNIMPDRIMNAVIGFAIGFYLLRSVRRWLDNEFLPALGMDSGMRASLVTLFANVGYVLLVLMTLGLLGVKWSNLAWIVSALSVGIGFGLQEIVKNFVSGLILLTERPVKVGDMISIAGVEGDIRRINVRATEIQLSDRSTVIVPNSQLISQNLRNVTMGNSTQGVATLMLTFPLNTDPEQVRDLLLEAYRAHPAILEKPAPSVTFSQLAPDGITLSVTGYVASPRIAGSTKSDLLFEILKQLRAAGITLSSPQMLVVQNMPSADGA
>NZ_CP046344.1|WP_035956164.1|802769_804281_-|aldehyde-dehydrogenase-family-protein
MQFNDILAALDIDLAQWKGNALTARSPLDGATLATLAVDTPADAERKIDAAHDAFLKWRTVPAPVRGELVRVFGNVLREHKAALGRLVTLEAGKIASEGLGEVQEMIDICDFAVGLSRQLYGLTIASERPGHRMMETWHPLGVCGVISAFNFPVAVWAWNAALAFVCGDPVVWKPSEKTPLTAIACHVLLGKALREFDKTHPGVAPEGLHQLVLGTRDVGEVLTSSKKVPVVSATGSVRMGTEVAKVLSQRLARGILELGGNNGMIVAPSADLDLVVRAVTFAAVGTAGQRCTTLRRLIVHRSIVDQLLPRLEKAYASVKVGNPLEEGTLVGPLVDRASFDAMQKALADAREQGGEVKGGERVDVGHADAYYVRPAIVRMPKQTAVVERETFAPILYVMVYDNFDDAIAVHNAVPQGLSSAIFTNDMREAEYFMSAAGSDCGIVNVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKAYMRRATNTINYSRQLPLAQGVKFDV
>NZ_CP046344.1|WP_155821092.1|804872_806453_+|amino-acid-permease
MHSDARPDSSRPPGSRAAKPALHRRLQARHLRMIAIGGSIGTGLFVASGASISQAGPGGAMFAYMVIGLMVYFLMTSLGEMAAFMPVSGSFATYGAKFVDEGFGFALGWNYWYSWAVTLAVELVAAQLVMHYWFPHVPGVWWSALFLTLIFALNALSVRGFGEAEYWFALIKVLTVIAFLGVGLLMIFGIMKGGPSAGLANFTIGDAPFVGGLPAMLGVAMIAGFSFQGTEMIGVAAGESENPRTTIPRAVSQIFWRILLFYVLAIFVIGVLIPYTDPSLLKTDVTDIGVSPFTLVFRHAGLAFAAGVMNAVILTAVLSAGNSGMYASTRMLYNLATEGRAPKLFAKLSPGGVPRNALYATTAVGALCFLTSLYGDKTVYMWLLNTSGMAGFITWLGIAVSHYRFRKGLLKQGYRLDQLPYRSKWFPFGPIFAFVLCAIVALGQDYQAFFAARIDWGAVAATYIGLPFFFAIWIGYALVRKCRLVRYEDMDIAPWIERNATPEPAADTSAGYAAYVARPANPTSGA
>NZ_CP046344.1|WP_060181489.1|806594_807863_+|FAD-binding-oxidoreductase
MQNFYEATVTRPPYPQLSGTLDTQVCIVGGGLAGLCTALGLVERGVRDVIVLDGERVGFGASGRNGGFVFGGYSLDNADLLRTLGRDEARRLYRLTVDAVDLIRARIARYGIDCDIVDRGVMLANWFDDPSRLDSVRSLMKREFDVDWEPVTRDALRAQLHTARYHGGLFEPNAFHFHPLKYVLGVAAAAARGGARIYERSAALGIEREGAGYVVRTAHGSVRAKDVVFAGGGYARGVSPRIERAVLPIATYVIATEPLGERLKDAIDAPYAIYDTRFAFDYYRPLKDTRILWGGRISVLDRGPDAIARLLRRDLLRVYPQLADVKVDYAWGGLMSYARHKMPQIGRDADGVWHAIAFGGHGMAPTTVAGETLAAALAEDRPVPDGFRAFGLTRTFGLAGLAAAQLTYTAYQARDALAAYRR
>NZ_CP046344.1|WP_012468043.1|807988_808663_+|TetR/AcrR-family-transcriptional-regulator
MKAGSKAATSDNRALPSDARRKYDPEQTKRNILDVATQEFSAMGLAGARVDAIAERTNTTKRMLYYYFDSKEGLYEAVLEKVYGDIRALEQELHVGDMEPREGMRRLVEFTFDYHDKHRDFVRLVSIENIHGAKYLEQLKSFKNRNVSIIKTLEELLERGAASGAFRKDIDAFDLHLLISSFCFHRVSNRYTFGAAFGRDPSAPRLRTRHRDTIAEAVLRYIAA
>NZ_CP046344.1|WP_155821094.1|808647_810483_-|phospholipase
MSVRVRSYLSPTLVLLAFDWPDVQSRADFLGFAIRRTPGFRSADGSRRASASWLPNRLTFDGPAADTQGDAPTDQAPIQKFMWWDARIDPQDRGAAFRYDVYPVVGTPERLQLLDAQAGVCRIVLPAHIEDGIGTWFNRAVVSSQAFAKQVAALGLAPDEAPSDAQALKLRTWLANDMEQVFAEMLDPASRAVSAVYHLTDTLWALPAFEAFGRAHGNASLAIVYDAHVTTRKGKRPLPSPNQPAVDALQGLATLAPRDRTHIMHDKFIVTNTGAGVAPARVLTGSANFTTEGLTEQANVLHAFDSPELAELYDERARALAANPSIAETARLSSGWSAPVTIGSAQVRVAFSPEPAGRRTEIDTIVAAIAAAKHSVSFCLFMPTDAALRDACFAAGDRGLMMFGLVNRISAGSATKADAAQQAGQSLDAATLANLELYHRRRDHRDVIDAAYFSPATVPQGFEPELRLFPGEPAPAYPPVVIHHKFIVIDAEGENPIVYTGSANMSRNSEQYNDENLLEIRDARIAGTYLAEFLRLYEHYRARALAIEAKQGSTGAHARLALAPDARWARKYFVAGSPEEKARRALASPAPADASAETETSDRERLRYAAM
>NZ_CP046344.1|WP_039226758.1|810708_811467_-|DeoR/GlpR-transcriptional-regulator
MLAEQRHQYILSELGRSGALSVAELVRSLDVSRETVRRDLNALAARGLLVMTHGGALAADRREPSLSEREAANADAKRTIGRRAAEFVPDGASVLIDSGSTPHAVALALADRHRLSVYTNDWRTALVLARRNGNRVTLLGGELSDDEDATFGLDTIQQLAQYHVDFAFVGAGGITADGDCTDYSRLAAEVRSRMIAAAGTAIIVADHSKFGRVTPVRINGTSAARYLVTERAPERAVRRALTARGIELVLCG
>NZ_CP046344.1|WP_006405926.1|811674_811860_+|hypothetical-protein
MYRKGSVLEIQFSPERLNDGAGDPYWIDLTLDEARRLYEQLAARFASDARANQPLDTFSLD
>NZ_CP046344.1|WP_155821096.1|812014_812890_+|EamA-family-transporter
MLTSLVAALFVALWSTGFIVARAIKPYADPNLFLLARFAGTAALFAVVALTARAPWPARREWPRHLIAGALLQGVYLGASYWAVAQGLNAGVMALLSALQPLATAVLAVPLFNERLPVRGWLGMALGLVGVALVLAPKVSGGVAAASPGAAPAWLVVGVSVLSVGAITAGSLYQKGKLAQSDLRTAVAVQNLGAALVAAVFVVLLHESRWIGAPALWVSLVWGVVFLSGGAVTMLMWMLRRGNAARATSLLFLAPPLAALQGYLLFDETLAAIQLAGFVLALIGVVLARQR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046344_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046344_2

941477-941679

Orphan

Consensus_repeat	Method
CCGCCGCCGAGCGCGCCGCCGAT	CRISPRCasFinder

3 spacers

The CRISPR arrays of NZ_CP046344_2

>merge|NZ_CP046344|2|941477-941679|CRISPRCasFinder
CCGCCCCCGACAGCGGCGCCGAGCAGGCCGCCCGTACGGCCGCCCATCGCGTTGCCGGCCGCGGTGCCCGCACCGCCGCCGAGCGCGCCGCCGATGATCGCGCCGGTACGCTCGCGACGGTTCGACGTGATCGCACCGCCGGCGCCGCCGCCGAGCGCGCCGCCGATCACGGAACCCGTGCTGCCGCCGACCGCGCCGCCGAC

>NZ_CP046344|2|2|941477-941679|CRISPRCasFinder
CCGCCCCCGACAGCGGCGCCGAG	CAGGCCGCCCGTACGGCCGCCCATCGCGTTGCCGGCCGCGGTGCCCGCA
CCGCCGCCGAGCGCGCCGCCGAT	GATCGCGCCGGTACGCTCGCGACGGTTCGACGTGATC
GCACCGCCGGCGCCGCCGCCGAG	CGCGCCGCCGATCACGGAACCCGTG
CTGCCGCCGACCGCGCCGCCGAC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046344.1\|WP_155821221.1\|949351_949501_+\|polyketide-cyclase	unknown	unknown	gnl\|CDD\|176904
NZ_CP046344.1\|WP_155821191.1\|933545_934637_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	unknown	unknown	gnl\|CDD\|376439
NZ_CP046344.1\|WP_012216303.1\|945522_946725_+\|trans-2-enoyl-CoA-reductase-family-protein	unknown	unknown	gnl\|CDD\|237460
NZ_CP046344.1\|WP_006397314.1\|942517_942937_-\|HIT-family-protein	unknown	unknown	gnl\|CDD\|238608
NZ_CP046344.1\|WP_155821194.1\|934656_935499_+\|heme-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|184132
NZ_CP046344.1\|WP_155821218.1\|947050_947629_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_155821188.1\|932619_933534_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|238569
NZ_CP046344.1\|WP_155821940.1\|947700_948231_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP046344.1\|WP_155821204.1\|936687_938832_-\|PBP1A-family-penicillin-binding-protein	unknown	unknown	gnl\|CDD\|273955
NZ_CP046344.1\|WP_035955773.1\|949824_950463_+\|2-hydroxychromene-2-carboxylate-isomerase	unknown	unknown	gnl\|CDD\|239320
NZ_CP046344.1\|WP_006397310.1\|939927_940764_-\|(S)-ureidoglycine-aminohydrolase	unknown	unknown	gnl\|CDD\|183011
NZ_CP046344.1\|WP_105766718.1\|950487_951408_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP046344.1\|WP_155821210.1\|940937_941267_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_155821207.1\|939045_939843_+\|3'-kinase	unknown	unknown	gnl\|CDD\|226100
NZ_CP046344.1\|WP_155821216.1\|944601_945237_-\|glutathione-S-transferase	unknown	unknown	gnl\|CDD\|198289
NZ_CP046344.1\|WP_035955754.1\|936064_936676_-\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP046344.1\|WP_155821213.1\|943131_944577_+\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP046344.1\|WP_155821200.1\|935883_936078_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_059781385.1\|948850_949333_+\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176904
NZ_CP046344.1\|WP_155821197.1\|935701_935887_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225415

Protein	Function_ID	Function_description	E-value
NZ_CP046344.1\|WP_155821221.1\|949351_949501_+\|polyketide-cyclase	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	1.62133e-10
NZ_CP046344.1\|WP_155821191.1\|933545_934637_+\|iron-chelate-uptake-ABC-transporter-family-permease-subunit	gnl\|CDD\|376439	pfam01032, FecCD, FecCD transport family. This is a sub-family of bacterial binding protein-dependent transport systems family. This Pfam entry contains the inner components of this multicomponent transport system.	1.46678e-76
NZ_CP046344.1\|WP_012216303.1\|945522_946725_+\|trans-2-enoyl-CoA-reductase-family-protein	gnl\|CDD\|237460	PRK13656, PRK13656, enoyl-[acyl-carrier-protein] reductase FabV.	0
NZ_CP046344.1\|WP_006397314.1\|942517_942937_-\|HIT-family-protein	gnl\|CDD\|238608	cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.	2.37333e-47
NZ_CP046344.1\|WP_155821194.1\|934656_935499_+\|heme-ABC-transporter-ATP-binding-protein	gnl\|CDD\|184132	PRK13547, hmuV, heme ABC transporter ATP-binding protein.	3.24545e-157
NZ_CP046344.1\|WP_155821188.1\|932619_933534_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|238569	cd01149, HutB, Hemin binding protein HutB. These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species. They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.	1.6081e-76
NZ_CP046344.1\|WP_155821940.1\|947700_948231_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.61238e-10
NZ_CP046344.1\|WP_155821204.1\|936687_938832_-\|PBP1A-family-penicillin-binding-protein	gnl\|CDD\|273955	TIGR02074, Includes:_Penicillin-insensitive_transglycosylase, penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan].	0
NZ_CP046344.1\|WP_035955773.1\|949824_950463_+\|2-hydroxychromene-2-carboxylate-isomerase	gnl\|CDD\|239320	cd03022, DsbA_HCCA_Iso, DsbA family, 2-hydroxychromene-2-carboxylate (HCCA) isomerase subfamily; HCCA isomerase is a glutathione (GSH) dependent enzyme involved in the naphthalene catabolic pathway. It converts HCCA, a hemiketal formed spontaneously after ring cleavage of 1,2-dihydroxynapthalene by a dioxygenase, into cis-o-hydroxybenzylidenepyruvate (cHBPA). This is the fourth reaction in a six-step pathway that converts napthalene into salicylate. HCCA isomerase is unique to bacteria that degrade polycyclic aromatic compounds. It is closely related to the eukaryotic protein, GSH transferase kappa (GSTK).	3.03394e-57
NZ_CP046344.1\|WP_006397310.1\|939927_940764_-\|(S)-ureidoglycine-aminohydrolase	gnl\|CDD\|183011	PRK11171, PRK11171, (S)-ureidoglycine aminohydrolase.	0
NZ_CP046344.1\|WP_105766718.1\|950487_951408_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.17229e-49
NZ_CP046344.1\|WP_155821207.1\|939045_939843_+\|3'-kinase	gnl\|CDD\|226100	COG3570, StrB, Streptomycin 6-kinase [Defense mechanisms].	1.23071e-81
NZ_CP046344.1\|WP_155821216.1\|944601_945237_-\|glutathione-S-transferase	gnl\|CDD\|198289	cd03180, GST_C_2, C-terminal, alpha helical domain of an unknown subfamily 2 of Glutathione S-transferases. Glutathione S-transferase (GST) C-terminal domain family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.	2.38259e-47
NZ_CP046344.1\|WP_035955754.1\|936064_936676_-\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	2.44848e-63
NZ_CP046344.1\|WP_155821213.1\|943131_944577_+\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	4.05773e-36
NZ_CP046344.1\|WP_059781385.1\|948850_949333_+\|SRPBCC-family-protein	gnl\|CDD\|176904	cd08895, SRPBCC_CalC_Aha1-like_2, Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins. SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain of a functionally uncharacterized subgroup of CalC- and Aha1-like proteins. This group shows similarity to the SRPBCC domains of Micromonospora echinospora CalC (a protein which confers resistance to enediynes) and human Aha1 (one of several co-chaperones which regulate the dimeric chaperone Hsp90), and belongs to the SRPBCC domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands.	3.62996e-69
NZ_CP046344.1\|WP_155821197.1\|935701_935887_-\|hypothetical-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	0.006081

>NZ_CP046344.1|WP_155821210.1|940937_941267_+|hypothetical-protein
MTFAVMRRRVVRNVRFGTRAALTIAKSSSIDQLNVAMGCIRFRTASQMRAADHGKRGDTSGYALDAGVTDDRDRHRAGGTRMHASTSAEKSKEKKRMRRANRASRIGNR
>NZ_CP046344.1|WP_006397310.1|939927_940764_-|(S)-ureidoglycine-aminohydrolase
MSKTTYYAPHGGHPPQTDLLTDRAMFTEAYAVIPKGVMRDIVTSWLPFWTHTRLWVIARPLSGFAETFSQYIVEVNPGGGSDKPEQDKNAEAVLFVVEGEAELTLQGSKHTLTPGGYAFIPPGADWTLHNVSDAAVRFHWIRKHYQAVDGIPLPEAFVTNEQDVEPIPMPGTNGAWVTTRFVDMSDMRHDMHVNIVTFEPGGVIPFAETHVMEHGLYVLEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYSGGPGRFRYLLYKDVNRHMNLTLNPAR
>NZ_CP046344.1|WP_155821207.1|939045_939843_+|3'-kinase
MFAAHLRSWSLTPDGGPILTASGGVLPVVWRGRPAMLKVATCEEERRGNALMTWWDGHGAAQVWAHDDDAILLERAQPQPALADFSASGHDDDAIRIACDVVAQLHAYRAPDPPPLVALRDWFASLLASDATDAILRRSQATAAALLAEPPVDEAVLHGDIHHRNVLHFGDRGWRAIDPKALRGARAYDYANLFCNPSHDIAVDRTRFERRIAIVADVARLDPRTLLRWILAWSGLSAIWLIEDDAPAETRLQVAALAAHALDSR
>NZ_CP046344.1|WP_155821204.1|936687_938832_-|PBP1A-family-penicillin-binding-protein
MTDRTDSRPTPPAPPPRRRVWRMLAGALLGLTLAGAGIAGWTIHRIWAQLPSVEQLAVYRPALPLRIFSRDGELLAEYGVERREFVPLERMPARMRDALLAAEDAQFYRHGAIDIGGLARATFANVVTGQPAQGGSTITMQVARNFYLTRDKVLSRKLAEILMAIKLERAYGKDKLLELYMNEIYLGERAYGFAAAAHVYFGKPLDALSVGEAAVLAGLPKAPSAFNPVVNPARATARRNYVLGRMLALGQLDDATYRAAVDAPIALSPQAPPGIVAAPYVAERARQMMVERFRDDAYTLGLDVTTTISMRDQRAAEAALERTLRRQRTTRDAQRTLEGALVSLDAATGDMLALVGGADFSRNVFDHALQAYRQPGSSFKPFVYSAALEKGYFPGVLVDDTQRTLTPAETGARPWRPRNYGNHYEGFIAVRRGLVRSKNVVAVSLMQAADPQYVQQHAMRFGFDARRNPASLPLALGAGAVTPLELASAYGVFANGGARVEPRLILSVKQRHGGVLYDAPAPSGTRVVSARNAFVMDSMLRDVVRAGTARGALALRRDDTAGKTGTSNGSKDVWFAGYSSGVVAVAWLGYDTPRSMGRATGAALALPVWLDYMKTAIDGRMPAEAVEPPDVARVDGDFVYAEYTRGACTADVPAFVRSRFACDGAGRAETTSAGFAASAASTAANGGAMPVAPTPAPVDAAERARVLDLFRTED
>NZ_CP046344.1|WP_035955754.1|936064_936676_-|trimeric-intracellular-cation-channel-family-protein
MHTLYLIAIVAEAMSGALMGMRRGMDRFGLALVGAVTALGGGTVRDVLLGHYPLGWIAHPQYLVITLVAATVASRIARHVARMKTLFVTVDALGLAAFTIIGCDVGASTGAAPIIVVLAGAITGVCGGMLRDLLCNEMPLILRRELYASVAFFTGALYVALQHVGIDARIATVVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP046344.1|WP_155821200.1|935883_936078_-|hypothetical-protein
MSSIERACGVRDDCMPCMSASVAHVDVDARVATVVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP046344.1|WP_155821197.1|935701_935887_-|hypothetical-protein
MSARAACGTTACRERRPSVAHVGVDARVATIVALAAGFAMRMLAVRFGWEMRTFGAADVEH
>NZ_CP046344.1|WP_155821194.1|934656_935499_+|heme-ABC-transporter-ATP-binding-protein
MLTVQHLRVARRHRVILHDLSLTIEPGRVTALLGRNGAGKSTLLKALAGELTGSAAPNGVRVTGRIVLNGEPLAQIDAQRLARLRAVLPQAAQPAFPFSVDEIVLLGRYPHARGRGGALSQRDRGIAWHALARAGADTLLGRDVTTLSGGELARVQFARVLAQLWPSDDEAGRDARDASPTRYLLLDEPTAALDLARQHRLLDTVRTIAREWRLGVLAIVHDPNLAARHADTIAMLADGTIVAHGTPHDVMTPEHIARCYGFAVKRIDSGDGTPPVMVPA
>NZ_CP046344.1|WP_155821191.1|933545_934637_+|iron-chelate-uptake-ABC-transporter-family-permease-subunit
MSARLSSIRASSAAAAAHGARRIGTQRRFAPVALGVLAVLVGAMSVVALCVGAYRISPADAWAALAGDPAAQQARAVLLGIRAPRVVLALLVGGGFGAAGAAMQALFRNPLADPGLVGVSSGAALGATAAIVLGPALFAAHAGAAALPAAAFVGALAIAALVYRLAASRGRLALPLLLLAGIAINALVGAAIGLLTFVADDAQLRSLTFWSLGSLGGAQWPTLAAVAPCAVLGCALLVRERDALNALQLGETEALHLGVPVQRLKRRVLVAVALAVGALVSCAGIVGFIGLVAPHCVRLACGPDQRIVLPGAALLGALLTLAADLAARTLAAPAEIPLGVLTALLGAPFFLALLWKSRGSLGA
>NZ_CP046344.1|WP_155821188.1|932619_933534_+|ABC-transporter-substrate-binding-protein
MNARTFDPRRRAVLAAAAASALAATAPARAIATVQSAPKRVVVIGGAVAETAFALGGEHAHGYRLVGADTTCTYPEAAKRLPKVGYQRALSAEGLLSLRPDLVLASAEAGPPAAIAQVARAGVAVQTFDEHHDAESVRMKIAGIAQALDMRDAGVALLRQFDRDWQAARDSVAAHVPGGAQPPRVLFVLNHTGNQALVAGRRTAADAMIRYAGARNAMQGFDHYKPLTSEALAAAAPDVVLISDEGLAAVGGRAALLAAPGFAATPAGRAQRIVSLDALLLLGFSPRLPLAVTMLHRRLSDTLA
>NZ_CP046344.1|WP_006397314.1|942517_942937_-|HIT-family-protein
MSYDDNNPFAKILRGELPCVKVAEDDATLAIMDLMPQADGHVLVIPKEPAAQIFDLSGDAAAASIRMTQRVATAVRAALAPDGLFIGQFNGAAAGQTVPHVHFHVIPRTEGVALRMHARDVADAATLESIAQRIRAHIA
>NZ_CP046344.1|WP_155821213.1|943131_944577_+|serine-hydrolase
MTIPLKPLIRRGVALALIAAIGYAGYQLSRLAPIATGYAAKALCSGVFVSGRPAASVIDVDIMAGVHPLLKLVRPSIDAEHHRAHATFAGFAARDAEFRPGLGCTLALGPAAAALPTALPPLPAAPAATAVPASLAIASASASASSATPAPNGVDMRKLHAALDRAFDEPDPARPRRTRAVVVMWRGHMIAERYAPGFTGDTPLPGWSMTKTVTVVLIGMLVGQHRLSPDTAALLPEWRGAGDPRAAITLDELLRMTSGLQFNEDYDDPLSDVAVMLFTQRDTARFASNKPLAAPPGTRWDYSSGTSEIVARVMRVALGGSTDDYLSFPRRALFAPLGMRSAVFEPDASGTLAAASFMYASARDWARFGQFLLQDGVWNGQRLLPEGWVRYLARATPQSSRAAFGAHLWVKVPEPFDDRDPHAPALPADAFHAVGHEGQFVSVVPSRDLVVVRLGLSRPESAWNHEAFLARVLDAIPASGT
>NZ_CP046344.1|WP_155821216.1|944601_945237_-|glutathione-S-transferase
MLHILGKIPSINVRKVLWLCTELNLPFEREDWGAGFRSTDDPAYLALNPNGLVPVIRDGDFVLWESNAILRYLANRYGDRYGDGSLYPTDPQARARVDQWIDWQGTDLNRSWVGAFLGLVRKSPDHQDPAAIAQSIANWTKHMRVLNGQLEATGAFVAGEHFTIADIAIGLSVNRWFGTPFERPELPAVKRYADRLATREGFKTYAGSANP
>NZ_CP046344.1|WP_012216303.1|945522_946725_+|trans-2-enoyl-CoA-reductase-family-protein
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARISAAFGAGADTLGVFFERPGSETKPGTAGWYNSAAFERFATEKGLYARSINGDAFSDQVKQVTIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPIGKTVTFRGIDTDKEVIRETVLEPATQEEIDGTVAVMGGEDWQMWIDALDEAGVLADGAKTTAFTYLGEQITHDIYWNGSIGEAKKDLDKKVLSIRDKLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEAGTHEGCIEQVYGLFKDSLYGATPHLDDEGRLRADYKELDPQIQKKVVELWDQVTNENLYELTDFAGYKTDFLRLFGFEIAGVDYDADVNPDVKIPRIIDTTV
>NZ_CP046344.1|WP_155821218.1|947050_947629_-|hypothetical-protein
MKRTHVVMGCAALLVALPIAAYALIKPLRVAVPALVPGVSCTHAPICIDDASKLADAQQLYRDGYARAAAAVGPFGDAPRVVFCSTRACADAFGLGERAALTLGTVGVVIAPRGWHAYFVAHELIHHRQAETLGNLAVLTKSRWLIEGMAYSLSGDPRHPLTEPFEGWRARFDAWHAALGTRPLWDAARAVE
>NZ_CP046344.1|WP_155821940.1|947700_948231_-|GNAT-family-N-acetyltransferase
MTESVTVRRVGANEAIAYVDALSDVLIDCVEGGASVSFMLPIARSTAVAFWTDVAESVANGERILLVAEDASGRIVGTVQIVTAQPENQPHRADIAKMLVARHARRQGVAARLLAAADAAARDAGKTVLVLDTVTGSDAERLYERAGWQRVGVVPNYALMPDGAPCATTFFHKQLV
>NZ_CP046344.1|WP_059781385.1|948850_949333_+|SRPBCC-family-protein
MMHSHTTRISRHVNAPRNRVYRALLDPHAVEQWKVPDGMTCHVHAFDAREGGALRVSLTADAAAPAGKTDAHTDTYHGRFVTLVPDRQVVEIDVFETDDPMLRGAMTITITLSDEDGGTRVDAVHDGVPPGVPAADNETGWRMALARLAALVEDGGRPHA
>NZ_CP046344.1|WP_155821221.1|949351_949501_+|polyketide-cyclase
MSDEDAGTRVDTVHGGVPPGVPAADNETGWRMALAPLAALVEDGSRPHA
>NZ_CP046344.1|WP_035955773.1|949824_950463_+|2-hydroxychromene-2-carboxylate-isomerase
MNAARTATWYFDFVSPFAYLQQEQFDRLPPDAAFEPTPIVLGALLAHWGQKAPAEIATKRIFTYRHAQYRADKLGIPFRMPPAHPFNPIQPLRLAIAMGNSRDAIRRIFRHIWRDGHDVASPEGFAALCDAVGFPEGVRAVDAQPIKDALRANTDRAIAHGVFGVPTFELDGDLFWGEDATDMFVDCAASRAWLDSPEVRRISALPEGIRRR
>NZ_CP046344.1|WP_105766718.1|950487_951408_-|LysR-family-transcriptional-regulator
MDGAGYRFELMETFVRIVEAGSLSAAAAQMHTTQPTVSRRLQALERSLGVRLLQRTTHAMRLTVDGERCFKRAKDLLASWAAFEADLRGAQEEPDGLLRVAVPHAFGQERFVEPLARFLRDYPRVSVEWLLQDDVRDFVGSGIDCAIQVGEPTDPGVVAIRLTNVPRFVAAAPSVLGGADVPRDPDALAALPWLALSTYYRTELTLTHAATGDTRRIRIRPRMTTANLYALRSAALLGVGACVGSSWMLAGDLARGELVHLAPEWHAAPLPVYLIYPHAQFYPSRLVRFAAMMREAVPRLVEGRDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046344_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046344_3

1115942-1116042

Orphan

Consensus_repeat	Method
CGCCGGCCGCGCCGGGGTTGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046344_3

>merge|NZ_CP046344|3|1115942-1116042|CRISPRCasFinder
CGCCGGCCGCGCCGGGGTTGCCGAATTACGAGGATCCGGGCGAATCGGGCGGCGCGGGCGGCGGCGCGCCGAACAACGCGCCGGCCGCGCCGGGATTGCCG

>NZ_CP046344|3|3|1115942-1116042|CRISPRCasFinder
CGCCGGCCGCGCCGGGGTTGCCG	AATTACGAGGATCCGGGCGAATCGGGCGGCGCGGGCGGCGGCGCGCCGAACAACG
CGCCGGCCGCGCCGGGATTGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046344.1\|WP_006413396.1\|1112564_1115198_+\|MMPL-family-transporter	unknown	unknown	gnl\|CDD\|274598
NZ_CP046344.1\|WP_155821330.1\|1097260_1101403_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|319753
NZ_CP046344.1\|WP_155821349.1\|1131757_1133635_-\|type-VI-secretion-system-baseplate-subunit-TssF	unknown	unknown	gnl\|CDD\|377574
NZ_CP046344.1\|WP_155821351.1\|1133985_1134690_-\|phosphorylase	unknown	unknown	gnl\|CDD\|235926
NZ_CP046344.1\|WP_155821345.1\|1123781_1124108_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|292215
NZ_CP046344.1\|WP_155821343.1\|1123194_1123665_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_012216206.1\|1101557_1102562_+\|chemotaxis-protein-CheB	unknown	unknown	gnl\|CDD\|319752
NZ_CP046344.1\|WP_155821336.1\|1105080_1107255_+\|malate-synthase-G	unknown	unknown	gnl\|CDD\|235097
NZ_CP046344.1\|WP_006397522.1\|1109424_1110804_+\|sensor-histidine-kinase	unknown	unknown	gnl\|CDD\|226930
NZ_CP046344.1\|WP_155821334.1\|1104641_1105046_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225734
NZ_CP046344.1\|WP_155628331.1\|1125484_1125739_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046344.1\|WP_155821347.1\|1124802_1125168_-\|DUF1493-family-protein	unknown	unknown	gnl\|CDD\|369336
NZ_CP046344.1\|WP_155821341.1\|1121167_1121422_-\|PAAR-domain-containing-protein	unknown	unknown	gnl\|CDD\|269829
NZ_CP046344.1\|WP_155821339.1\|1120215_1121157_-\|type-VI-secretion-system-protein-ImpK	unknown	unknown	gnl\|CDD\|236157
NZ_CP046344.1\|WP_155821337.1\|1116233_1120187_-\|type-VI-secretion-system-membrane-subunit-TssM	unknown	unknown	gnl\|CDD\|274531
NZ_CP046344.1\|WP_012468086.1\|1107738_1109307_+\|sensor-domain-containing-diguanylate-cyclase	unknown	unknown	gnl\|CDD\|143635
NZ_CP046344.1\|WP_155821353.1\|1134695_1136669_-\|squalene--hopene-cyclase	unknown	unknown	gnl\|CDD\|239222
NZ_CP046344.1\|WP_006397524.1\|1111649_1112246_-\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|377516
NZ_CP046344.1\|WP_155821332.1\|1102577_1104056_-\|nitronate-monooxygenase	unknown	unknown	gnl\|CDD\|240081
NZ_CP046344.1\|WP_006404668.1\|1110831_1111476_+\|response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|225107

Protein	Function_ID	Function_description	E-value
NZ_CP046344.1\|WP_006413396.1\|1112564_1115198_+\|MMPL-family-transporter	gnl\|CDD\|274598	TIGR03480, HpnN, hopanoid biosynthesis associated RND transporter like protein HpnN. The genomes containing members of this family share the machinery for the biosynthesis of hopanoid lipids. Furthermore, the genes of this family are usually located proximal to other components of this biological process. The proteins appear to be related to the RND family of export proteins, particularly the hydrophobe/amphiphile efflux-3 (HAE3) family represented by TIGR00921.	0
NZ_CP046344.1\|WP_155821330.1\|1097260_1101403_+\|PAS-domain-S-box-protein	gnl\|CDD\|319753	cd16434, CheB-CheR_fusion, Chemotaxis response regulator protein-glutamate methylesterase, CheB, fused with CheR domain. This family contains the methylesterase CheB (EC 3.1.1.61; also known as CheB methylesterase, chemotaxis-specific methylesterase, methyl-accepting chemotaxis protein methyl-esterase, or protein methyl-esterase) domain, a phosphorylation-activated response regulator involved in reversible modification of bacterial chemotaxis receptors, fused with a CheR domain as well as other domains. Signaling output of the chemotaxis receptors is modulated by CheB and methyltransferase CheR by controlling the level of receptor methylation. cheB and cheR are typically found in the same operon. However, CheB and CheR are fused in multi-domain proteins in this subgroup. The CheR protein/domain includes an all-alpha N-terminal domain and an S-adenosylmethionine-dependent methyltransferase C-terminal domain. Reversible methylation of transmembrane chemoreceptors plays an important role in ligand-dependent signaling and cellular adaptation in bacterial chemotaxis. Phosphorylated CheB catalyzes deamidation of specific glutamine residues in the cytoplasmic region of the chemoreceptors and demethylation of specific methyl glutamate residues introduced into the chemoreceptors by CheR.	1.4572e-80
NZ_CP046344.1\|WP_155821349.1\|1131757_1133635_-\|type-VI-secretion-system-baseplate-subunit-TssF	gnl\|CDD\|377574	pfam05947, T6SS_TssF, Type VI secretion system, TssF. This is a family of Gram-negative bacterial proteins that form part of the type VI pathogenicity secretion system (T6SS), including TssF. TssF is homologs to phage tail proteins and is required for proper assembly of the Hcp tube (the T6SS inner tube) in bacteria.	0
NZ_CP046344.1\|WP_155821345.1\|1123781_1124108_-\|hypothetical-protein	gnl\|CDD\|292215	pfam15581, Imm58, Immunity protein 58. A predicted immunity protein with an alpha+beta fold and YxxxD, WxG, KxxxE motifs. Proteins containing this domain are present in bacterial polymorphic toxin systems as an immediate gene neighbor of the toxin gene.	2.13486e-37
NZ_CP046344.1\|WP_012216206.1\|1101557_1102562_+\|chemotaxis-protein-CheB	gnl\|CDD\|319752	cd16433, CheB, Chemotaxis response regulator protein-glutamate methylesterase, CheB. This family contains the methylesterase CheB (EC 3.1.1.61; also known as CheB methylesterase, chemotaxis-specific methylesterase, methyl-accepting chemotaxis protein methyl-esterase, or protein methyl-esterase) domain, a phosphorylation-activated response regulator involved in reversible modification of bacterial chemotaxis receptors. Signaling output of the chemotaxis receptors is modulated by CheB and methyltransferase CheR by controlling the level of receptor methylation. cheR and cheB have a strong preference to occur in the same operon, and a subgroup contains multidomain proteins with CheB-CheR fusions. Reversible methylation of transmembrane chemoreceptors plays an important role in ligand-dependent signaling and cellular adaptation in bacterial chemotaxis. Phosphorylated CheB catalyzes deamidation of specific glutamine residues in the cytoplasmic region of the chemoreceptors and demethylation of specific methyl glutamate residues introduced into the chemoreceptors by CheR.	4.32759e-80
NZ_CP046344.1\|WP_155821336.1\|1105080_1107255_+\|malate-synthase-G	gnl\|CDD\|235097	PRK02999, PRK02999, malate synthase G; Provisional.	0
NZ_CP046344.1\|WP_006397522.1\|1109424_1110804_+\|sensor-histidine-kinase	gnl\|CDD\|226930	COG4564, COG4564, Signal transduction histidine kinase [Signal transduction mechanisms].	1.35491e-162
NZ_CP046344.1\|WP_155821334.1\|1104641_1105046_+\|hypothetical-protein	gnl\|CDD\|225734	COG3193, GlcG, Uncharacterized protein, possibly involved in utilization of glycolate and propanediol [General function prediction only].	6.17834e-37
NZ_CP046344.1\|WP_155821351.1\|1133985_1134690_-\|phosphorylase	gnl\|CDD\|235926	PRK07077, PRK07077, phosphorylase.	5.30331e-110
NZ_CP046344.1\|WP_155821347.1\|1124802_1125168_-\|DUF1493-family-protein	gnl\|CDD\|369336	pfam07377, DUF1493, Protein of unknown function (DUF1493). This family consists of several bacterial proteins of around 115 residues in length. Members of this family seem to be found exclusively in Salmonella and Yersinia species and several have been described as being putative cytoplasmic proteins. The function of this family is unknown.	3.03129e-07
NZ_CP046344.1\|WP_155821341.1\|1121167_1121422_-\|PAAR-domain-containing-protein	gnl\|CDD\|269829	cd14744, PAAR_CT_2, proline-alanine-alanine-arginine (PAAR) domain with uncharacterized C-terminal extension. This domain is found in the PAAR (proline-alanine-alanine-arginine) repeat family of mostly beta- and gamma-proteobacteria, and forms a sharp conical extension on the VgrG spike, a trimeric protein complex of the bacterial type VI secretion system (T6SS). Most members contain C-terminal domain extensions corresponding to several uncharacterized domains such as S-type pyocin, DUF2235, DUF2345 and cytotoxic proteins. However, these terminal domains are exposed to solution, and do not distort the binding site of VgrG. The pointed tip of the PAAR domain is stabilized by a zinc atom positioned close to the cone's vertex and is likely to be important for its integrity during penetration of the target cell envelope. VgrG proteins are orthologous to the central baseplate spikes of bacteriophages with contractile tails, and genes encoding proteins with PAAR motifs have been frequently found immediately downstream from vgrG-like genes.	3.67529e-16
NZ_CP046344.1\|WP_155821339.1\|1120215_1121157_-\|type-VI-secretion-system-protein-ImpK	gnl\|CDD\|236157	PRK08126, PRK08126, hypothetical protein; Provisional.	1.56976e-70
NZ_CP046344.1\|WP_155821337.1\|1116233_1120187_-\|type-VI-secretion-system-membrane-subunit-TssM	gnl\|CDD\|274531	TIGR03348, VI_IcmF, type VI secretion protein IcmF. Members of this protein family are IcmF homologs and tend to be associated with type VI secretion systems. [Cellular processes, Pathogenesis].	0
NZ_CP046344.1\|WP_012468086.1\|1107738_1109307_+\|sensor-domain-containing-diguanylate-cyclase	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	1.0532e-56
NZ_CP046344.1\|WP_155821353.1\|1134695_1136669_-\|squalene--hopene-cyclase	gnl\|CDD\|239222	cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold. Squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY) are integral membrane proteins that catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. This group contains bacterial SQCY which catalyzes the convertion of squalene to hopene or diplopterol and eukaryotic OSQCY which transforms the 2,3-epoxide of squalene to compounds such as, lanosterol in mammals and fungi or, cycloartenol in plants. Deletion of a single glycine residue of Alicyclobacillus acidocaldarius SQCY alters its substrate specificity into that of eukaryotic OSQCY. Both enzymes have a second minor domain, which forms an alpha-alpha barrel that is inserted into the major domain.	0
NZ_CP046344.1\|WP_006397524.1\|1111649_1112246_-\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|377516	pfam05494, MlaC, MlaC protein. MlaC is a component of the Mla pathway, an ABC transport system that functions to maintain the asymmetry of the outer membrane. This family of proteins is involved in toluene tolerance, which is mediated by increased cell membrane rigidity resulting from changes in fatty acid and phospholipid compositions, exclusion of toluene from the cell membrane, and removal of intracellular toluene by degradation. Many proteins are involved in these processes.	4.30418e-48
NZ_CP046344.1\|WP_155821332.1\|1102577_1104056_-\|nitronate-monooxygenase	gnl\|CDD\|240081	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDP is a member of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.	2.94038e-83
NZ_CP046344.1\|WP_006404668.1\|1110831_1111476_+\|response-regulator-transcription-factor	gnl\|CDD\|225107	COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription].	4.85322e-67

>NZ_CP046344.1|WP_006413396.1|1112564_1115198_+|MMPL-family-transporter
MVTSLIVRLVAWSVRRPVWVVVLSLLIAAFSGVYVARHFKINTDISKLVDAEPQWAALSQAVDRAFPQRNGTILAVVEAPAPEFATAAAHALTESLQKQAAAGRIGPVAEPGGGPFFEHNGLLFLSPQQVADTTSQLASARPLVNELAKNPSLTGLATTLSTTLGQPLLTGQVKLPSMAKLLSRSAATVDDVLAGKPAAFSWRALVDNDAARQPARAFVTVQPVVNYGALKAGAQTSDVIRETARALDLEKRYGAVVRLTGEQPLADDEFSSVEDGAALNGVVTLLVVFVILWLALRSKRMIASVLVTLFVGLVVTAALGLAMVGSLNMISVAFMVLFVGLGVDFSIQYGVKYREERFRDARIDHALIGAAHSMGMPLALATTAVAASFFSFIPTAYRGVSELGLIAGVGMFVALLTTLTLLPALLRLFAPPGESKTPGFPWLAPVDDYLDRHRKPILIGTLAVVIGALPLLAFLHFDFNPLHLKDPHSESMSTLLALKDSPEAAVNDVTLLAPSLADADAAAKRLDALPEVGRTTTLSTFIPADQPEKRAAIATAASTLLPALTQPPAPPATDAQRVAALKRASDLLGYAAEDHPGPGAAAAQHLSQSLAKLAAADSATRDRAERAFADTLRIALNQLAALLQPQEITRDTLPPPLVRDWVAPDGKALVQISPKVPKGVDPNDDTMLRHFATAVKAAEPGAIGGPISILHSANTIISAFLHAALWSIISITILLWITLRRFGDVLRTLVPLLVSGIVTLEMCVVLGMSLNFANIIALPLMLGVGVAFKVYFVMAWRAGQTGLLHSSLTHAVLFSAATTATAFGSLWLSHHPGTSSMGKLLALALTCTLIGAVVFQPVLMGKPRVKRAKNQSQGINE
>NZ_CP046344.1|WP_006397524.1|1111649_1112246_-|ABC-transporter-substrate-binding-protein
MKRHLFAFLAAAAVSVSAFAQSAPVDIVRHAVEGTVNAMKADPAARGGDMAKITQVVEQRFLPATNFERTTRIAVGDAWKQATPQQQQELYKQFRLLMTRTYAASLAQLGNQDAKFSFKAGGTSGADALVQSTVTTPGDSQSVGYRLGKVGNDWKIYDIDMSGAWLIQVYQGQFKSQLASGGIDGLIAYLQKHNSRTN
>NZ_CP046344.1|WP_006404668.1|1110831_1111476_+|response-regulator-transcription-factor
MSAPDTARPAARLLLVDDHPLVRDGLRMRLEAADLSVVGEAGNADEALALAAELEPDLALMDVGMNGMNGIALAGVFHERFPAIRVLMLSMHDNVEYVTQAVRAGASGYLLKDSPASEIVRAIGAVLAGQTFFSEGLAARMIQASAAASPLDRLTPRERDILDALAEGLSSKQIAQQTGLSVRTVETHRLNLKRKLDIEGQAELIKFAVEHRRR
>NZ_CP046344.1|WP_006397522.1|1109424_1110804_+|sensor-histidine-kinase
MKLKAKIFLLAIVPFLLAIAGIGFGVRQQATSLARTQHATIQAAYLSSKEVELKHYVELATSAIMPLYDAAGRNGRDDAMLRTQALAMLQKMDFGPDGYFFVYDLHGNALMHPREPERVGHNFWTMRDPQGALTIQQLIGAASRGGGFVRYVWQRPSTGKPAPKLGYVVALERWGWMVGTGIYLDDVDTALQRIDARASANIERTMSWLTAIALTGAAAIAVCALVLNVSESRSADAKLKQLAQRVVESQEQERARLSRELHDGISQMMVSAKLMLESALARFERGTVRVPEAERALASGVVRLGDTLREVRRISHALRPAMLDDLGLAAALDQLIREFGAQSGIDIGYTQVAHSGARPLPAAVNTALFRIAQEALSNIVHHAHASRAAVTLDVGAQSVTLTIADNGCGFDAVRSQADERRGIGLRNMRERLDALGGTLTITSQVGHTVVAARVPLRDA
>NZ_CP046344.1|WP_012468086.1|1107738_1109307_+|sensor-domain-containing-diguanylate-cyclase
MAETDYAMPRESGLTSRVATHLRRLLLPHLIFYSGLLIALLLMLLCAIVLYEGRIDARERARTTLQNLVLMASWDIERNIEIYSLSLQAVVEGENDPAIVALPMPLRRQVLFDRATTARYLGGIYVLDSRGNIAVDGKSDVPRNANFADAPYFSVHRDRPDVGLYVSDPYRSRLRGGSPSIALSRRITRADGSFGGIAVMSIRLEYFRDLFSRLALGDRGAMSLIGTNGVMVMREPYDPKIVGRNISQASTFRQFMRAREGSFFDRASIDGVRRLYAFRHLDNLPLIMMVAESESEIYAAWYDRAIPIGSAMALLALGFVGLSLLLDVQLRKRHRAETELQALARTDGLTGLDNRRMLDVTLAREWRRAARSQHALSLLFVDVDHFKRYNDSQGHQAGDDALAAVGRCIAGCLRRPADYAARYGGEEFVVILPDIGSDGAVAIAETIRTSILELGIRHDGSAFGCLTASIGVATCRPDRDDDMHAALKLADDALYRAKETGRNRVVVLTAAHAGRHYAPRTA
>NZ_CP046344.1|WP_155821336.1|1105080_1107255_+|malate-synthase-G
MIDHDGLQVAPALSQFIENEALPGTGIDQAAFWRGFSALVHDLAPRNRELLAERDRLQSELDAWHRAHPGPVRDLAAYRAFLEQIGYLVPTPADVAATTANVDSEIATQAGPQLVVPLSNARYALNAANARWSSLYDALYGTDALPEDNGAERTATYNPTRGQRVIDYARNVLDNAAPLAGASHRDALRYRVQDGQLAVETGKGIVHLAQPAQFVGYQGAADAPSAILLKHNGLHLEIQIDGSTPIGRADVANVKDVVLEAAVSTIIDCEDSVAAVDAEDKVQLYRNWLGLMQGTLVEEVSKGGKTFTRRLNADREYTTPDGGTLTLHGRSLLFVRNVGHLMTIGAVLDRDGNEIPEGILDGVVTTLCALHDLKSKRNSRTGSIYIVKPKMHGPAEVAFADTLFARIEDLYGLPRNTLKMGIMDEERRTSVNLAACIAAAAARVAFINTGFLDRTGDEMHSAMEAGPMIRKGDMKSSAWIAAYERNNVLAGLSAGLRGRAQIGKGMWAMPDLMHAMLEQKIAHPRAGANTAWVPSPTAATLHALHYHLVDVQAVQQALEKTPYASERDALLEGLLTVPVVERAAWSDEEILREVENNAQGILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLRHGVITEAFVLDVFKRMARVVDQQNAGDPNYRPMAPDYDRSVAFQAACALALQGTSQPSGYTEPLLHRFRLAFKAQQAQA
>NZ_CP046344.1|WP_155821334.1|1104641_1105046_+|hypothetical-protein
MQMKPELELADADRILAAARAEAERNGWAVSIAVVDDGGHLLAFARLDGASPASAAIAQDKARAAALGRRDTKAYEDMINGGRTAFLSTPLSGLLEGGVPVTAGGRVAGAIGVSGVKSVQDAQVARAGAQSVAD
>NZ_CP046344.1|WP_155821332.1|1102577_1104056_-|nitronate-monooxygenase
MSNPVRGDGPDARAVQILHRPVCDLLGCTWPIVLAGMGGAARSALVSAVSAAGGFGFLGMVREPVELIRREVEQVRAATDRPFGINLIPAATPPELLDAQLDACIELRVPVVALFWDVMPAVVRRLRDAGIRVVHQVGSVDDAQAAEAAGADALIVQGHEAGGHVRGDRPLLALLPDVIGAVQVPVLAAGGIVDGAGVAAAMALGAQGAAIGTAFLATHESFAHAYHKQRIVDAHDGDTLLTDIFHINWPRGAKVRVLPSSVTRGERGDPFGDARVVIGDEEGRPIYLFSTDSPLRTMTGDFEAMALYAGTGAGRIGAVEAAADVLRRIVRDAAAILESRAAARSGHDVDAQRTALLAALDELLEAERAGARVASETAAELTDDDALHRLIAHIRQDEAHWCSVLVDAIRTLGATPTRATGAFYEKAMAIDDLAERMAFLNRGQRWVVRKLQALLPTLADRDLHEALTQMLVAHEKNIGAVDVRLRDGGVHG
>NZ_CP046344.1|WP_012216206.1|1101557_1102562_+|chemotaxis-protein-CheB
MDHRDVVVVASSRGGLPVLRTLVTNLPEGFPVPICIVQHIGRNRSILPELLTRWGRLDATHALHGERPHPGRIYVAPPDRHLVLRGGRLHLLDTAAENYARPAADPLFRSAAREYGPGAIGVVLSGDLDDGSAGLAAIRAHGGYGIVQRPDECEAPSMPRAALAAAGADAVATADELARTIHAAVYGARGEEGRTMTDLRTLDDESRIAEGRFVTPQLLDAIGERSALTCPSCNGALWRMRDDRPLRYRCHTGHAFSALSLDDAEAQKAEDAIWVAIRAVNERMIFARERQEWARRTGNAEDEAIEQARIDENRQLAEVLRHALHVATHGRETG
>NZ_CP046344.1|WP_155821330.1|1097260_1101403_+|PAS-domain-S-box-protein
MARQEPTDRERLPASATLRSDLTFPIVGIGASAGGTTALQTFFENAPTGMEMAFVVIVHLAPEQISHMDSVLQHTTGMPVRQVTSTVPIEKNHIYVIAPGMQLEMADGCLRCSPREMSGGVALTIDHFFRTLADAHDSRAIGIVMSGTGSDGAAGLRRIKEVGGITLAQTPDDAEHAEMPKQAIAIGGADIVLPAAEMPQRLLDLWANARRIEQQGLELAHAHQNLDRPGANDPERALSDILMHLRVRTGHDFRLYKRATVLRRIERRMQVNGQRDLLAYRDFLRATPDEANALLADMLIGVTQFFRDRDAFDFLEREVIASMFSPDAGEEQVRVWVAGCATGEEAYSISLLLARARETAVSSQAIQVFATDIDEAAIVRARTGSYPLSIAADVPEPLLQRYFTRDGAHFVIAKSVRERILFAAHSLLRDPPFSHLDLISCRNVLIYLERAVQRQILELFHFALRPNGYLFLGTAESADAADDLFTVVDKKRRIYQARVVTHRAKTPTGCPPLLHVESGSADERPVPTPTLRAPASPVQRNFSYAELHQRALEMYSPPSVIIDKESNVVHLSDNAGRFLRHVGGELSSNIMTLVLPDLRLDLRTAIFRALQTGTSVEARRVKWTHDTQVSWINMTVRPFHDKVANADFLLVVFDEVAGRMTDEDQAEANGQDPVLAQLEHELQHSREQLATIIEQYETSVEELKASNEELQAINEELRSTSEELESSKEELQSVNEELTTANAEMQARIEDTAKANDDLHNIIASSEIATVFVDKEIRIKRFTPNATAIFNLIDSDLGRSLFHITHSLRYPTLADDVRQSFQSLRLIEREIESEAGRWYLIRLLPYRTADDHIDGAVITLIDVTDRHHAEEAARAGEQRLRLVAQSTKDYAIIIQDGNGIIASWNAGAERIFGYTEDEMIGQDVELIYEPNDRHARVPAHEREVAAREGRADDERWHRTKDGRRIFCSGVVTPIADTSFNGFAKIVRDLTQRKLSEDANREALAREQAAREQALSSNQLKDEFIAVLSHELRHPLNLIGVRAEMLPRLPETRDIPAVREAAELIRQAVRAQAQIIDDLLDLSRIRTGKLALELSRVDLTAVLRTIVDTCEADAHARGLVLTAELPDDPAIALADPIRCEQIFWNLMSNALKFTHAGGRIVVRLTHEARMLRVDVIDDGQGIDRDTLPHVFDMFRQAPRDRTRGGLGIGLALVRQLVEMHDGRISAASEGPGRGTTMTVWLPAAADTRVAAADRRASEGRIAGLHVLLVEDDAETALSLTTLLKLAGAEVRTAASGAAALEMLAQGPVDAIVSDIGLPDMDGYALLRRIKADPQWAQVKAIALTGRNRQTDVGAATQAGFDTHLPKPLDFGLLLAALAEPR
>NZ_CP046344.1|WP_155821337.1|1116233_1120187_-|type-VI-secretion-system-membrane-subunit-TssM
MKKILSFPSSRHLWAVVMVIAAVVVIWFAGPLLTFGGLSPLALIGIRLTLIALVLAAWVLWLIDWTTSIVIVVLLCLAIWHAFPLVTLSGKPLFASATARILAMIGVVFVYAGVMLVRWWRQMRRHPGRLRRWLRLGKRGPRPLAASRLAEIEDIARATIAQLKAGRAAHGRLARLFRGAAHLYDVPWYVVLGPKGSGKTSMLLNSGLAFPLDARLQHSLAPDDARALPGWRLTNEAVLIDTAGHYVQHGTSRYSLPVASSDGPNGGKRKSQPPDITAVRRQSDAAEWHGFIRLLRRIRPRLPLNGVLFTIDVAALAHADPAAHTTESRALRARLEEMQAEFGTGFPVWLVVTKMDRLPGFTDYFASLGQAERAQILGVTLGSDRQARMNDAIRTELNLLATRLADGVTSLLRNETDMDRRRRLAVLPESVAALVNPLADLIEHVFARDDNGGPTQPHAMFRGVYLTSAIQGDHAIAAERRTLLRRMIDASGTTRRAPRPARGETGYFLRDLWLAVVFREGHLASPNWNREHRVRLQRWLGHSLVWLIAAAMCVNLWNGFVTERTSLATLEQKARSLAALLAPSDLSANPERVPMVLNHAKELLHDATQLATDADGTFRFATARLETIASDSRNVYEALSEQAVLPHIVRRMEHAIVSAVAIGDAQAAYDALRVYLMLHDRERFNANDVRMWVLDDWSRHDSAATFGGRAAMIGHVERLFSEGHVVRSPLSRNDALIRQARAFLDGSDLIERLYRRAKATMWNDAPDDFSLLRMVGTQAGMVFTRVSGAPLSGGVPGIFTREGYQAVFSKRLPEFLRVASDDDAWVMGRRASGDPRRHSAGTLNAPNQDDDALLAAVTRRYLLEYAQQWDAFLGDIRIVSGTSLAFNLKILRTLAAPDSPLMRLARAAVIETTVTQPMAESDGALLAKATDAIHQKAETRLALRASEQLEREWVDRHFAALREVVTGHADTRSDTQRVETSAGRTGLDGIADLLNDYYGALAIADNALLNNSMPPASEHAAKLKMMADTMPAPLRAVLHQLAVEGSRGINQGIGRLLARQVQAAIGDVCRTTIEGNYPFSPDSSRDVGIDDFTRMFAHGGVIDDFFTRTLAPFVDTAAKPWRYRTLPGATEPVQGPDLAPFEHAKAIRDIFFNEVDRTRPSWKVDIRIPELDPTIMSLSLDIDGQTTRYRHGPVEPFTVTWPGPRGGAHAWLVASPSIGSNTSTIAADGPWALMRLLRKGRVIETATLGRTRVVFSFDGREAALDIASAGSAANPLTSDVLATFRCPGTTAMFNLPDSGPPPGLPQGRLPAMPDSGL
>NZ_CP046344.1|WP_155821339.1|1120215_1121157_-|type-VI-secretion-system-protein-ImpK
MSRMSSATQSGSAPKIVSARRTSAPPRRPNGTFLSNRNPRQQPGSRRNRPFGPLAPPEDEPTRLAAVLGHRNGLLEAGRVLLRALVDMSALIDTGHDARLRDLLLEEVRVFERLCVRANIRVDHRIGARYCLCTALDEAAMRELAARGDATGSAAWASDALTQRIGEDNQGGSKVYALTLRLLDDAADHWPLLELIYRIFSLGFEGRYPHGRTFSAHDRVRERIYNAIAAHLPTVPNALSTQAATIESARPSHCFEMPVWLSAAVLSAALCALYVYCRIESGAQADDVQRQLSNIAHTAPYSAIDPPQGDPAR
>NZ_CP046344.1|WP_155821341.1|1121167_1121422_-|PAAR-domain-containing-protein
MPARVATLGTLTTHGGAVTSASAGVAINGRPAACVGDAVSCPLHGAGVITTGGVGTINGRQIAHHGSGTSCGATLVVSDDGPTV
>NZ_CP046344.1|WP_155821343.1|1123194_1123665_-|hypothetical-protein
MKIDFSVFENDFFSSDEPIACGGRVEPRAVEAFFRGRRRFDVTLGDLNNVYEHDPSACLGFMLPRAFAFFLPVFMKISIIDHEEADVISDAVVRRMYDMAKDRADDNLSAVLSSYTREQLETIPNFLLEMSRIEWRHHNPNLASEAATLLRGKFLL
>NZ_CP046344.1|WP_155821345.1|1123781_1124108_-|hypothetical-protein
MSKAATLIILMLIGLCLILAYFWVDRSISLDYSRQSEDAANNALRGLEHVLEQEWRGLPEAEVLRRLQAAFPSSPTARPIVEKDGDVVWLDEIPFYIEKGSLKSIGRR
>NZ_CP046344.1|WP_155821347.1|1124802_1125168_-|DUF1493-family-protein
MMLMKNDLSPELREYLKQCGFSKRVITKCTLDTRLYHDLDVYGDVAEGCITVLCEQYHVDISGFEFDKYFPPEFVGENPFIRTLLWAVPFWGWTVRRRGEYSALTMRMIDNAIRTGRWQEA
>NZ_CP046344.1|WP_155628331.1|1125484_1125739_-|hypothetical-protein
MKYCDGNRNVRVGDSVLVENGVEGVVVCDFEGKEYEPGYEDWATGSSAIASGIPEKGIMVSTVEYGLIYYESEDESIVFVKSKQ
>NZ_CP046344.1|WP_155821349.1|1131757_1133635_-|type-VI-secretion-system-baseplate-subunit-TssF
MNPHLLDAYNRELLYFKELVEEFAQAHPKIARRLGLHAGEIADPFVERLVQAASFTTARLQLKLDAAFPLLSSRLLETVYPNYVAPTPSIAVARLYPDEQQGNLLEGFRVPRGTTFTSRVPDGERTPCTFRSGLDVTLYPLEIVSARLTGVPPDIPSVERYGAADRPIRGALRLRLRTTGEARFEELRGLDRLPVYLAGDERIASRLFELIHAGAVASVIGMPNRFADSNRSFGVVRDRAVEHTGLAADESLLPLIGTKFHGHNLLHEYATCPARFWFFTLTGLNAGLRYVTDREAEIVVLLDRFDGSLVEHVDASRFALFCTPVVNLFRRTSDPAEVPGTGAEILVQPDKQNGSDYEVFAVEALHGFVSKGAASLAFRPLYRPLPSNEADHGRYFTIRREHGTAKTSYRRYGARTPYVSTDVFVSLVDENEQSYPQAMKYLSVDAWLTNGDLPSLLEPEGATDLTVEISAPVRRTELVRAPSAARAPLAQGDAAWRLIGQLNLDYGRLEPQDGSALRDILILFAAADDVRLRRQIDSLIRVETRPVTKKLPGQGPLRFGRGIECVLTVDEAGFDGASPFLFGVILEHYVARHVSTHSFTQSVLRSPQRGELMRWPVRMGTRSAA
>NZ_CP046344.1|WP_155821351.1|1133985_1134690_-|phosphorylase
MASQQSGRLPVIAVTGMAFEARIARGDGVEAVFAARADRLERALTEVTARGCAGIVSFGTAGGLAPDLKPGALVVADAVDGPFGRVQTDADWSARLVVALHDTPVWTRVSRGAIAAVTAPVVTEQEKASLHRAKGALAVDMESHIAAAFAAARGVPFAVCRAIVDPAWRTLPRAATAGLRDDGSTAILPILRELLKQPSQLGPLLQVASDARAARTTLIQARHAFGREGALRIV
>NZ_CP046344.1|WP_155821353.1|1134695_1136669_-|squalene--hopene-cyclase
MNDLTDMATLSAGTVPAELDAAVARATDALLAAQNADGHWVYELEADSTIPAEYVLLVHYLGETPNLELEQKIGRYLRRIQQADGGWPLFTDGAPNISASVKAYFALKVIGDDENAEHMQRARRAIHAMGGAEMSNVFTRIQLALYGAIPWRAVPMMPVEIMLLPQWFPFHLSKVSYWARTVIVPLLVLNAKRPLAKNPRGVRIDELFIDPPVNAGLLPRQGHQSAGWFAFFRAVDHVLRAVDGLFPAYTRERAIRQAVAFVDERLNGEDGLGAIYPAMANAVMMYDVLGYAEDHPNRAIARKSIEKLLVVHEDEAYCQPCLSPVWDTSLAAHALLETRDPRAEQAAMRGLDWLRPLQILDVRGDWISRRPHVRPGGWAFQYANPHYPDVDDTAVVAMAMDRAQKLNQSDTYRESIARAREWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLDPPTADVSGRCLSMLSQLGETALNSDAARRALDYMLKEQEPDGSWYGRWGMNYVYGTWTALCALNAAGLGPEDARVKRAAQWLLSIQNKDGGWGEDGDSYKLNYRGYEPAPSTASQTAWALLGLMAAGEVNNPAVKRGIDYLIAEQKEHGLWDEARFTATGFPRVFYLRYHGYRKFFPLWALARYRNLKRDNTTRVTVGI

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046344_2	2.3\|941632\|25\|NZ_CP046344\|CRISPRCasFinder	941632-941656	25	MH371109	Microbacterium phage Lyell, complete genome	47363-47387	4	0.84
NZ_CP046344_2	2.3\|941632\|25\|NZ_CP046344\|CRISPRCasFinder	941632-941656	25	NZ_CP016617	Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence	840013-840037	5	0.8

1. spacer 2.3|941632|25|NZ_CP046344|CRISPRCasFinder matches to MH371109 (Microbacterium phage Lyell, complete genome) position: , mismatch: 4, identity: 0.84

cgcgccgccgatcacggaacccgtg	CRISPR spacer
cgcgccgccgatcccggcacccggt	Protospacer
************* *** *****

2. spacer 2.3|941632|25|NZ_CP046344|CRISPRCasFinder matches to NZ_CP016617 (Microvirga ossetica strain V5/3m plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.8

cgcgccgccgatcacggaacccgtg	CRISPR spacer
ggcgccgccgatcacggaacggatt	Protospacer
 *******************  .*

Prophage detection

Region	Region Position	Protein_number	Hit_taxonomy	Key_proteins	Att_site	Prophage annotation

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

367267 : 374928

uncultured_Caudovirales_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012211083.1\|367267_367939_+	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	2.5e-29	34.7
WP_009693503.1\|367935_369330_+	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	1.6e-17	24.7
WP_012211084.1\|369481_369877_+	DUF305 domain-containing protein	A0A218MND9	uncultured_virus	1.4e-11	42.1
WP_012211085.1\|370416_371154_-	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	3.0e-100	75.5
WP_009693508.1\|371131_371554_-	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	2.6e-53	71.4
WP_009693509.1\|371550_372783_-	MFS transporter	NA	NA	NA	NA
WP_012210993.1\|372784_373858_-	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_012210994.1\|373921_374416_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	4.5e-28	47.1
WP_009693514.1\|374433_374928_-	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	2.7e-25	43.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046344

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection