CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Target MGE spacer number	Prophage number
NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	1 crisprs	DEDDh,WYL,csa3,cas3	1	1
NZ_CP046330	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed1, complete sequence	0 crisprs	NA	0	2
NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	0 crisprs	NA	0	1
NZ_CP046331	Cupriavidus metallidurans strain FDAARGOS_675 chromosome, complete genome	1 crisprs	DinG,csa3,RT,PD-DExK,WYL,cas3,DEDDh	0	259

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046333_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046333_1

588716-588798

Orphan

Consensus_repeat	Method
GTGCGGAATTCGTAGCCATACTTGTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046333_1

>merge|NZ_CP046333|1|588716-588798|CRISPRCasFinder
GTGCGGAATTCGTAGCCATACTTGTCTGCCGGCACCCGGGTCCCCGCGGACTCGCCGGTGCGGAATTCATAGCCATACTTGTC

>NZ_CP046333|1|1|588716-588798|CRISPRCasFinder
GTGCGGAATTCGTAGCCATACTTGTC	TGCCGGCACCCGGGTCCCCGCGGACTCGCCG
GTGCGGAATTCATAGCCATACTTGTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046333.1\|WP_011518428.1\|585457_586456_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270234
NZ_CP046333.1\|WP_011518434.1\|577774_579091_-\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
NZ_CP046333.1\|WP_011518419.1\|594636_595908_-\|YeaH/YhbH-family-protein	unknown	unknown	gnl\|CDD\|377280
NZ_CP046333.1\|WP_011518421.1\|591860_593039_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225360
NZ_CP046333.1\|WP_011518426.1\|587344_587971_-\|LysE-family-translocator	unknown	unknown	gnl\|CDD\|224199
NZ_CP046333.1\|WP_011518420.1\|593060_594599_-\|SpoVR-family-protein	unknown	unknown	gnl\|CDD\|236973
NZ_CP046333.1\|WP_008647020.1\|596004_597927_-\|PrkA-family-serine-protein-kinase	unknown	unknown	gnl\|CDD\|185352
NZ_CP046333.1\|WP_049799794.1\|588010_588292_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046333.1\|WP_011518432.1\|580471_581458_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|270296
NZ_CP046333.1\|WP_152560190.1\|600780_601806_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	unknown	unknown	gnl\|CDD\|270294
NZ_CP046333.1\|WP_152560261.1\|589224_591486_+\|mechanosensitive-ion-channel	unknown	unknown	gnl\|CDD\|366370
NZ_CP046333.1\|WP_011518427.1\|586642_587317_+\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|366010
NZ_CP046333.1\|WP_011518433.1\|579130_580444_-\|DUF1254-domain-containing-protein	unknown	unknown	gnl\|CDD\|227659
NZ_CP046333.1\|WP_011518413.1\|603266_604646_+\|MmgE/PrpD-family-protein	unknown	unknown	gnl\|CDD\|377179
NZ_CP046333.1\|WP_035822869.1\|583694_584501_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224332
NZ_CP046333.1\|WP_029310285.1\|584665_585343_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP046333.1\|WP_011518414.1\|602088_603258_+\|acyl-CoA/acyl-ACP-dehydrogenase	unknown	unknown	gnl\|CDD\|224871
NZ_CP046333.1\|WP_024568962.1\|598804_599719_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187611
NZ_CP046333.1\|WP_011518431.1\|581500_583612_-\|acetate--CoA-ligase-family-protein	unknown	unknown	gnl\|CDD\|223972
NZ_CP046333.1\|WP_011518416.1\|599855_600758_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176113

Protein	Function_ID	Function_description	E-value
NZ_CP046333.1\|WP_011518428.1\|585457_586456_+\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270234	cd07012, PBP2_Bug_TTT, Bug (Bordetella uptake gene) protein family of periplasmic solute-binding receptors; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) proteins present in a number of bacterial species, but mainly in proteobacteria. In eubacteria, at least three families of periplasmic binding-protein dependent transporters are known: the ATP-binding cassette (ABC) transporters, the tripartite ATP-independent periplasmic transporters, and the tripartite tricarboxylate transporters (TTT). Bug proteins are the PBP components of the TTT. Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	1.08498e-116
NZ_CP046333.1\|WP_011518434.1\|577774_579091_-\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	1.60378e-71
NZ_CP046333.1\|WP_011518419.1\|594636_595908_-\|YeaH/YhbH-family-protein	gnl\|CDD\|377280	pfam04285, DUF444, Protein of unknown function (DUF444). Bacterial protein of unknown function. One family member is predicted to contain a von Willebrand factor (vWF) type A domain (Smart:VWA).	0
NZ_CP046333.1\|WP_011518421.1\|591860_593039_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225360	COG2771, CsgD, DNA-binding HTH domain-containing proteins [Transcription].	4.2466e-12
NZ_CP046333.1\|WP_011518426.1\|587344_587971_-\|LysE-family-translocator	gnl\|CDD\|224199	COG1280, RhtB, Putative threonine efflux protein [Amino acid transport and metabolism].	2.29951e-42
NZ_CP046333.1\|WP_011518420.1\|593060_594599_-\|SpoVR-family-protein	gnl\|CDD\|236973	PRK11767, PRK11767, SpoVR family protein; Provisional.	0
NZ_CP046333.1\|WP_008647020.1\|596004_597927_-\|PrkA-family-serine-protein-kinase	gnl\|CDD\|185352	PRK15455, PRK15455, PrkA family serine protein kinase; Provisional.	0
NZ_CP046333.1\|WP_011518432.1\|580471_581458_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein	gnl\|CDD\|270296	cd13578, PBP2_Bug27, Aromatic solutes transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. Bug27 binds non-carboxylated solute nicotinamide, in contrast to BugD (aspartic acid transporter) and BugE (glutamate transporter) which both bind aliphatic carboxylated ligands. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity.	1.56372e-125
NZ_CP046333.1\|WP_152560190.1\|600780_601806_-\|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD	gnl\|CDD\|270294	cd13576, PBP2_BugD_Asp, Aspartic acid transporter of Bug (Bordetella uptake gene) protein family; contains the type 2 periplasmic binding fold. The Bug (Bordetella uptake gene) protein family is a large family of periplasmic solute-binding (PBP) receptors present in a number of bacterial species, but mainly in proteobacteria. Bug proteins are the PBP components of the tripartite carboxylate transporters (TTT). Their expansive expansion in proteobacteria indicates a large functional diversity. The best studied examples are Bordetella pertussis BugD, which is an aspartic acid transporter, and BugE, which is glutamate transporter.	4.69106e-132
NZ_CP046333.1\|WP_152560261.1\|589224_591486_+\|mechanosensitive-ion-channel	gnl\|CDD\|366370	pfam00924, MS_channel, Mechanosensitive ion channel. Two members of this protein family of M. jannaschii have been functionally characterized. Both proteins form mechanosensitive (MS) ion channels upon reconstitution into liposomes and functional examination by the patch-clamp technique. Therefore this family are likely to also be MS channel proteins.	2.07066e-39
NZ_CP046333.1\|WP_011518427.1\|586642_587317_+\|histidine-phosphatase-family-protein	gnl\|CDD\|366010	pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1). The histidine phosphatase superfamily is so named because catalysis centers on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute different additional residues to the 'phosphate pocket' and, more surprisingly, differ in the position, in sequence and in three dimensions, of a catalytically essential acidic residue. The superfamily may be divided into two main branches. The larger branch 1 contains a wide variety of catalytic functions, the best known being fructose 2,6-bisphosphatase (found in a bifunctional protein with 2-phosphofructokinase) and cofactor-dependent phosphoglycerate mutase. The latter is an unusual example of a mutase activity in the superfamily: the vast majority of members appear to be phosphatases. The bacterial regulatory protein phosphatase SixA is also in branch 1 and has a minimal, and possible ancestral-like structure, lacking the large domain insertions that contribute to binding of small molecules in branch 1 members.	1.06418e-23
NZ_CP046333.1\|WP_011518433.1\|579130_580444_-\|DUF1254-domain-containing-protein	gnl\|CDD\|227659	COG5361, COG5361, Uncharacterized conserved protein [Function unknown].	2.20103e-52
NZ_CP046333.1\|WP_011518413.1\|603266_604646_+\|MmgE/PrpD-family-protein	gnl\|CDD\|377179	pfam03972, MmgE_PrpD, MmgE/PrpD family. This family includes 2-methylcitrate dehydratase EC:4.2.1.79 (PrpD) that is required for propionate catabolism. It catalyzes the third step of the 2-methylcitric acid cycle.	1.91556e-152
NZ_CP046333.1\|WP_035822869.1\|583694_584501_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	2.62949e-31
NZ_CP046333.1\|WP_029310285.1\|584665_585343_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	1.28057e-11
NZ_CP046333.1\|WP_011518414.1\|602088_603258_+\|acyl-CoA/acyl-ACP-dehydrogenase	gnl\|CDD\|224871	COG1960, CaiA, Acyl-CoA dehydrogenases [Lipid metabolism].	9.72873e-110
NZ_CP046333.1\|WP_024568962.1\|598804_599719_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187611	cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs. Beta oxidation of fatty acids in eukaryotes occurs by a four-reaction cycle, that may take place in mitochondria or in peroxisomes. (3R)-hydroxyacyl-CoA dehydrogenase is part of rat peroxisomal multifunctional MFE-2, it is a member of the NAD-dependent SDRs, but contains an additional small C-terminal domain that completes the active site pocket and participates in dimerization. The atypical, additional C-terminal extension allows for more extensive dimerization contact than other SDRs. MFE-2 catalyzes the second and third reactions of the peroxisomal beta oxidation cycle. Proteins in this subgroup have a typical catalytic triad, but have a His in place of the usual upstream Asn. This subgroup also contains members identified as 17-beta-hydroxysteroid dehydrogenases, including human peroxisomal 17-beta-hydroxysteroid dehydrogenase type 4 (17beta-HSD type 4, aka MFE-2, encoded by HSD17B4 gene) which is involved in fatty acid beta-oxidation and steroid metabolism. This subgroup also includes two SDR domains of the Neurospora crassa and Saccharomyces cerevisiae multifunctional beta-oxidation protein (MFP, aka Fox2). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	2.06905e-95
NZ_CP046333.1\|WP_011518431.1\|581500_583612_-\|acetate--CoA-ligase-family-protein	gnl\|CDD\|223972	COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion].	2.29661e-114
NZ_CP046333.1\|WP_011518416.1\|599855_600758_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176113	cd08421, PBP2_LTTR_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor. The genes controlled by the LTTRs have diverse functional roles including amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to a name a few. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.83746e-86

>NZ_CP046333.1|WP_049799794.1|588010_588292_-|hypothetical-protein
MFQNTFAQADAVIVHDAAIAAAIDAAMLRRRDEYAGQPMAWKVFCEASHVATLCEPLRMAFINRVASERGADIALRLKTKAEAIRAAAIAELV
>NZ_CP046333.1|WP_011518426.1|587344_587971_-|LysE-family-translocator
MPPFDTLLPFLGIAVLLSLAPGPDNIFVLLLSAMHGTRAGLTVVLGLCTGLLVHTAVVAVGLAALLAASTVAFTVLKIAGALYLVYLAWQAFRAPVGELSSSQMQVKTGKHMYLRGVIMNLTNPKVVIFFLAFLPQFVSPDRGPVAPQIMVLGFVFILATLLVFGSIAWFSGAFGRVLMRSARMQRAVNWFAGSVFLALAGRLALSQR
>NZ_CP046333.1|WP_011518427.1|586642_587317_+|histidine-phosphatase-family-protein
MATLFLVRHGQASFGAANYDCLSDTGRQQSRWLGEYFRDRGVQFRRVVAGTLVRQQDTASEILAGMGISDLPVASHPGLNEYDGESLYRSFTKGADHRAHQNGDYQDYWRTFRAAFAAWTQDQLTGMPETWGEFGQRMQAALAHATEGASREDALLVVSSGGAIGRAVADLLGAPTQTAIELNLQFRNTGFCELIVGRGTQRLLSFNNVPHLELPERRPAITFA
>NZ_CP046333.1|WP_011518428.1|585457_586456_+|tripartite-tricarboxylate-transporter-substrate-binding-protein
MKQTIPPRRRWVMRAACAAVALLPLATFAQGSYPSKPIRMVVPYPAGGLTDTVARQLAEGLGKRLGQPVVVENRGGAGGIIGTDFVAKSPADGYTLLMTIPGPITANIALYKKLPYDPRTELRPISDVAMARTVLTVNSAVPVKTVTELIAYAKKEPGKLRMGSWGPGTQPHTIQAYMDKTYGVDILHVPYRGEGPMVTDLLAGQVNLTIGSVTTLRQYIAVGKLRPLAVAGTTRAKALPDVPTFTEAGYSDAAYKIVGPTTLLAPAKTPDAIIERLGREVSALVKSPELSAKIDELGAEPIGNTPAEAERAYKAYLPVVLKLTADTGVTLD
>NZ_CP046333.1|WP_029310285.1|584665_585343_+|TetR/AcrR-family-transcriptional-regulator
MQSPITSAPSTSSPFPRVDTTSILQPPRQRRARETEQALLAAGRKLLAERDFAAVSVAQIAAACQVSVGAFYGRFRDKMAFFDALRTLVMEESDASVARYMAEHRWGEVPARQIVEKTMRFLVNGCHNNRGVIRASLKHSSTRPEEWLPHQKNGEEIVERLVALLTPRLPGPAEANEVRVRFAMQMVFGMLVNAVLNNPGPLRLDDERLSGEMTRMVACYLGLES
>NZ_CP046333.1|WP_035822869.1|583694_584501_-|helix-turn-helix-domain-containing-protein
MNTPVEQFIAERRREDPSFGGLLAKGFALLRCFIDDPRPLGNGELAQRLQLPRATVSRICRTLFELGYLDWEPKLDKYFVSAQVLALGYPYMAGLQVRHLARPLMQALANQIEGAVSMGVAYRLDVTYLESCTHMEGTPARPAIGAVRSVLTSAMGRAYLCTLSKTEFEKLMTTARAERPDEYAACYETLCHCIAHYPKRGFTLNEGDAGADVHGVGVYSRVVYMNRPLLFNCAIPGMRVKRGSMEKRVAPLLREMVRSIENMAGVGR
>NZ_CP046333.1|WP_011518431.1|581500_583612_-|acetate--CoA-ligase-family-protein
MQDLQPLLRPRSIAVIGASTQPEKVGGMPIRLLGELGYAGRVFPVNPGADTVQGLRAFPTVEAIGEPVDLAIVAVPALAAPDVMAQLGRAGTRAAVVFTSGFAEVANGSGLQHALATQAKTHGVQLLGPNCLGAMNLGERMFATFSPIPLTGVPPVGGVGLVSQSGAFGAYAFALAREAGLGLSHWVTTGNEAGLQVADVIEWLAHDPQTQVILAYIEGARDGMRLRQALAAARAAGKPVVIAKVGTTVAGASAAQSHTASLAGEDAVYQAVFDEYGVHRAHTLEAFFRLGYTLARGRRPARWHSPTGMAADAVAPVAIVTVSGGVGIMMADSAESQGLPRPPMPDAAAAALREAVPFASTSNPIDVTGQVVAQPKVLADALAGVARSGAYGSVAAFLAGGGNAPRVWSLLEQTVDDLASDPQAAPLMIAGVISDEKRAWLEARGCLVFREPAHTIEAVAALAKAAAMTESAQSPVAPAQLLSVPELPADAKALSEADAMALLLQAGVPVAPHGLARDADEAVRVAESIGYPVVVKLCSPDILHKSDVGGVVLNLSDADAVRAAFERVRRAAGTARFDGALVARMVRGWGEIMVGVRRDPVFGLVALAGIGGTAVEIFRQMSFGLAPVSRERARAMLTQSRAAALCAGHRGHPPLDLDAVADVIVNVSRAADAIGDRLDTLEINPFIVSADGLVAADAVITLR
>NZ_CP046333.1|WP_011518432.1|580471_581458_-|tripartite-tricarboxylate-transporter-substrate-binding-protein
MRSKLRRALLGMTLVLAGVCMTTGAVNAARVYPDRPIRLVVPFPAGGGTDVIGRMLAARLSNTLKTTVVVDNVVGATGTIGTAQVARAAPDGYTLVLGISATHAIAPSIFPKLPYDPLRDFVPIGRIAIGGNVLVANPSFPAHDLRALIAMAKQPNADLTYGSWGQGSGGHLAGESLNVSAGIHLRHIPYKGVAPMLTDVMGGTLPVAMSDLAGTLPLIRSGKVRALAVSGSERSVALPDVPTFAESGVRFRLDSWFALFAPSRTPAPIVEQLDRAMQEAMQDSGLQAQIASLGMRYAPVSRAQFTNQMREDTRTWAALVKSSGAALE
>NZ_CP046333.1|WP_011518433.1|579130_580444_-|DUF1254-domain-containing-protein
MNHPASPMFPAPVHTSPQEAMVAAAALPLVIYGYPLIETLRTCRLQTSVDAPTRYGRAPMNMLSASARQWTHEDRDIVTPANDLLYFCGWLNLADGPATIRVPALPDADRYYVIELLDAHTNNFANLGPRNVPKEGADIEIVGPGQRGSGGQTVESPTSLVWIIGRVLVTGADDLARAYAFEQGFQMVKSAGPAQPPSVAQWQESDDEAVDFFQNLYRAMRDFPPTQQELGLFTLLRKVGLRLEDDPDIGSMRPSIVNGLRSAYAQAMALIEAHTRSQGHKAWGYSLRLGTYGDDWLLRACTAMKGLGALRADEAVYAMADFDADGERLHGNQAYELRFPPGMLPPADAFWSVSLYGEDRFFTANELGRYAVGDRTPGLRKEPDGTLVIPIGHARPAEDANWLPAPSSHFYLILRLYHPSEAFRAGQYTIPAVRRVG
>NZ_CP046333.1|WP_011518434.1|577774_579091_-|DUF1254-domain-containing-protein
MTQQENTAQQRARDAVIHTLPLYEMARMRAATCPRRDHTGRFAGDGPESTLRWVNHVIRPRQLLGPQHRQVVTPNNDTLYTNAWIDLSRGPVVLEVPDFNGRYYVLGLLDFYTNPFGYIGSRTTGTSAGRFLLHGPDWLGTVPAGMRAVACPTNAVWMIGRLLVDGEADLPVVHALQDAIALRQLDGSLAAFAFDVAMQPEEHLGDARRFAEVVNRVVGENPPLGAEAAEIAAFAEVGIGHGIVPTPQQIDLLDAALRGVLADLAEPQPSDMGGGWAMSVDVRESFGSNYLQRALVARNYIGALGVQEAMYVMADRGGDGEPLDGRHAYRLDFAADNLPDVGAFWSLTMYDKGDCMLVPNDISRYSLGDRSPSLTRGADGSLSLYLSATPPRDEALRGNWLPAPPGPFYVALRLYVPQPSHLNRTYRYPAIQLLEVPA
>NZ_CP046333.1|WP_152560261.1|589224_591486_+|mechanosensitive-ion-channel
MAMFLAGAAQSAGLSLAAMTQKANAQPASAPPASAPLAQSLDQVINTLQNEGERQALVKQLQAVRTGLDASAAGAAGAASAAGASAPSPGLIGAVAQAIQEMDNAPHKNSGAMHYWKWRMEFAREELHDALTIKNTRKAIVSWTEFGTVFAGWAITGWLLRELARRLRQNRLRRPRDHQLPKIPSWIDVSLYFVRGIGPWIVAFGLTVLLAYQVFGRTPASVGAVLVAYAILAGAVMSAVCQVIFTLFQSAHRAHAVRDLITHSPILLFITGSLAALGEVNSDPRVIAALGLNLTALISTLSNILAAILIGVFAVRFRRAIGQLISFRPFAIRQEYPAMMDLLRLAGDAWYLPVLAVVAASVIGTIMATGHADEFLRRAVITVALFVTATLLTLVVGRSPKATVRAPRLRDRRRSAYVQRFGRFGAALIRVVIWITFLELNARIWQTSLIRIAQSTAAGRHITESLLGVVGVVLLAWLAWLLIDTAITQTLSPTHGRAAQPSLRAKTILPLVRNASFVSVLVVAMIAVLANLGVNVTPLLAGAGVVGLAIGFGAQTLVQDLITGLFIVVEDTIAIGDSIELPDHVGVVEAMTIRTVRLRDGKGAVHTLPYSQIKAVKNLSRGYAFAVFNISIAYQSDFERALELVRETGAEVARDHRYSRNLLSGLDILGLDRFDPTGQVVLAQFKTRPLTQYEITRAFNIRLKRNFDANGIRLAVPFVTVQVDGSGTEEEIATAAAAGAGADLVTRKAGKPA
>NZ_CP046333.1|WP_011518421.1|591860_593039_+|helix-turn-helix-transcriptional-regulator
MGEHPSTDDVFHRLVDCIYESAMDVAAMPAALDLFSRYTGTGSPSYLIWDKLAARARLGVTPHGCFTSAGSMPDNMRALPPHLTTTGATRACATMSVDGATAMLAEPEAAAATSIYDCSGLAQGIRLFDTSDVCVLMSATPASCDAFAHCQQRVAQVMPHWARAARMQHRNFELSGLASLGLASLDTLDFGVMVLQADMRVRYANSWAEALVQADTNLALDNGVLRARAESMQSVLAGLLESAVHGGRNGTVAGSWMHITSGGQPVPIIVMPLVSRQPVEGPWQLPMAMMLLGNSESRSVLDAGVLTSLFGLSRKESIIAIRLAAGETLTEIAEREFLSPHTVRVHIRDTLRKTGTHRQSELVRLLHLLPGVDLERAGVSSTARPRDTRRRH
>NZ_CP046333.1|WP_011518420.1|593060_594599_-|SpoVR-family-protein
MAYLSTGSEWTFELIQRYDREIARIAGDFGLDTYPNQIEIITAEQMLDAYASSGLPVGYNHWSYGKHFLASERGYQRGYMGLAYEIVINSNPCIAYLMEENTMPMQALTIAHACYGHNSFFKGNYLFRTWTNADAIIDYLLFAKNYVAECEQRYGEQEVELLLDSCHALQNYGVDRYKRPKKLSITEEQARQAERESYLQMQVNDLWRTLPKHRPHALRQEEEALELEAIFPPEPQENLLYFIEKNAPKLQPWQREIVRIVRKIAQYFYPQRQTKVMNEGWATFWHYTIIHQLYEEKLVNDAFMLELLQAHTNVIYQPPYHSQYYSGLNPYTLGFLMFQDIRRMCENPTEEDRRWAPEIAGSDWRQTLDFAMRNFKDESFLLQFLSPRVIRELKLFSVLDDDREGKLRVTAIHDDEGYREIRHLLANQYDLSNMEPNIQVTNVDIGGDRSLTLRHLQNDRRPLAQNFDEVVRHVTRLWGFTVRLEVAYEDGRRELKYECKPERRHQPQRRAA
>NZ_CP046333.1|WP_011518419.1|594636_595908_-|YeaH/YhbH-family-protein
MATVIDRRENGGNKSAVNQQRFIKRYREQIRQAVAKAVSGRKIMDIEQSGQVSIPVKDISEPIFHHGQGGRREWIHPGNKKFVRGDSFDRQQQGGGGGGSRASDSGEGEDDFVFTLSREDFLNFFFEDMALPDLAKRHLAKIAEVRKVRAGFSIDGTPSNLSILRTMRSSLGRRIALSSPYLKRLRELELEYNDEVEKDPYSEKAEALMERMRHLRAQVDRVPFIEKLDLRYNNRVLKKRPQAQAVMFCLMDVSGSMDESRKDLAKRFFMLLYLFLKRNYERIDVVFIRHHTVAKEVDEEDFFHSRESGGTVVSSALKLMVEVIHDRYPPSQWNIYCAQASDGDNWAGDSELCGRLLRESILPLVQYYAYVEVASEEPQNLWEEYLTVKGEFEHFAMQRIIGADEIYPVLHDLFQKRAAWPGR
>NZ_CP046333.1|WP_008647020.1|596004_597927_-|PrkA-family-serine-protein-kinase
MDIFGHYATRFEARKEEEYSIQEYLEICKKDPTAYATAAERMLSAIGQPELVDTHHDPRLSRLFFNKVIRVYPAFRDFYGMEDTIEQIVSFFKHAAQGLEERKQILYLLGPPGGGKSSLAEKLKALMEEIPIYALKGSPIHESPLGLFSADEDGKIMEEDYGIPVRYLNTIPSPWAVKRLNEFNGDITKFRVVKLRPSVLAQIAISKTEPGDENNQDISSLVGKVDIRKLEDFPQDDPDAYSYSGGLCLANRGLLEFVEMFKAPIKVLHPLLTATQEGNYKGTEGFGAIPFDGVILAHSNEAEWTTFKADKNNEAFLDRIYIVKVPYCLRVSDEVKIYDKLLRSSSLSAAPCSPNTLKMMAQFAVLTRIKEPENSNIFSKMRVYDGESLKDVDPKAKSYQEYRDYAGIDEGMNGLSTRFAFKVLSKVFNFDNTEVAANPVHLLYVLEQQIEREQFPPEQEAKLMSYIKEYLTTPYVEFIGKEIQTAYLESYSEYGQNIFDRYVVFADLWIQDQEYRDPNTGEILDRNALNDELEKVEKPAGISNPKDFRNEIVNFVLRARANNGGKNPVWTSYEKLRMVIEKRMFSTTEDLLPVISFNAKSSREDQDKHENFINRMVEKGYTPKQVRLLVEWYLRVRKSS
>NZ_CP046333.1|WP_024568962.1|598804_599719_-|SDR-family-NAD(P)-dependent-oxidoreductase
MSGMMEGKVVVVTGAGGGIGRGIALGMAAAGARVVVNDLGVSMSGEGGDAGPAQRVVEEIRAAGGQAVANTDSVSTWAGGNAIVQCALDTFGRIDAVVNNAGNLRDRMFFKMNEEEWRSVIDVHLHGTFFVSRAAANYFKDQESGAYVNMTSTSGLIGNLGQANYSAAKLGIAALSKSIALDMARFNVRSNCIAPFAWSRMTSSIPAETPAEKERVARLQKMEAGKIAPVAVFLASDAAKDVNAQIFAVRANEIMLMSQSRPVRSVHTGEGWTPETVAEIAMPAMRGSFFKLDRSPDVINWDPI
>NZ_CP046333.1|WP_011518416.1|599855_600758_+|LysR-family-transcriptional-regulator
MHYDLTDLRLFLNVGETENITRAAERSFLSLPAASARIKQLEEAFQTQLLIRQVKGVRLTPAGDALLRHAREVFRELECLHSDLRPYAKGVKGRVRLLANTTATNSFLAHALSRFLSENPDVDIELEEHLSADIVSAIGTGAADLGIVAGEVATADLDTMQLCSDELIVIAPVNHPLPAFKTLRFAELLDSCRFVGLNQSSAIQSFLDRIASGMGKRISLRIQVGSFDAVCRMVEAGAGIAIVPNSCARRYASRKVLRFIRLEDDWARRELQLVRRPGRELPQFAETLIQYLVDAAREPV
>NZ_CP046333.1|WP_152560190.1|600780_601806_-|tripartite-tricarboxylate-transporter-substrate-binding-protein-BugD
MTTFPQLPAIGTGKWRGMTWAALALAAVAVAVPGQGRANDAYPSKPIVMVVPFAAGGPTDVVARSVAAAMSKTLGQSVVVENRLGAGGTVSAAYVAKAAPDGYTILIHHNGMATAPALYSKLPYKPLTDFSFVGQVADVPMTLLGRHDLPPNNLPELVTYIQKNQNKVNLANAGLGAVSQLCGMLFQKAIGVDVQTIPYQGTAPAMTALLGGQVDVLCDQTTQTLTHIKADKVKLYGVTTAERIPALPNAPTLREGGLKGFEVKVWHGIYAPKGTPPAVINKLNGALRAALKDPAVAARMQDLGAVIVPEDKQTPEGLRTWLASEIDKWSPIIKAAGVKAD
>NZ_CP046333.1|WP_011518414.1|602088_603258_+|acyl-CoA/acyl-ACP-dehydrogenase
MHAAQDQDLIYPEIREAVRDLCKQFDSAYWQRIEEHSAFPEEFVQALTHAGWLSALIPEAYGGSGLPLTAASVIMEEINRNGGNSGACHGQMYVMGCLLRHGSEAQKQRWLPGIASGELRMQSMAVTEPTTGTDTTKLKTTAVRRGDKYVINGQKVWISRVQHSDLMLLLARTTPLDQVKKKSEGLSVFVVDLREAIGNGLTVQPIRNMVNHETNELFFDNLEIPAENLIGEEGKGLKYILDGLNAERILIAAECIGDGYWFVERASSYARERIVFDRPIGQNQGVQFPIARSFVNVEAASLMRYKAAQLFDAGKPCGKEANMAKLLAADASWEAANVCLQTHGGFGFAAEYDIERKFRETRLYQVAPISTNLILSFVAEHVLELPRSF
>NZ_CP046333.1|WP_011518413.1|603266_604646_+|MmgE/PrpD-family-protein
MSDIDTRYPTRQLCEFLARFTLADVPSPVVERTKDLFLDWIASAIAGKDAPAVRRIQEFAAAMGPATGQAEVFVDRRRTSPYFAALINGASSHVVEQDDVHNGSVLHPAAVVFPAVVAAAQAEGKTGAEVLLASIAGYEAGIRIGEFMGRSHYRVFHTTGTVGTLAAAAAVAKLYGLDAEGINQALGSAGTQAAGLWEFLRDAADSKQLHTAKAAADGLQSAWLARAGFTGARQILEGAQGMAAGMSSDANPAALTDGLGTRWATAETSFKFFASCRHTHPAADALKALMLREGLQADQIAAVTAHVHQGAIDVLGPVVNPATIHQAKFSMGTVLGLVAVHAHAGLGEFEQHSLKDAQVSAFRDKVTMELDEEINAAYPRQWIGRVTVRTTDGRTLQARVDVPKGDPDNTLSRPELEAKAIQLGAFRHGATEAEMRAIIARVWQLDREANVNDWLPAAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046333_1	1.1\|588742\|31\|NZ_CP046333\|CRISPRCasFinder	588742-588772	31	NC_007974	Cupriavidus metallidurans CH34 megaplasmid, complete sequence	458479-458509	0	1.0
NZ_CP046333_1	1.1\|588742\|31\|NZ_CP046333\|CRISPRCasFinder	588742-588772	31	NZ_CP046333	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3	588742-588772	0	1.0
NZ_CP046333_1	1.1\|588742\|31\|NZ_CP046333\|CRISPRCasFinder	588742-588772	31	NZ_CP029831	Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence	92699-92729	7	0.774
NZ_CP046333_1	1.1\|588742\|31\|NZ_CP046333\|CRISPRCasFinder	588742-588772	31	NZ_CP007517	Rubrobacter radiotolerans strain RSPS-4 plasmid 3, complete sequence	30464-30494	9	0.71

1. spacer 1.1|588742|31|NZ_CP046333|CRISPRCasFinder matches to NC_007974 (Cupriavidus metallidurans CH34 megaplasmid, complete sequence) position: , mismatch: 0, identity: 1.0

tgccggcacccgggtccccgcggactcgccg	CRISPR spacer
tgccggcacccgggtccccgcggactcgccg	Protospacer
*******************************

2. spacer 1.1|588742|31|NZ_CP046333|CRISPRCasFinder matches to NZ_CP046333 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed3) position: , mismatch: 0, identity: 1.0

tgccggcacccgggtccccgcggactcgccg	CRISPR spacer
tgccggcacccgggtccccgcggactcgccg	Protospacer
*******************************

3. spacer 1.1|588742|31|NZ_CP046333|CRISPRCasFinder matches to NZ_CP029831 (Azospirillum ramasamyi strain M2T2B2 plasmid unnamed7, complete sequence) position: , mismatch: 7, identity: 0.774

tgccggcacccgggtccccgcggactcgccg	CRISPR spacer
ggccggcaccccggtcccggcggaccgggcc	Protospacer
 ********** ****** ******. * *

4. spacer 1.1|588742|31|NZ_CP046333|CRISPRCasFinder matches to NZ_CP007517 (Rubrobacter radiotolerans strain RSPS-4 plasmid 3, complete sequence) position: , mismatch: 9, identity: 0.71

tgccggcacccgggtccccgcggactcgccg	CRISPR spacer
caccggcacccgggtgcccgcgaacaccagc	Protospacer
..************* ******.** *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1384930 : 1424682

Shigella_phage(50.0%)

integrase,transposase

attL 1418404:1418418|attR 1427436:1427450

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960507.1\|1384930_1386072_-\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.6e-89	60.6
WP_082219905.1\|1386109_1386907_+	zinc-binding dehydrogenase	NA	NA	NA	NA
WP_152560236.1\|1387058_1388069_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011519898.1\|1388143_1388491_-	NIPSNAP family protein	NA	NA	NA	NA
WP_011519897.1\|1388487_1390191_-	FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_011519896.1\|1390205_1391171_-	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011519894.1\|1391539_1392718_+	4-hydroxybenzoate 3-monooxygenase	NA	NA	NA	NA
WP_080710363.1\|1393775_1394066_-	4-hydroxybenzoate transporter	NA	NA	NA	NA
WP_011519889.1\|1394813_1396610_+	AAA family ATPase	NA	NA	NA	NA
WP_011519888.1\|1396602_1398378_+	ATP-dependent helicase	A7KV33	Bacillus_phage	3.5e-30	22.3
WP_029309992.1\|1400089_1400428_-	hypothetical protein	NA	NA	NA	NA
WP_152560237.1\|1400583_1401462_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	E5G6L8	Salmonella_phage	3.5e-47	39.6
WP_124682078.1\|1402141_1402687_+\|transposase	transposase	NA	NA	NA	NA
WP_008651549.1\|1402798_1404238_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_008651548.1\|1404234_1405068_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|1405064_1405337_+	hypothetical protein	NA	NA	NA	NA
WP_011519879.1\|1407464_1408448_+	tripartite tricarboxylate transporter substrate binding protein	NA	NA	NA	NA
WP_011519878.1\|1408458_1409628_+	mandelate racemase	NA	NA	NA	NA
WP_011519877.1\|1409633_1410476_+	fumarate hydratase	NA	NA	NA	NA
WP_011519876.1\|1410489_1411053_+	hydrolyase	NA	NA	NA	NA
WP_011519875.1\|1411165_1411894_+	GntR family transcriptional regulator	NA	NA	NA	NA
WP_011519873.1\|1412983_1413673_+	hypothetical protein	NA	NA	NA	NA
WP_152560197.1\|1414281_1415373_+	hypothetical protein	NA	NA	NA	NA
WP_152560198.1\|1415475_1415784_+	hypothetical protein	NA	NA	NA	NA
WP_011519869.1\|1415923_1416415_+	hypothetical protein	NA	NA	NA	NA
WP_152560199.1\|1417414_1417762_+	hypothetical protein	NA	NA	NA	NA
WP_152560200.1\|1417997_1418468_-	hypothetical protein	NA	NA	NA	NA
1418404:1418418	attL	NA	NA	NA	NA
WP_049799813.1\|1418693_1419251_+	hypothetical protein	NA	NA	NA	NA
WP_152560201.1\|1419650_1420553_+\|transposase	transposase	NA	NA	NA	NA
WP_011519860.1\|1420552_1422730_+\|integrase,transposase	DDE-type integrase/transposase/recombinase	NA	NA	NA	NA
WP_029309851.1\|1422713_1423517_+	ATP-binding protein	NA	NA	NA	NA
WP_085960507.1\|1423541_1424682_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.6e-89	60.6
1427436:1427450	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046331

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046331_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046331_1

2984554-2984711

Orphan

Consensus_repeat	Method
GCCGCCCTTAGCTCAGTTGGATAGAGCACTCGCCTTCTAAGCGAGCGGTCA	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046331_1

>merge|NZ_CP046331|1|2984554-2984711|CRISPRCasFinder
GCCGCCCTTAGCTCAGTTGGATAGAGCACTCGCCTTCTAAGCGAGCGGTCAGAGGTTCTTATAGCGGGTCGCCGTAGTTGCGTATTGTAAAATTGGTTTTTCTTCAGGCCGCCCTTAGCTCAGCTGGATAGAGCACTCGCCTTCTAAGCGAGCGGTCA

>NZ_CP046331|1|1|2984554-2984711|CRISPRCasFinder
GCCGCCCTTAGCTCAGTTGGATAGAGCACTCGCCTTCTAAGCGAGCGGTCA	GAGGTTCTTATAGCGGGTCGCCGTAGTTGCGTATTGTAAAATTGGTTTTTCTTCAG
GCCGCCCTTAGCTCAGCTGGATAGAGCACTCGCCTTCTAAGCGAGCGGTCA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046331.1\|WP_152560249.1\|2991974_2992721_-\|TatD-family-deoxyribonuclease	unknown	unknown	gnl\|CDD\|223162
NZ_CP046331.1\|WP_011516885.1\|2981062_2981539_-\|histidine-phosphatase-family-protein	unknown	unknown	gnl\|CDD\|224973
NZ_CP046331.1\|WP_011516882.1\|2983229_2984480_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP046331.1\|WP_011516879.1\|2989667_2990336_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046331.1\|WP_011516886.1\|2979964_2980816_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|225717
NZ_CP046331.1\|WP_080710372.1\|2976078_2978199_-\|polyphosphate-kinase-1	unknown	unknown	gnl\|CDD\|235469
NZ_CP046331.1\|WP_011516878.1\|2990625_2991273_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046331.1\|WP_011516874.1\|2993976_2994849_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046331.1\|WP_011516871.1\|2999587_3000907_+\|DUF4365-domain-containing-protein	unknown	unknown	gnl\|CDD\|379535
NZ_CP046331.1\|WP_008641662.1\|2973806_2974514_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	unknown	unknown	gnl\|CDD\|131209
NZ_CP046331.1\|WP_008641661.1\|2973065_2973770_+\|phosphate-signaling-complex-protein-PhoU	unknown	unknown	gnl\|CDD\|182974
NZ_CP046331.1\|WP_008641674.1\|2981701_2981923_-\|translation-initiation-factor-IF-1	unknown	unknown	gnl\|CDD\|237102
NZ_CP046331.1\|WP_008641660.1\|2972206_2972995_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	unknown	unknown	gnl\|CDD\|182692
NZ_CP046331.1\|WP_029310051.1\|2986287_2989668_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046331.1\|WP_011516887.1\|2978309_2979842_+\|exopolyphosphatase	unknown	unknown	gnl\|CDD\|223326
NZ_CP046331.1\|WP_011516873.1\|2994848_2996717_-\|KAP-P-loop-containing-nucleoside-triphosphate-hydrolase	unknown	unknown	gnl\|CDD\|227265
NZ_CP046331.1\|WP_011516881.1\|2984889_2986284_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271175
NZ_CP046331.1\|WP_011516889.1\|2974637_2975990_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	unknown	unknown	gnl\|CDD\|274368
NZ_CP046331.1\|WP_011516872.1\|2996833_2998966_-\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|238045
NZ_CP046331.1\|WP_011516875.1\|2992720_2993980_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|223676

Protein	Function_ID	Function_description	E-value
NZ_CP046331.1\|WP_152560249.1\|2991974_2992721_-\|TatD-family-deoxyribonuclease	gnl\|CDD\|223162	COG0084, TatD, Mg-dependent DNase [DNA replication, recombination, and repair].	9.0147e-46
NZ_CP046331.1\|WP_011516885.1\|2981062_2981539_-\|histidine-phosphatase-family-protein	gnl\|CDD\|224973	COG2062, SixA, Phosphohistidine phosphatase SixA [Signal transduction mechanisms].	2.30775e-39
NZ_CP046331.1\|WP_011516882.1\|2983229_2984480_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	7.36966e-53
NZ_CP046331.1\|WP_011516886.1\|2979964_2980816_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|225717	COG3176, COG3176, Putative hemolysin [General function prediction only].	1.35126e-77
NZ_CP046331.1\|WP_080710372.1\|2976078_2978199_-\|polyphosphate-kinase-1	gnl\|CDD\|235469	PRK05443, PRK05443, polyphosphate kinase; Provisional.	0
NZ_CP046331.1\|WP_011516873.1\|2994848_2996717_-\|KAP-P-loop-containing-nucleoside-triphosphate-hydrolase	gnl\|CDD\|227265	COG4928, COG4928, Predicted P-loop ATPase [General function prediction only].	8.8714e-60
NZ_CP046331.1\|WP_011516871.1\|2999587_3000907_+\|DUF4365-domain-containing-protein	gnl\|CDD\|379535	pfam14280, DUF4365, Domain of unknown function (DUF4365). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria, eukaryotes and viruses. Proteins in this family are typically between 182 and 530 amino acids in length. There is a single completely conserved residue D that may be functionally important.	5.91008e-29
NZ_CP046331.1\|WP_008641662.1\|2973806_2974514_+\|phosphate-regulon-transcriptional-regulatory-protein-PhoB	gnl\|CDD\|131209	TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB. PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems].	1.54192e-128
NZ_CP046331.1\|WP_008641661.1\|2973065_2973770_+\|phosphate-signaling-complex-protein-PhoU	gnl\|CDD\|182974	PRK11115, PRK11115, phosphate signaling complex protein PhoU.	8.5852e-85
NZ_CP046331.1\|WP_008641674.1\|2981701_2981923_-\|translation-initiation-factor-IF-1	gnl\|CDD\|237102	PRK12442, PRK12442, translation initiation factor IF-1; Reviewed.	3.4546e-48
NZ_CP046331.1\|WP_008641660.1\|2972206_2972995_+\|phosphate-ABC-transporter-ATP-binding-protein-PstB	gnl\|CDD\|182692	PRK10744, pstB, phosphate ABC transporter ATP-binding protein PstB.	0
NZ_CP046331.1\|WP_011516872.1\|2996833_2998966_-\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	9.08199e-08
NZ_CP046331.1\|WP_011516887.1\|2978309_2979842_+\|exopolyphosphatase	gnl\|CDD\|223326	COG0248, GppA, Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism].	1.03266e-162
NZ_CP046331.1\|WP_011516881.1\|2984889_2986284_+\|site-specific-integrase	gnl\|CDD\|271175	cd00397, DNA_BRE_C, DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine based site-specific recombinases (integrases) that share the same fold in their catalytic domain containing conserved active site residues. The best-studied members of this diverse superfamily include Human topoisomerase I, the bacteriophage lambda integrase, the bacteriophage P1 Cre recombinase, the yeast Flp recombinase, and the bacterial XerD/C recombinases. Their overall reaction mechanism is essentially identical and involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA. The enzymes differ in that topoisomerases cleave and then rejoin the same 5' and 3' termini, whereas a site-specific recombinase transfers a 5' hydroxyl generated by recombinase cleavage to a new 3' phosphate partner located in a different duplex region. Many DNA breaking-rejoining enzymes also have N-terminal domains, which show little sequence or structure similarity.	2.64884e-14
NZ_CP046331.1\|WP_011516889.1\|2974637_2975990_+\|phosphate-regulon-sensor-histidine-kinase-PhoR	gnl\|CDD\|274368	TIGR02966, Phosphate_regulon_sensor_protein_PhoR, phosphate regulon sensor kinase PhoR. Members of this protein family are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter in most Proteobacteria. Related proteins from Gram-positive organisms are not included in this model. The phoR gene usually is adjacent to the response regulator phoB gene (TIGR02154). [Signal transduction, Two-component systems].	2.20217e-175
NZ_CP046331.1\|WP_011516875.1\|2992720_2993980_-\|hypothetical-protein	gnl\|CDD\|223676	COG0603, COG0603, Predicted PP-loop superfamily ATPase [General function prediction only].	0.000253287

>NZ_CP046331.1|WP_011516882.1|2983229_2984480_+|GGDEF-domain-containing-protein
MFQSQVVVLIAGLIALQMAIVCAVLRRSAGMERSGLTSWALGDLLVTLAVVLQAAHAYRPEWPLAVLPEFALTAGLSMMVYGTRHFAGKRGRGVVLGVLNLPGLAALTIYAVGGLAEMGLGRVPTGTLAWLGLATASIQTLLLLEIARITVALVPLKRGTGRLAALSLSVLSLGCAVLAGAEAWPMFAALMDGHVQPLVDRHESMTVWFVFGVMGLAVSFALMAHDRLRQIIERRARHDDLTDVLSRGAFWEELELACKQAERSRKPLTVAFMDLDHFKAINDLYGHLAGDSVLRHFAGLLRKVAAPDSVIGRLGGEEFAIVMPATGLETGRAISVRLSALVRATPCPSEPDPIAYTVSIGMAEWQLGENADAVMRRSDRALYDAKQMGRNCVSSHDAEEFTGMPRRPRVREREPS
>NZ_CP046331.1|WP_008641674.1|2981701_2981923_-|translation-initiation-factor-IF-1
MAKEELIEFGGVVSEALPDNRYRVTLENGVEIWAYASGKMQKHRIRILAGDRVTLEMSPYDLTKGRINFRHKS
>NZ_CP046331.1|WP_011516885.1|2981062_2981539_-|histidine-phosphatase-family-protein
MNLILWRHAEAEDLPDVLSISRSADLQRPLTRRGRKQAESSAAWLRARLPADYRVVCSPALRTRETAAALTGKAEILDELAPGADVGAVLAAIDWPQGHEYTVVVGHQPWIGQLASLLLAGQEINWSVKKSGIWWLTARTRESEAQVVLRAVIPPDLL
>NZ_CP046331.1|WP_011516886.1|2979964_2980816_-|GNAT-family-N-acetyltransferase
MRDLPTPTQPLFDSLPTGLTGQSARRRLPRQPAQRQTEAQVATPAFSVAWARHQDEVAEAQRLRYKVFAEEMGARLQSSATETDVDMFDAYCDHLIVRDQETLRVVGTYRVLPPHQAKRIGCLYAESEFDLVRLSHLRPKMLELGRSCVHRDYRSGSVIMALWGGLGEYLQRYNLETMLGCASVPMSDGGHYAASLYRLFAEKSLAPIEYHAFPRVPLPVEDLNQTLDVEPPALIKGYLRLGAKICGLPAWDPDFNVADFLTLLRVRDMNPRYARHFLGLNRD
>NZ_CP046331.1|WP_011516887.1|2978309_2979842_+|exopolyphosphatase
MTQTPRLLAAVDMGSNSFRLMIGRVDETPTASGPASQIFQVDALREPVRLAAGLTPDKYLDQPARRRGIEALRRFGDRLRDFSPDQVRAVATNTLRVAKNASEFLIEAEAALGFPIEVIAGREEARLIYLGASHDAPACQGNRLVVDIGGGSTEFIIGSGYQSKLMESLYIGCVSHSRQFFPSGNVDEYAMKQAELAARREIQVLVRQYRAAGWQQAVGSSGTARALAELIELNGMNDSASEHGITREGLERLKRALVKAENANRVKLAGLKADRIPVLPGGLSIMLGVFAELDLDRMDVTDGALRLGVLYDLLGRSHHEDMRTVTVDQFMRRYGVDRAQAGRVGVAARDLLSQFPDPPNERRSDNLALLGWAASLHEIGMTISHSGYHKHSAYIATHADMPGFSKTDQARLATLLLGHASKLSKLSGSGKFLDWRMLFSLRLAFVLCRRRADVKLPEIQVGQRSDELDEGFEVRLPKSWIDMNPLVEYSLAQEADEWERIGKRYKVVYV
>NZ_CP046331.1|WP_080710372.1|2976078_2978199_-|polyphosphate-kinase-1
MKKSPHRQNKVIDMSTTPPGTLLNRELGILEFNARVLAQAADPNVPLLERLKFICIVSSNLDEFFEIRMAGLKEQMRENASGLTPDGLSFLQTYQLVTERTQRLVASQYDMLQNVIFPALEQEGVFFHLTSTWTEQQRAWARDFFVRELGPVLTPIALDPAHPFPRVLNKSLNFVIELSGKDAFGRDADLAIVQAPRALPRVVRMPEQLSGYPYGFVMLSSFMQAFVHELFPAIEVEGCYQFRVTRNSDLFVSEDDITDLREALQGELPTRHFGDMVRLEVSSDTPPALTRRLLLESGLTEQDLYRVSGPVNLARLMQIPDMVDRPTLKYPPHVPAAVKALPAGSNMFDVIRQRDVLLHHPYESFSSVLDLLQLAANDPNVVAIKQTVYRTGNESAVMEALMTAARNGKEVTVVVELLARFDEETNINWAERLESVGAHVVYGVVGHKCHAKMLLIVRREPATPKAKHFMLRRYVHLGTGNYHPRTARLYTDFGLLTAEEKICEDAHHVFQLLTGTAGTIRLNHLWQSPFTMHSNLVEHIRAEARNARAGKRARIIAKMNALLEPTIIEELYKASRSGVKIDLIVRGVCALRPGVPGMSENISVRSIVGRFLEHHRVYYFHAGGDDVLYLSSADWMDRNLFRRVEVAFPILDRTLKARVIKEGLQVHLRDNASAWIMQSDGEYVRKPSRAKEQRVSQVELLARFGT
>NZ_CP046331.1|WP_011516889.1|2974637_2975990_+|phosphate-regulon-sensor-histidine-kinase-PhoR
MNVIWARSVAILVSLTVVATGLYVFAGPVSGLLFLCIALFLLLGYYLFQINRLWKVLDAPAYGEIPSALGLWGEVYYRLHRLVKRWRTQVLQVEQQHTRFIQAIQASPYGVLMLDDADQIEWCNDVAEQHFGLNAKRDVRQRITHLIRRPEFVHYLTRERYDEPLIMRDMGEHKRSSTSVQILPYGENRKLVLTQDITKVENTEAMRRDFVANVSHELKTPLTVLTGFLETVRDLPVSEEDRKRYIDMMLVQSMRMQHIVEDLLALAKLESDVQPPTLDPVDVGGLAAHLVHDAEALSQGRHDIHAEIDTAVVLRGSEGELLSALGNLVSNAVRYTPDGGRIAIRMTYTDGHSVFSVSDTGLGIAPEHIPRLTERFYRVDRSRSRDTGGTGLGLAIVKHVLSRHHADLRVTSEVGRGSTFRIVFPVDRSGYEPESAQPMPQLGDAPRHAA
>NZ_CP046331.1|WP_008641662.1|2973806_2974514_+|phosphate-regulon-transcriptional-regulatory-protein-PhoB
MPSSILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLMSDVLPDLVLLDWMLPGKSGATFAKELRNNDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVLRRRAPQLTDDVVAINGLRLDPATHRVTGQDDGGPIKLDLGPTEFRLLHFLMTHPERVHSRSQLLDQVWGDHVFVEERTVDVHIKRLRAALTPGGYSNMIETVRGSGYRLARSPSH
>NZ_CP046331.1|WP_008641661.1|2973065_2973770_+|phosphate-signaling-complex-protein-PhoU
MTDKHLSTQFDADLNAINTKLLQMGGLVESQIELAMRALADFDGDLADQVITREQQLNALEVEIDADCGNIIARRQPTARDLRLVMAISKTITNLERAGDEAEKIAKRTKHIMEDAAAHTINYAEVKLSGEMAITLLRQALDAFARLDTVAAARIVKDDKAIDEEFRAFVRKLITYMMEDPRTISVALDFLFIAKAVERIGDHAKNIAEFIIYIVKGTDVRHASREDMEREALS
>NZ_CP046331.1|WP_008641660.1|2972206_2972995_+|phosphate-ABC-transporter-ATP-binding-protein-PstB
MTSTVIDIPDTVRAKIDVRNLNFYYNQFHALKNINMSIPDRKVTAFIGPSGCGKSTLLRTFNKMYALYPEQRAEGEISMDGENLLTSKQDISLLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEKLSRSEMDDRVEWALSKAALWNEAKDKLHQSGYGLSGGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELIAELKDEYTVVIVTHNMQQAARCSDYTAYMYLGELIEFGETEKIFIKPHRKETEDYITGRFG
>NZ_CP046331.1|WP_011516881.1|2984889_2986284_+|site-specific-integrase
MYKHVSLRRRQLSGRTSWLLLGPDGRPIDAFTAFAESLRNAPANTRDSYCRHLAEFFDYLIEAAALIGQGRQLTKLELTETLEAYGDYLLLGIDASRPIAQAVASSLPPGVNQASSVVPKKAALRRFLKLSEDVRKEMAELARLYDSRGVIADTPLLPELGQKRPLQLGEVRAMQAHSMIAGVVAGGPKFVECVVLGDGAADAPYDEQRAFPYDKVMDLIDAMPTYRDKAFYALLAASGCRTHEALQVLLNDDIDVDEGTVRLVDPKSRSGHSSYRSLTPSQRELLAWKGRTSDLTLLIEPFATSFFDSLQGYLEQEHLAHGKHGFLFQYLKGLERGQPYFLSAPGTRLELFHRVQKHIGVMLPPGTGPHSLRHMYGTYVLNYFPRANGDYGLPVPMVQQLLGHADINSTLKYAKFDKDLFKLEVQNANRVLFSHGTPKKLMELKLEALRAQMAKVQSQLSQRP
>NZ_CP046331.1|WP_029310051.1|2986287_2989668_+|hypothetical-protein
MVNLTPDSIVFNRIDEALNADIRAALQLAADTSLSIHGLEQVDLEAVTTKKHLQAVFAKFVRLRVFADTKRVFGQAYANEALDAYRQKTGHLTKAHFTALMFPDESGSLAFKSSYANSIRPGVGLFLVALHCSGAITLPASFSWPSVRGEKPDGGSGRRREVGMLVSSELLGLIRRLNSQSESLPHSAFEAVGGDRKRREWFLTYGTKLLLATGWHRAEDVNIEDLLAIKAAEQVISPKDTLPLAYKPLLDVFKLAFGDRVRVTAEDWSSALRIQIGRRARGTGGVGDRTFQQPRSDYDLVQELLHVEPSWGRPERIRTLMRLPGLDVDIKVISDLWLNLEELYVQKTARESYKQIQGIIGWWNIYLFYYLPYWFARNPNTILSYPSSPSLLLKSVFVSRLLPVAEETPLTFLEFMDSHRERRGWKNNGYYGSLLQLQGFFEFIERYSDEIPGCEGFTQPLAPHDFPLTSRTKATRKQPVPRRFFGVYLDYHEAILAHHNVVTSRVLSGELGTERLESLAQNGWVIDTYASAQDVGFVPILFTRSKTIPLQFIPNVLALGWRKLKDGRMVFLPHPHALHQNLVALHTGVRHNHIQWLDGERFDSLVDEEEAEFALLFVNTDKQKKEPWTPHVSMRVIELLRAQRNWAEQIGEDGFHVSHFYNDNPSTKWPKFKPLFAYTKDGKPHGDGKYSDVWKSMLCGLQGLMPELSEYGRMRQLLTLLPPGHKVGEPELKKKLVDFGARFGAGESCPLNVMTAISPHSARVAVVSQYITFLPTDLIGKHITGQKPGVVSYYVHLDRETVEAEQVHQAARLREAALRNAFEPVLSGQHASPAFIHADSVNSNLAQSMRENLDETLVSYGCISISFGERSVRGVDVLRETRGANAAANKTEICPYGNDCPPEVVKDLRGIRRCGLCHYAVRNVDHLPAVIAKKRQVAEMVDELENLLSTDAKTLNAKYTPEELDRLEEERARLCEELTGWILNEELLELTRQRIALGQVTRTWIVQKPEIIERDLQRVIAPTSLTEYLLARLGECLAYPTLESPQIRARFDLLRRELLARAGNLRAAFASDMPVDPVSECAGLLKSVIASTGLDAAQLAEMLDQDKHMSHLPRTPLRLLGQDEEA
>NZ_CP046331.1|WP_011516879.1|2989667_2990336_+|hypothetical-protein
MKKPSSFAAWQEANQVRREAIIEDYLQYLGKTRVRVRNPTDLADLVARHIAQVEDGPCNKSTLMRNFRYKAKILTYQAEHSESGSRSLRPRGVTDPSTNALVTIAKLEAGNLKREVGRLNIYINSLEEQLEQYQQQGRQRLSELVAHKAESGAHRISDYEFKFVRTCQALRALVSHMNLVLEVDTKAQRILDRSKRRNNVIVDNEIAGPFIEWLASVSEEVK
>NZ_CP046331.1|WP_011516878.1|2990625_2991273_+|hypothetical-protein
MPFEGKHSGVGFIDCGPDEVMPLLQPISSVCAGFATTMLTAGGAYRGSICTPNQEGVCDATLLLVFVPLDWDMSPNRVDKSIDLTLDDFAAQVEEAELLSSQYLDLVSKYGAHLHVGQRLSGELPATSLALLFGVHISANAGQQMAERFRPFMTGPACSWAAEGEHRRLVRDGVLDDRHPTANQFASAIGCLPRSGMAKAKESSSIVSFEKFQNR
>NZ_CP046331.1|WP_152560249.1|2991974_2992721_-|TatD-family-deoxyribonuclease
MDFHCHLDLYPSARTVHTEAARRCEFVWLVTTSPRAFIATSRILQPAPTIIISPGLHPEVAHQRHNELPLLLEEIGRASAVGEVGLDGSARYREHFSVQKAIFEATVERCSELGGRVLSIHSRSAAKEVLDTLERHSAHGTAVLHWFSDSPTQLRRAIELGCWFSIGPAMLRSANGLRLAASLPSERVVPESDGPFAKLDSRPIMPWQAMDIVGPLANVWGLTEDKVRAQLTENGRELRHMMTAENSQ
>NZ_CP046331.1|WP_011516875.1|2992720_2993980_-|hypothetical-protein
MKVICTSFDARPRAISAGTRAFTFFQSSDVAGSERIANGWLQELERAGYAPSIPIWDFVLFGFAVCAADLAVPRNKSADGWTRELELSVTVVDPTPWNAQRPLVEGMLRILTGDFWSVTFLSDGPQPPRGQRRICDRDCVALLSGGLDSLIGGIDAVAKMRRPIFVSQLAYEDSERQRQYAAALGGAAWHQQWSHRIDPAAPREPSTRARSMGFYALAVLATSLLTTTGPAEILVPENGFISVNPPLLPGRMASLSTRTTHPLFMKQLQGLLKAVGIPANLSMPYRFKTKGEMMMECLDQKLLAHFASDSTSCGRYRTYNRTHCGRCVPCMVRRAAFLRWGQADDTRYKFPNLRLSEKSAADDPMAVACAVLATEANGIDAFLGATLSFATQNERVHYRDVAERALLELSTLLKQDGVL
>NZ_CP046331.1|WP_011516874.1|2993976_2994849_-|hypothetical-protein
MGTSTSSAGAPGGSPFDPPWLTDVEQGIDTSQSDAPLAPVPPAPQPDGGADDTETGADADAVQTVGPNIAPPGRYGEARRALSSFVKGGGSADLRKGINRLVNKGMGGSKRAASRMQSTVTAAAALGGLLSAARAGGDPGIDAWVASVKQRGLSATDIALEVAERLLPNGGSIDEESAKHAMDQAIIKLYDTDPNADIFNLTDDQIADVMTYTIAYDVYNRVQLELGRVFEKLKYSAKVVHERLGQVLDYVTGVVADAMKGAREGKKPRSMREVSAKAMDDAMFVFGTAE
>NZ_CP046331.1|WP_011516873.1|2994848_2996717_-|KAP-P-loop-containing-nucleoside-triphosphate-hydrolase
MWHDNETTVDYVNFKLVAKVCADLIRNSGGDPISIGVSGGWGTGKSSLVRMIEAELISARKSTASSRDNSEPYVVVTFNPWLYQGFEDARTALLQTVGDAVLKQAEGSQTLTDKAKAFVKRINLLRLAQLGGEVAATLVTGVPVGLLSKAFDLGIGAFQKGSASEVVDAMKGVPEATKGLIDDAKPRSLPKEIQGFRDDLEELLSELGVTLVVFVDDLDRCLPKTAIATLEAIRLLLFLKGSAFVVAADDVFIRGAVRVHFTGTGLADDVVTNYFDKLIQVPLRVPRLGPNETKAYAALLFLERAHREKSIDDTHFELAKKRVEERLRETWKGKRVDLSFLESLAPQADAELQSLMGLAERLSPLLLNARAVQSNPRLVKRFLNTVFLRQAMAKPQGIEVDLPVLAKWHLLERCEEGLANALAELVSADSDGKVAAIRQGEEAAKDADRALPEVFGEKPFAREWLHLQPSLADIDLRPVLHLSRDGTVRDFGHDALTSEGKVLQEALVATRTKSKQLADDIRAAGETQAILAMTRAWEARRASRDWSKSEEVLMLTEVCEVFPAAGPRAAAQLVEAPVTQISPGLVQRLVSAPWARELVNRWEADSQTSEAVKRAIRAARKT
>NZ_CP046331.1|WP_011516872.1|2996833_2998966_-|helix-turn-helix-domain-containing-protein
MSTQTPMAIGHYLTQLREHAGLKQAELARKVTWSPAVLSRVESGERELNPEELGEVLRAIGTDDALKLGERLQRSWEVLVAPPLTHPEQDLLWEAELASKQLRALSAADDVSAAFQRRIDEYLEELQYLASLVLKRDHTVAFIGSIGIGKSTAICRMTGLEVADDGAPVQPVLEAGAGGITVCEVHLYTGPQYGIVVEPCSDEEIRQHTTDFVEHISRTGNPASNDDAEPLENEGQGISREIERAIRNMSGLRVRKEKVDGKTTRRDDAKQLALSHASARELLVEVLARMELHKRDARHIWYDASTGKPPLVWLKETFEAINNGRLPEFTLPKRIEVVAPVGLLKGVDLSVRLVDTKGIDRTAARADLEVHLEDPHTLAVLCSGFNNAPGAEARLLLNRARDAGIRNLGLNAAIVALPRPEEALAVKDDAGDRVETVEEGYELKGDQVATALEPLGLAELPVGFFNAREDAPSKLQEFVAFQLRRIRDDFAKRLAQATANVQEVIQNREEEQNQAIIREAAAQLKHWLTQNTDSPPLKQQIHASLINELAKAHASTVHAAVRRGGDWPNLNYSHQLGHGARVLATGSLGRKIKDFHAIAENLRTNPEYAKAVSLIGQAESVLLVAFDGVLTRMRLLGETLFEDEMRRDAMFWRDCENEWGQGKGYRERVAERSKQWFDDERKDELNQAIQSLLSTEWGESVARVSALLEA
>NZ_CP046331.1|WP_011516871.1|2999587_3000907_+|DUF4365-domain-containing-protein
MSEKKLTDSQLLGTQGTGLIELTVSRMGLVWRPTAQHDAGIDGEIEIRDAANGRMTGMLLKVQSKAVSEFKNETNAGFDYWPDSRDMDYWLGHSVPVILIVSRPSTNECYWQVIKPPTEGGEKRLRFVKARDVLNESSKARLIEVAQAASPRGVAPALVRRETLVSNLLPVTKLPERLYLAETPYRTAKDLGAALREANLRLEFILKNERILTVRDLTEPRYHNLCDRGTVEDFGIKEWAASPDPDRQRDFVSLMNSCLREKLRSMPEALRFDKAMRCFFFPPSESNTPYDYAYRGDKKSTAREVFKELRNKQKKHLMGYRHSAMKAQFYRFGSDWYLEVTPTYFFTRNGTEQSKWHEDWLKGIKELEKNGAIRGQLMMWADLLRNPPGLFDEGYPFLDFGVPVTFGIDRGIDDSAWASSDNIDKQQGETSSAPLFELG

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 1790

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516085.1\|743_1790_+	4-hydroxy-2-oxovalerate aldolase	E5EQ69	Micromonas_sp._RCC1109_virus	3.0e-45	34.4

DBSCAN-SWA_2

8326 : 51335

Escherichia_phage(22.22%)

integrase,transposase

attL 18369:18384|attR 42676:42691

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960479.1\|8326_9144_-\|transposase	IS5-like element ISRme6 family transposase	NA	NA	NA	NA
WP_011516074.1\|9313_10375_+	alcohol dehydrogenase catalytic domain-containing protein	NA	NA	NA	NA
WP_049799775.1\|10519_11848_+	aromatic hydrocarbon degradation protein	NA	NA	NA	NA
WP_011516071.1\|12583_13414_+	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_011516070.1\|13586_15431_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_080710382.1\|15524_15956_-\|transposase	transposase	NA	NA	NA	NA
WP_011516068.1\|16819_17785_-\|transposase	IS481-like element ISRme14 family transposase	NA	NA	NA	NA
18369:18384	attL	NA	NA	NA	NA
WP_029310277.1\|18612_18972_-	hypothetical protein	NA	NA	NA	NA
WP_011516065.1\|19146_20241_+	hydrogenase small subunit	NA	NA	NA	NA
WP_011516064.1\|20261_22121_+	nickel-dependent hydrogenase large subunit	NA	NA	NA	NA
WP_049799686.1\|22252_22855_+	HupE/UreJ family protein	NA	NA	NA	NA
WP_011516062.1\|22892_23624_+	Ni/Fe-hydrogenase, b-type cytochrome subunit	NA	NA	NA	NA
WP_080710402.1\|23743_24091_+	HigA family addiction module antidote protein	M9MUN2	Rhodococcus_phage	6.9e-07	42.0
WP_011516060.1\|24112_24778_+	HyaD/HybD family hydrogenase maturation endopeptidase	NA	NA	NA	NA
WP_011516059.1\|24779_25082_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516058.1\|25097_25547_+	hydrogenase	NA	NA	NA	NA
WP_011516057.1\|25578_26442_+	hydrogenase expression/formation protein	NA	NA	NA	NA
WP_011516056.1\|26447_26678_+	rubredoxin	NA	NA	NA	NA
WP_029310280.1\|26670_27156_+	[NiFe]-hydrogenase assembly chaperone HybE	NA	NA	NA	NA
WP_011516054.1\|27184_28339_+	hydrogenase expression/formation protein HoxV	NA	NA	NA	NA
WP_011516053.1\|28331_28679_+	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_011516052.1\|28702_29740_+	hydrogenase nickel incorporation protein HypB	NA	NA	NA	NA
WP_011516051.1\|29753_30893_+	carbamoyltransferase HypF	NA	NA	NA	NA
WP_011516050.1\|30883_31111_+	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516049.1\|31119_32283_+	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_011516048.1\|32279_33392_+	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_152560238.1\|34941_35331_-	hypothetical protein	NA	NA	NA	NA
WP_029309997.1\|35648_35966_+	hypothetical protein	NA	NA	NA	NA
WP_080710364.1\|35962_36325_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_049799681.1\|36347_38168_+\|transposase	IS66 family transposase	S5VLC8	Leptospira_phage	8.0e-46	35.1
WP_011516043.1\|37931_38927_-\|integrase	tyrosine-type recombinase/integrase	A0A2D2W391	Mycobacterium_phage	4.0e-07	25.5
WP_011516042.1\|38923_39871_-\|integrase	tyrosine-type recombinase/integrase	U3PCM7	Lactobacillus_phage	3.5e-05	27.5
WP_011516041.1\|39867_41100_-\|integrase	tyrosine-type recombinase/integrase	A0A142F1N9	Bacillus_phage	4.3e-11	27.5
WP_011516040.1\|41617_42787_+	ABC transporter permease	NA	NA	NA	NA
42676:42691	attR	NA	NA	NA	NA
WP_011516039.1\|42791_43910_+	ABC transporter permease	NA	NA	NA	NA
WP_011516038.1\|43906_45445_+	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_010792188.1\|45464_45668_+	DUF2892 domain-containing protein	NA	NA	NA	NA
WP_011516037.1\|45675_47085_+	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_011516036.1\|47084_47951_+	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	2.3e-11	32.4
WP_011516035.1\|48118_49129_+\|transposase	IS21-like element ISRme20 family transposase	A0A2L1IVA1	Escherichia_phage	8.2e-85	49.4
WP_011516034.1\|49128_49935_+	AAA family ATPase	A0A2L1IVB6	Escherichia_phage	4.6e-78	57.5
WP_011515352.1\|50084_51335_+\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8

DBSCAN-SWA_3

56959 : 57598

Halomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516027.1\|56959_57598_-	AAA family ATPase	B0ZSI1	Halomonas_phage	3.3e-31	40.1

DBSCAN-SWA_4

66178 : 69741

Cronobacter_phage(50.0%)

integrase

attL 65386:65401|attR 76933:76948

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
65386:65401	attL	NA	NA	NA	NA
WP_041240053.1\|66178_67003_-	DUF945 domain-containing protein	K4F5L3	Cronobacter_phage	1.8e-42	40.9
WP_011516015.1\|67711_68104_-	hypothetical protein	NA	NA	NA	NA
WP_011516014.1\|68730_69741_-\|integrase	tyrosine-type recombinase/integrase	A0A0K2CP59	Brevibacillus_phage	2.9e-21	28.3
76933:76948	attR	NA	NA	NA	NA

DBSCAN-SWA_5

72851 : 77751

Salmonella_phage(50.0%)

integrase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516011.1\|72851_73928_-	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	1.8e-21	39.7
WP_011516010.1\|73924_75124_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_035822143.1\|75558_77751_-	ATP-dependent DNA helicase	A0A127AW80	Bacillus_phage	3.0e-84	31.4

DBSCAN-SWA_6

81501 : 85252

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008646843.1\|81501_83400_-	potassium transporter Kup	M1IBC2	Acanthocystis_turfacea_Chlorella_virus	6.5e-59	29.8
WP_008646845.1\|83771_84488_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.6e-11	27.0
WP_011516003.1\|84484_85252_-	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	2.8e-16	29.3

DBSCAN-SWA_7

89316 : 90966

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515999.1\|89316_90966_-	benzoate-CoA ligase family protein	A0A2K9KZV5	Tupanvirus	1.1e-12	21.6

DBSCAN-SWA_8

105686 : 106481

Indivirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515985.1\|105686_106481_+	ABC transporter ATP-binding protein	A0A1V0SE00	Indivirus	6.4e-08	24.8

DBSCAN-SWA_9

111574 : 116837

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008648595.1\|111574_112270_-	nitroreductase	M1I6Q5	Acanthocystis_turfacea_Chlorella_virus	1.2e-21	31.8
WP_029310151.1\|112302_112749_-	acyl-CoA thioesterase	NA	NA	NA	NA
WP_029310152.1\|112855_113779_-	histone deacetylase	A0A0N9QAS6	Chrysochromulina_ericina_virus	4.5e-05	22.2
WP_011515979.1\|114213_114792_+	TIGR01841 family phasin PhaP1	NA	NA	NA	NA
WP_011515978.1\|115058_116837_-	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	1.1e-34	25.3

DBSCAN-SWA_10

126872 : 133069

Enterococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515972.1\|126872_127730_+	bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD	A0A249XZQ2	Enterococcus_phage	2.5e-34	34.8
WP_011515971.1\|127863_129966_+	M3 family metallopeptidase	A0A1V0SD92	Indivirus	1.4e-33	20.9
WP_011515970.1\|130004_130460_+	hypothetical protein	NA	NA	NA	NA
WP_011515969.1\|130456_131254_+	exodeoxyribonuclease III	NA	NA	NA	NA
WP_011515968.1\|131257_133069_+	STAS domain-containing protein	A0A2H4J153	uncultured_Caudovirales_phage	3.8e-24	26.8

DBSCAN-SWA_11

145923 : 150395

Streptococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515956.1\|145923_147201_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	7.9e-125	55.6
WP_011515955.1\|147320_148220_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.1e-11	28.1
WP_011515954.1\|148140_149655_-	HAMP domain-containing histidine kinase	A0A1V0SGX0	Hokovirus	2.9e-09	28.1
WP_029308127.1\|149651_150395_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.0e-28	31.1

DBSCAN-SWA_12

157004 : 164492

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008650476.1\|157004_157415_-	integration host factor subunit alpha	A0A1P8CWT5	Bacillus_phage	1.3e-12	41.1
WP_011515947.1\|157499_159947_-\|tRNA	phenylalanine--tRNA ligase subunit beta	NA	NA	NA	NA
WP_011515946.1\|160024_161056_-\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	2.7e-27	40.0
WP_008650487.1\|161264_161621_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_006575466.1\|161649_161847_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_080672715.1\|162015_162537_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	4.8e-12	31.7
WP_029308133.1\|162584_164492_-\|tRNA	threonine--tRNA ligase	A0A2K9L6B6	Tupanvirus	7.6e-124	36.2

DBSCAN-SWA_13

188330 : 189440

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515925.1\|188330_189440_-	chorismate synthase	A0A291AU41	Pandoravirus	1.9e-79	45.0

DBSCAN-SWA_14

207279 : 210414

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515908.1\|207279_210414_+	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.4e-52	22.9

DBSCAN-SWA_15

214902 : 215928

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515904.1\|214902_215928_+	2,3-diaminopropionate biosynthesis protein SbnA	A0A1W6JHY1	Lactococcus_phage	3.8e-37	33.4

DBSCAN-SWA_16

236030 : 237449

Niemeyer_virus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515887.1\|236030_237449_-\|tRNA	cysteine--tRNA ligase	A0A0U2SJ70	Niemeyer_virus	1.7e-40	30.5

DBSCAN-SWA_17

244153 : 249208

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515880.1\|244153_245182_-	alcohol dehydrogenase AdhP	A0A2K9L339	Tupanvirus	5.5e-36	28.9
WP_011515879.1\|245329_246835_-	DASS family sodium-coupled anion symporter	NA	NA	NA	NA
WP_035821823.1\|247393_249208_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.3e-19	39.1

DBSCAN-SWA_18

256492 : 260063

Moumouvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024569174.1\|256492_257881_-\|tRNA	cysteine--tRNA ligase	M1PG92	Moumouvirus	5.3e-42	32.5
WP_049799662.1\|258092_258818_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_011515871.1\|258899_259508_+	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011515870.1\|259562_260063_+	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	3.0e-11	33.5

DBSCAN-SWA_19

264165 : 267712

Acinetobacter_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515865.1\|264165_264345_+	type II toxin-antitoxin system HicA family toxin	A0A0D4DC32	Acinetobacter_phage	2.8e-12	57.6
WP_029310017.1\|264374_264779_+	type II toxin-antitoxin system HicB family antitoxin	A0A0U4ISP5	Pseudomonas_phage	8.8e-22	40.3
WP_035821829.1\|265105_267712_+	DNA mismatch repair protein MutS	A0A1V0SDQ0	Indivirus	2.0e-26	23.5

DBSCAN-SWA_20

271140 : 271929

Paenibacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515857.1\|271140_271929_-	MBL fold metallo-hydrolase	A0A2I7SDH3	Paenibacillus_phage	4.7e-27	31.7

DBSCAN-SWA_21

277286 : 281171

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515851.1\|277286_278348_+	NAD(P)/FAD-dependent oxidoreductase	A0A2K9L4X0	Tupanvirus	4.1e-10	26.1
WP_011515850.1\|278404_279298_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_029309929.1\|279443_281171_+	AMP-binding protein	A0A2K9L3I8	Tupanvirus	3.8e-21	22.9

DBSCAN-SWA_22

284908 : 289226

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008650102.1\|284908_286198_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	3.9e-156	63.8
WP_008650103.1\|286262_286553_-	DUF1330 domain-containing protein	NA	NA	NA	NA
WP_011515845.1\|286681_287551_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	4.1e-48	41.1
WP_011515844.1\|287576_289226_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	8.3e-151	52.2

DBSCAN-SWA_23

302354 : 317961

Planktothrix_phage(12.5%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515832.1\|302354_303104_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.6e-37	39.8
WP_011515831.1\|303096_304347_-	lipoprotein-releasing ABC transporter permease subunit	NA	NA	NA	NA
WP_011515830.1\|304450_305569_+	hypothetical protein	NA	NA	NA	NA
WP_011515829.1\|305615_307316_+	single-stranded-DNA-specific exonuclease RecJ	A7KV88	Bacillus_phage	2.0e-59	29.9
WP_011515828.1\|307390_308113_-	M23 family metallopeptidase	G3MBP9	Bacillus_virus	1.4e-06	37.1
WP_104669723.1\|308317_309421_+	peptide chain release factor 2	A0A0S4KWG0	Pseudomonas_phage	2.9e-06	37.1
WP_008649271.1\|309557_310328_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_011515826.1\|310387_311935_+\|tRNA	lysine--tRNA ligase	A0A2K9KZX5	Tupanvirus	1.1e-83	37.0
WP_011515825.1\|312212_312917_+	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_029308219.1\|313035_314052_+	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_008649279.1\|314112_314307_-	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_011515823.1\|314329_314668_-	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_011515822.1\|314709_316575_-	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.1e-98	39.7
WP_011515821.1\|316584_317103_-	Fe-S protein assembly co-chaperone HscB	NA	NA	NA	NA
WP_008649296.1\|317167_317488_-	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	1.4e-25	52.3
WP_008649297.1\|317559_317961_-	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	6.6e-54	82.3

DBSCAN-SWA_24

332821 : 333790

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515810.1\|332821_333790_+	alpha/beta hydrolase	G1DB77	Mycobacterium_phage	7.8e-08	25.8

DBSCAN-SWA_25

345940 : 347563

Tupanvirus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515797.1\|345940_347563_+\|protease	MprA protease, GlyGly-CTERM protein-sorting domain-containing form	A0A2K9L1P3	Tupanvirus	4.8e-10	28.3

DBSCAN-SWA_26

359644 : 360727

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960478.1\|359644_360727_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	5.2e-77	45.3

DBSCAN-SWA_27

391206 : 392750

Anomala_cuprea_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008643406.1\|391206_391899_-	urea ABC transporter ATP-binding subunit UrtE	W6JKT0	Anomala_cuprea_entomopoxvirus	5.9e-18	29.1
WP_011515764.1\|391901_392750_-	urea ABC transporter ATP-binding protein UrtD	A0A1M7XV31	Cedratvirus	4.7e-09	23.6

DBSCAN-SWA_28

430128 : 432480

Micromonas_sp._RCC1109_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008643333.1\|430128_431670_-	2-isopropylmalate synthase	E5EQ69	Micromonas_sp._RCC1109_virus	1.8e-06	24.5
WP_011515741.1\|431979_432480_-	peptidoglycan-binding protein LysM	G3MBQ1	Bacillus_virus	1.7e-06	48.1

DBSCAN-SWA_29

441695 : 446412

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308259.1\|441695_442733_+	UDP-2,3-diacylglucosamine diphosphatase	A0A218MKA7	uncultured_virus	1.3e-61	46.0
WP_011515730.1\|442832_443951_+	glycosyltransferase family 1 protein	NA	NA	NA	NA
WP_080672710.1\|443877_444375_+	diacylglycerol kinase	NA	NA	NA	NA
WP_011515728.1\|444434_445019_-	TIGR00730 family Rossman fold protein	A0A1V0S9E9	Catovirus	2.3e-07	25.9
WP_011515727.1\|445015_445726_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_029308261.1\|445827_446412_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	4.2e-17	28.4

DBSCAN-SWA_30

453568 : 458443

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515719.1\|453568_455065_+	xanthine dehydrogenase small subunit	A0A0P0IVM8	Acinetobacter_phage	1.3e-131	52.2
WP_011515718.1\|455076_457428_+	xanthine dehydrogenase molybdopterin binding subunit	A0A0P0I429	Acinetobacter_phage	1.8e-239	55.5
WP_011515717.1\|457447_458443_+	xanthine dehydrogenase accessory protein XdhC	A0A0P0IKN7	Acinetobacter_phage	1.5e-51	38.9

DBSCAN-SWA_31

466338 : 467745

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515709.1\|466338_467745_+	purine permease	Q9KX94	Enterobacteria_phage	5.4e-26	27.8

DBSCAN-SWA_32

477439 : 478456

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649749.1\|477439_478456_+	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	2.6e-46	34.4

DBSCAN-SWA_33

487126 : 489567

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515694.1\|487126_488605_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	1.2e-10	31.6
WP_011515693.1\|488664_489567_-	lipid A hydroxylase LpxO	S4VR59	Pandoravirus	5.2e-38	38.1

DBSCAN-SWA_34

494269 : 500139

Bordetella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308276.1\|494269_496690_-	bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase	A0A291L9W9	Bordetella_phage	2.8e-14	33.7
WP_006578656.1\|496979_497183_-	DNA-directed RNA polymerase subunit omega	NA	NA	NA	NA
WP_011515683.1\|497267_497918_-	guanylate kinase	A0A223FNL1	NY_014_poxvirus	7.3e-18	31.4
WP_008647044.1\|497922_498858_-	YicC family protein	NA	NA	NA	NA
WP_008647046.1\|499077_500139_+	serine/threonine protein kinase	Q8JE84	Murine_leukemia_virus	2.8e-11	29.0

DBSCAN-SWA_35

506205 : 507096

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515675.1\|506205_507096_+	trypsin-like peptidase domain-containing protein	A0A2H4JE36	uncultured_Caudovirales_phage	1.8e-30	33.1

DBSCAN-SWA_36

516384 : 517071

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515666.1\|516384_517071_-	PKHD-type hydroxylase	Q5GQB0	Synechococcus_phage	5.9e-18	29.4

DBSCAN-SWA_37

525950 : 528575

Klosneuvirus(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308285.1\|525950_528575_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	7.9e-79	38.2

DBSCAN-SWA_38

543233 : 544982

Escherichia_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515648.1\|543233_544982_+\|tRNA	glutamine--tRNA ligase/YqeY domain fusion protein	A0A222YZ70	Escherichia_phage	5.6e-190	57.0

DBSCAN-SWA_39

553841 : 556616

Acanthamoeba_polyphaga_lentillevirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515639.1\|553841_554597_+	slipin family protein	J3IZE5	Acanthamoeba_polyphaga_lentillevirus	1.0e-23	30.6
WP_011515638.1\|554751_555198_+	hypothetical protein	NA	NA	NA	NA
WP_017511209.1\|555232_555370_+	hypothetical protein	NA	NA	NA	NA
WP_011515637.1\|555419_556616_-	ABC transporter ATP-binding protein	F2Y1V5	Organic_Lake_phycodnavirus	9.6e-08	25.6

DBSCAN-SWA_40

560841 : 562410

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308301.1\|560841_562410_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-21	29.8

DBSCAN-SWA_41

570636 : 572172

Klebsiella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515626.1\|570636_572172_-	DUF853 domain-containing protein	A0A248XCZ8	Klebsiella_phage	8.7e-78	43.3

DBSCAN-SWA_42

582671 : 586133

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515615.1\|582671_583601_+	phosphonate ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	2.8e-07	25.7
WP_008645163.1\|583721_584702_+	phosphonate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_029308312.1\|584784_585597_+	phosphonate ABC transporter, permease protein PhnE	NA	NA	NA	NA
WP_011515613.1\|585593_586133_+	HD domain-containing protein	A0A2K9L4U0	Tupanvirus	5.6e-24	39.3

DBSCAN-SWA_43

593409 : 604915

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515603.1\|593409_594186_+	phosphonate C-P lyase system protein PhnK	G3M9Y6	Bacillus_virus	3.8e-13	24.0
WP_104670185.1\|594191_594914_+	phosphonate C-P lyase system protein PhnL	G9BWD6	Planktothrix_phage	8.1e-18	32.2
WP_029309700.1\|594933_596133_+	alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase	NA	NA	NA	NA
WP_080710320.1\|596386_596887_+	hypothetical protein	NA	NA	NA	NA
WP_011515599.1\|596909_597494_-	peroxidase-related enzyme	NA	NA	NA	NA
WP_035820263.1\|597578_599345_-	lipid A export permease/ATP-binding protein MsbA	W8CYL7	Bacillus_phage	4.8e-56	28.5
WP_011515597.1\|599441_600224_+	glycosyltransferase family 2 protein	NA	NA	NA	NA
WP_011515596.1\|600156_601419_-	glycosyltransferase	NA	NA	NA	NA
WP_029309702.1\|601411_604915_-	DNA polymerase III subunit alpha	A0A0K1Y9G6	Streptomyces_phage	6.2e-172	36.2

DBSCAN-SWA_44

621434 : 633735

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008643673.1\|621434_622469_-	methionine ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	8.0e-35	40.0
WP_008643671.1\|622642_623566_-	histone deacetylase family protein	A0A2K9KZC4	Tupanvirus	1.6e-39	33.3
WP_029308328.1\|623730_624837_+	lytic murein transglycosylase B	NA	NA	NA	NA
WP_029309853.1\|624916_625819_-	cysteine synthase CysM	C3U2M1	Lactococcus_phage	8.2e-52	41.2
WP_011515577.1\|625929_627378_-	nitrate reductase	Q9KX94	Enterobacteria_phage	1.3e-144	64.4
WP_011515576.1\|627475_627856_-	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_011515575.1\|628065_629061_-	ADP-glyceromanno-heptose 6-epimerase	R9S880	Prochlorococcus_phage	3.1e-28	33.4
WP_011515574.1\|629087_630032_-	D-glycero-beta-D-manno-heptose-7-phosphate kinase	A0A2H4N7X4	Lake_Baikal_phage	3.8e-15	27.5
WP_011515573.1\|630111_631485_-	UDP-glucose/GDP-mannose dehydrogenase family protein	A0A127AXI2	Bacillus_phage	3.5e-70	35.4
WP_011515572.1\|631542_632772_-	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_008643660.1\|632775_633099_-	LapA family protein	NA	NA	NA	NA
WP_011515571.1\|633327_633735_-	integration host factor subunit beta	A7KV42	Bacillus_phage	6.0e-10	37.8

DBSCAN-SWA_45

638960 : 646035

Faustovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515566.1\|638960_640085_-	histidinol-phosphate transaminase	A0A1X7BZP2	Faustovirus	3.8e-14	26.5
WP_011515565.1\|640104_641268_-	prephenate dehydratase	NA	NA	NA	NA
WP_008643651.1\|641368_642532_-	3-phosphoserine/phosphohydroxythreonine transaminase	M1Q1P2	Streptococcus_phage	3.4e-82	45.3
WP_011515564.1\|642689_643259_-	DUF2059 domain-containing protein	NA	NA	NA	NA
WP_011515563.1\|643341_646035_-	DNA gyrase subunit A	G3M9Z5	Bacillus_virus	8.0e-103	32.8

DBSCAN-SWA_46

651069 : 653373

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029309855.1\|651069_653373_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.5e-60	32.8

DBSCAN-SWA_47

666159 : 669836

uncultured_Mediterranean_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515546.1\|666159_667467_-\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	6.0e-96	51.9
WP_035821263.1\|667634_668930_-	replication-associated recombination protein A	G3MBE0	Bacillus_virus	4.7e-77	36.9
WP_011515544.1\|669086_669836_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.8e-35	39.1

DBSCAN-SWA_48

674822 : 678285

Mycobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515538.1\|674822_677150_-	DNA translocase FtsK	G1FGP1	Mycobacterium_phage	4.2e-84	49.7
WP_011515537.1\|677331_678285_+	thioredoxin-disulfide reductase	G3MA85	Bacillus_virus	7.1e-62	43.3

DBSCAN-SWA_49

683755 : 696647

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515533.1\|683755_684283_-	inorganic diphosphatase	A0A2H4J8U1	uncultured_Caudovirales_phage	5.5e-48	52.6
WP_011515532.1\|684447_685884_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_008643588.1\|685876_686116_+	hypothetical protein	NA	NA	NA	NA
WP_011515531.1\|686186_686948_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.7e-19	31.0
WP_011515530.1\|687057_688371_+	MFS transporter	NA	NA	NA	NA
WP_011515529.1\|688443_694413_-	hybrid sensor histidine kinase/response regulator	W8CYM9	Bacillus_phage	1.7e-12	35.6
WP_011515528.1\|694445_696647_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-12	35.5

DBSCAN-SWA_50

711348 : 712365

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515513.1\|711348_712365_-	glycosyltransferase family 2 protein	I1TED8	Salmonella_phage	6.3e-93	57.1

DBSCAN-SWA_51

729152 : 729941

Caulobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515495.1\|729152_729941_+	metallophosphoesterase	K4K650	Caulobacter_phage	1.0e-42	37.7

DBSCAN-SWA_52

740004 : 740259

Rhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515488.1\|740004_740259_-	PAAR domain-containing protein	R9U4D0	Rhizobium_phage	3.6e-05	53.7

DBSCAN-SWA_53

745129 : 747799

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515483.1\|745129_747799_-	type VI secretion system tip protein VgrG	A0A2H4JCD4	uncultured_Caudovirales_phage	3.4e-13	32.9

DBSCAN-SWA_54

754569 : 760000

uncultured_virus(66.67%)

plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515475.1\|754569_757251_+	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	2.2e-92	31.8
WP_011515474.1\|757247_757682_+\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_008644493.1\|757981_759625_-	chaperonin GroEL	A0A240F779	uncultured_virus	3.4e-173	60.6
WP_008644494.1\|759709_760000_-	co-chaperone GroES	A0A221S4A8	uncultured_virus	5.5e-18	43.6

DBSCAN-SWA_55

769268 : 775780

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515469.1\|769268_770981_+	AMP-binding protein	A0A2H4PQM9	Staphylococcus_phage	7.5e-30	27.9
WP_011515468.1\|770985_772593_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	6.0e-21	70.8
WP_011515467.1\|772606_774646_+	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_011515466.1\|774847_775780_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.8e-39	35.9

DBSCAN-SWA_56

795391 : 798757

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515451.1\|795391_798757_+	diguanylate cyclase	G3MA91	Bacillus_virus	5.3e-19	35.7

DBSCAN-SWA_57

804924 : 806025

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515446.1\|804924_806025_-	ornithine cyclodeaminase	A0A1V0SL93	Klosneuvirus	4.0e-85	46.9

DBSCAN-SWA_58

824877 : 825600

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308392.1\|824877_825600_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.4e-24	35.1

DBSCAN-SWA_59

853081 : 855896

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515407.1\|853081_854179_-	Zn-dependent alcohol dehydrogenase	A0A0K0KVL7	Prochlorococcus_phage	9.1e-29	29.0
WP_011515406.1\|854211_854880_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011515405.1\|854876_855896_-	ferredoxin--NADP reductase	A0A1D8KP97	Synechococcus_phage	1.4e-07	38.5

DBSCAN-SWA_60

859645 : 861739

Bacillus_thuringiensis_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008640957.1\|859645_860224_-	superoxide dismutase	Q56AR7	Bacillus_thuringiensis_phage	1.4e-44	44.2
WP_049799652.1\|860353_861739_-	exodeoxyribonuclease VII large subunit	A0A1V0SD82	Indivirus	6.9e-34	31.0

DBSCAN-SWA_61

871915 : 873409

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515388.1\|871915_873409_-	N-acetylmuramoyl-L-alanine amidase	Q5YA51	Bacillus_phage	5.6e-13	28.3

DBSCAN-SWA_62

878090 : 882785

Powai_lake_megavirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008645026.1\|878090_878570_+	methylated-DNA--[protein]-cysteine S-methyltransferase	A0A167R6J9	Powai_lake_megavirus	8.0e-14	45.2
WP_011515383.1\|878566_879475_+	site-specific tyrosine recombinase XerD	A0A0K2CP59	Brevibacillus_phage	5.0e-25	28.5
WP_011515382.1\|879497_879989_+\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_008645034.1\|880087_880696_+	glycerol-3-phosphate 1-O-acyltransferase PlsY	NA	NA	NA	NA
WP_011515381.1\|880770_882054_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_008645039.1\|882050_882785_-	response regulator	W8CYM9	Bacillus_phage	2.3e-28	34.8

DBSCAN-SWA_63

887675 : 890978

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515378.1\|887675_890978_+	MMPL family transporter	S5VTK5	Leptospira_phage	8.1e-65	22.1

DBSCAN-SWA_64

895795 : 899505

Pandoravirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515372.1\|895795_896788_-	threonylcarbamoyl-AMP synthase	S4VW33	Pandoravirus	2.1e-40	36.7
WP_011515371.1\|896803_898048_-	5-(carboxyamino)imidazole ribonucleotide synthase	NA	NA	NA	NA
WP_008652146.1\|898077_898575_-	5-(carboxyamino)imidazole ribonucleotide mutase	A0A2P0VNU7	Tetraselmis_virus	3.4e-15	41.9
WP_008652147.1\|898596_899505_-	phosphoribosylaminoimidazolesuccinocarboxamide synthase	A0A0M4JBD3	Mollivirus	8.8e-54	37.8

DBSCAN-SWA_65

910600 : 913540

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035822026.1\|910600_913540_-	DEAD/DEAH box helicase	A0A0P0CJA9	Ostreococcus_lucimarinus_virus	6.2e-40	30.0

DBSCAN-SWA_66

921082 : 926283

Escherichia_phage(66.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515356.1\|921082_921868_-	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.0e-34	36.2
WP_011515355.1\|921857_923384_-\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	5.2e-14	25.6
WP_011515353.1\|923711_924194_+	hypothetical protein	NA	NA	NA	NA
WP_080710404.1\|924279_924945_-	DUF4435 domain-containing protein	NA	NA	NA	NA
WP_011515352.1\|925032_926283_+\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8

DBSCAN-SWA_67

933072 : 933768

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515344.1\|933072_933768_-	TerC family protein	W8EBD0	Pseudomonas_phage	3.7e-28	40.1

DBSCAN-SWA_68

937875 : 950351

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008646499.1\|937875_938937_-	recombinase RecA	A0A0S2MVG1	Bacillus_phage	3.3e-116	65.3
WP_011515340.1\|939176_939866_+	response regulator transcription factor	NA	NA	NA	NA
WP_011515339.1\|939887_941462_+	sensor histidine kinase	W8CYF6	Bacillus_phage	4.6e-18	28.1
WP_104669615.1\|941482_941779_+	DUF4212 domain-containing protein	NA	NA	NA	NA
WP_011515337.1\|942137_943835_+	MHS family MFS transporter	NA	NA	NA	NA
WP_011515334.1\|944442_946101_-	putative pyridoxal-dependent aspartate 1-decarboxylase	S4W1T5	Pandoravirus	1.6e-21	26.8
WP_011515333.1\|946228_946852_-	response regulator transcription factor	NA	NA	NA	NA
WP_011515332.1\|947181_947616_+	universal stress protein	NA	NA	NA	NA
WP_011515331.1\|947670_948717_-	serine/threonine protein kinase	NA	NA	NA	NA
WP_011515330.1\|948728_950351_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.7e-53	32.8

DBSCAN-SWA_69

954252 : 955248

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515326.1\|954252_955248_+	PhoH family protein	A0A0S0MVD6	Pseudomonas_phage	1.5e-46	46.0

DBSCAN-SWA_70

981598 : 986911

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515301.1\|981598_983173_+	bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase	Q58MG4	Prochlorococcus_phage	8.1e-63	45.1
WP_008646027.1\|983299_983845_+	crossover junction endodeoxyribonuclease RuvC	NA	NA	NA	NA
WP_011515300.1\|983959_985138_+	glycerophosphodiester phosphodiesterase	NA	NA	NA	NA
WP_011515299.1\|985192_985774_+	Holliday junction branch migration protein RuvA	NA	NA	NA	NA
WP_011515298.1\|985843_986911_+	Holliday junction branch migration DNA helicase RuvB	A0A127AWE7	Bacillus_phage	1.7e-08	27.3

DBSCAN-SWA_71

991846 : 994846

Gordonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515291.1\|991846_993241_+	M23 family metallopeptidase	A0A2P1JY73	Gordonia_phage	4.5e-17	46.2
WP_011515290.1\|993243_994386_+	anhydro-N-acetylmuramic acid kinase	NA	NA	NA	NA
WP_008646009.1\|994477_994846_-	iron-sulfur cluster insertion protein ErpA	A0A2H4N7M3	Lake_Baikal_phage	2.3e-29	57.4

DBSCAN-SWA_72

1004232 : 1004967

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008645995.1\|1004232_1004967_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.6e-29	39.4

DBSCAN-SWA_73

1012139 : 1016115

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515270.1\|1012139_1012985_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.5e-31	34.5
WP_011515269.1\|1012981_1014040_-	taurine ABC transporter permease	NA	NA	NA	NA
WP_011515268.1\|1014222_1016115_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	9.8e-47	28.7

DBSCAN-SWA_74

1031441 : 1036065

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515255.1\|1031441_1032149_-	DUF502 domain-containing protein	A0A2I7S9X1	Vibrio_phage	2.0e-13	27.9
WP_011515254.1\|1032163_1032493_-	FmdB family transcriptional regulator	NA	NA	NA	NA
WP_011515253.1\|1032716_1034153_-	sodium:solute symporter	NA	NA	NA	NA
WP_011515251.1\|1034487_1036065_-	ubiquinone biosynthesis regulatory protein kinase UbiB	M4QMK7	Micromonas_pusilla_virus	2.4e-38	32.4

DBSCAN-SWA_75

1039204 : 1041115

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008644384.1\|1039204_1041115_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	2.9e-06	30.4

DBSCAN-SWA_76

1053246 : 1054293

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308424.1\|1053246_1054293_+	XdhC family protein	A0A0P0IKN7	Acinetobacter_phage	1.9e-15	27.6

DBSCAN-SWA_77

1060758 : 1061592

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515232.1\|1060758_1061592_+	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF	A0A2I7SAX1	Vibrio_phage	6.0e-41	39.8

DBSCAN-SWA_78

1064881 : 1065868

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515228.1\|1064881_1065868_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.0e-19	29.7

DBSCAN-SWA_79

1070730 : 1072056

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515223.1\|1070730_1072056_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.4e-20	24.9

DBSCAN-SWA_80

1080708 : 1087103

uncultured_Caudovirales_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515216.1\|1080708_1082208_+	lytic transglycosylase F	A0A0S2SXL7	Bacillus_phage	9.2e-16	31.5
WP_011515215.1\|1082437_1083256_+	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_011515214.1\|1083449_1083779_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_011515213.1\|1083782_1084271_+	glyoxalase/bleomycin resistance/dioxygenase family protein	NA	NA	NA	NA
WP_011515212.1\|1084336_1084849_+	arsenate reductase ArsC	A0A2H4J8A6	uncultured_Caudovirales_phage	1.6e-28	44.5
WP_011515211.1\|1084845_1085910_+	ACR3 family arsenite efflux transporter	NA	NA	NA	NA
WP_011515210.1\|1085919_1086342_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	4.0e-49	66.4
WP_011515209.1\|1086338_1087103_+	arsenical resistance protein ArsH	A0A2H4J5V6	uncultured_Caudovirales_phage	5.8e-91	71.9

DBSCAN-SWA_81

1090449 : 1120579

Burkholderia_virus(16.67%)

protease,integrase,transposase

attL 1088663:1088680|attR 1122476:1122493

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1088663:1088680	attL	NA	NA	NA	NA
WP_152560155.1\|1090449_1092147_-\|integrase	integrase	NA	NA	NA	NA
WP_049799649.1\|1092457_1093573_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_124682078.1\|1093732_1094278_+\|transposase	transposase	NA	NA	NA	NA
WP_008651549.1\|1094389_1095829_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_008651548.1\|1095825_1096659_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|1096655_1096928_+	hypothetical protein	NA	NA	NA	NA
WP_029310226.1\|1097106_1097619_-	hypothetical protein	NA	NA	NA	NA
WP_011515203.1\|1097615_1098812_-\|integrase	site-specific integrase	NA	NA	NA	NA
WP_011515202.1\|1098999_1099866_-	hypothetical protein	NA	NA	NA	NA
WP_011515201.1\|1100098_1100644_-	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	2.3e-49	85.3
WP_011515200.1\|1100919_1102176_-	MFS transporter	NA	NA	NA	NA
WP_011515199.1\|1102450_1105318_+	excinuclease ABC subunit UvrA	A0A1B1IVR3	uncultured_Mediterranean_phage	6.2e-303	54.8
WP_011515198.1\|1105371_1107048_-	Na/Pi cotransporter family protein	NA	NA	NA	NA
WP_011515197.1\|1107327_1107900_-	adenine phosphoribosyltransferase	A0A1V0SKE5	Klosneuvirus	1.6e-29	44.5
WP_011515196.1\|1107975_1108605_+	DJ-1/PfpI family protein	NA	NA	NA	NA
WP_011515195.1\|1108663_1109092_+	ribbon-helix-helix domain-containing protein	NA	NA	NA	NA
WP_029306755.1\|1109081_1111061_-	potassium transporter	NA	NA	NA	NA
WP_011515193.1\|1111211_1112195_+	KpsF/GutQ family sugar-phosphate isomerase	A0A2P0VNK5	Tetraselmis_virus	2.0e-35	33.7
WP_011515192.1\|1112198_1112825_+	LPS export ABC transporter periplasmic protein LptC	NA	NA	NA	NA
WP_011515191.1\|1112887_1113532_+	lipopolysaccharide transport periplasmic protein LptA	NA	NA	NA	NA
WP_011515190.1\|1113557_1114349_+	LPS export ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	2.5e-20	28.0
WP_011515189.1\|1114472_1115951_+	RNA polymerase factor sigma-54	NA	NA	NA	NA
WP_008650960.1\|1116001_1116355_+	ribosome-associated translation inhibitor RaiA	NA	NA	NA	NA
WP_017511024.1\|1116831_1117287_+	PTS IIA-like nitrogen regulatory protein PtsN	NA	NA	NA	NA
WP_008650955.1\|1117355_1118327_+	HPr kinase/phosphorylase	NA	NA	NA	NA
WP_017511023.1\|1118532_1118874_+	hypothetical protein	NA	NA	NA	NA
WP_011515185.1\|1118988_1119879_+	RNase adapter RapZ	A0A1P8D5W0	Corynebacterium_phage	1.1e-08	37.4
WP_011515184.1\|1119925_1120579_+\|protease	ATP-dependent protease	NA	NA	NA	NA
1122476:1122493	attR	NA	NA	NA	NA

DBSCAN-SWA_82

1129044 : 1136327

Tupanvirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008650936.1\|1129044_1129998_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	2.4e-41	33.8
WP_011515177.1\|1130168_1130780_+	50S ribosomal protein L25/general stress protein Ctc	NA	NA	NA	NA
WP_011515176.1\|1130954_1131551_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_008650933.1\|1131674_1131935_-	YfhL family 4Fe-4S dicluster ferredoxin	A0A1B1IWY9	uncultured_Mediterranean_phage	5.3e-20	58.0
WP_011515175.1\|1132001_1132487_-	pantetheine-phosphate adenylyltransferase	A0A1B1IVQ3	uncultured_Mediterranean_phage	3.6e-30	45.3
WP_035820726.1\|1132698_1133259_-	16S rRNA (guanine(966)-N(2))-methyltransferase RsmD	NA	NA	NA	NA
WP_011515173.1\|1133439_1134804_-	insulinase family protein	NA	NA	NA	NA
WP_011515172.1\|1134812_1136327_-	insulinase family protein	A0A2K9L1M6	Tupanvirus	2.2e-25	22.5

DBSCAN-SWA_83

1142549 : 1146624

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515164.1\|1142549_1143353_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-34	38.0
WP_011515163.1\|1143451_1144441_+	DNA-binding protein YbiB	NA	NA	NA	NA
WP_011515162.1\|1144481_1145357_-	pirin family protein	NA	NA	NA	NA
WP_008642691.1\|1145688_1146624_+	RNA polymerase sigma factor RpoH	A0A248SJA5	Salicola_phage	4.4e-40	37.7

DBSCAN-SWA_84

1153252 : 1154863

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515154.1\|1153252_1154863_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.2e-06	35.8

DBSCAN-SWA_85

1162131 : 1165353

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008642654.1\|1162131_1163847_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	3.1e-225	67.5
WP_011515148.1\|1165095_1165353_-	glutaredoxin 3	V9QKN6	Rhizobium_phage	4.4e-11	43.6

DBSCAN-SWA_86

1168664 : 1172558

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515144.1\|1168664_1169417_+	molybdopterin-synthase adenylyltransferase MoeB	A0A1V0SAV8	Catovirus	6.1e-08	26.5
WP_008645854.1\|1169633_1170113_-	bacterioferritin	NA	NA	NA	NA
WP_011515143.1\|1170258_1170564_-	bacterioferritin-associated ferredoxin	NA	NA	NA	NA
WP_011515142.1\|1170800_1172558_-	phosphoenolpyruvate--protein phosphotransferase	A0A1V0SGR7	Hokovirus	3.8e-13	29.3

DBSCAN-SWA_87

1184348 : 1188096

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515132.1\|1184348_1186457_+	ATP-dependent helicase	A7KV33	Bacillus_phage	7.0e-62	29.0
WP_011515131.1\|1186494_1188096_-	tyrosine 2,3-aminomutase	A0A1V0S940	Catovirus	1.1e-67	36.3

DBSCAN-SWA_88

1194610 : 1195804

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641765.1\|1194610_1195804_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.6e-61	40.3

DBSCAN-SWA_89

1200529 : 1201345

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641776.1\|1200529_1201345_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	4.4e-12	25.0

DBSCAN-SWA_90

1204853 : 1207776

Brazilian_cedratvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515120.1\|1204853_1205795_-	ATP-binding cassette domain-containing protein	A0A2R8FG22	Brazilian_cedratvirus	1.2e-13	24.8
WP_011515119.1\|1205811_1207776_-	AMP-binding protein	A0A1V0SBX8	Catovirus	5.1e-30	23.3

DBSCAN-SWA_91

1231036 : 1231633

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515101.1\|1231036_1231633_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.1e-39	45.1

DBSCAN-SWA_92

1238878 : 1252188

Paramecium_bursaria_Chlorella_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515093.1\|1238878_1240717_-	glutamine--fructose-6-phosphate transaminase (isomerizing)	A7IW18	Paramecium_bursaria_Chlorella_virus	1.3e-149	46.4
WP_008641833.1\|1240731_1242096_-	UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase	A0A2K9L277	Tupanvirus	4.4e-33	35.0
WP_035821838.1\|1242383_1243190_+	hypothetical protein	NA	NA	NA	NA
WP_011515091.1\|1243219_1244164_-\|tRNA	tRNA 2-thiocytidine(32) synthetase TtcA	A0A0U2S5Z2	Escherichia_phage	2.4e-102	70.5
WP_008641837.1\|1244279_1244678_-	dihydroneopterin aldolase	NA	NA	NA	NA
WP_011515090.1\|1244699_1245500_-	SDR family oxidoreductase	NA	NA	NA	NA
WP_011515089.1\|1245534_1246731_+	SAM-dependent methyltransferase	NA	NA	NA	NA
WP_008641842.1\|1246756_1246951_+	DUF2905 domain-containing protein	NA	NA	NA	NA
WP_011515088.1\|1246991_1248236_-	multifunctional CCA addition/repair protein	A0A0F6YPT7	Sinorhizobium_phage	1.8e-81	42.5
WP_011515087.1\|1248239_1248929_-	glutathione S-transferase family protein	NA	NA	NA	NA
WP_011515086.1\|1249097_1250120_-	complex I NDUFA9 subunit family protein	NA	NA	NA	NA
WP_011515085.1\|1250220_1252188_-	lytic transglycosylase domain-containing protein	A0A0H3V0Q1	Geobacillus_virus	6.2e-12	37.3

DBSCAN-SWA_93

1255520 : 1256939

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641860.1\|1255520_1256939_-	adenosylhomocysteinase	S4VPF6	Pandoravirus	6.0e-41	30.4

DBSCAN-SWA_94

1266887 : 1274059

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515072.1\|1266887_1268429_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-08	68.0
WP_011515071.1\|1268480_1270163_-	FAD-binding protein	A0A1V0SI18	Klosneuvirus	6.6e-47	28.8
WP_011515070.1\|1270410_1271814_+	coniferyl aldehyde dehydrogenase	NA	NA	NA	NA
WP_011515069.1\|1271859_1272753_-	hypothetical protein	NA	NA	NA	NA
WP_008648556.1\|1272895_1274059_-	methionine adenosyltransferase	A0A2H4PQS6	Staphylococcus_phage	9.7e-122	60.2

DBSCAN-SWA_95

1279983 : 1280760

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515063.1\|1279983_1280760_+	exodeoxyribonuclease III	R4TWA8	Phaeocystis_globosa_virus	6.0e-27	31.6

DBSCAN-SWA_96

1295374 : 1296706

Erwinia_phage(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029306786.1\|1295374_1296706_-\|protease	ATP-dependent protease ATPase subunit HslU	A0A191ZC11	Erwinia_phage	2.1e-43	30.1

DBSCAN-SWA_97

1340264 : 1341332

Dickeya_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515008.1\|1340264_1341332_-	5-methyltetrahydrofolate--homocysteine methyltransferase	A0A140XBC7	Dickeya_phage	2.7e-09	44.6

DBSCAN-SWA_98

1350944 : 1351436

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515000.1\|1350944_1351436_+	D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase	A0A1B1IUK5	uncultured_Mediterranean_phage	4.8e-14	30.9

DBSCAN-SWA_99

1355371 : 1356211

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008648922.1\|1355371_1356211_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	7.7e-12	28.5

DBSCAN-SWA_100

1367942 : 1369052

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011514982.1\|1367942_1369052_-	tyrosine recombinase XerC	G1JX48	Mycobacterium_phage	1.2e-17	31.9

DBSCAN-SWA_101

1387259 : 1393176

Ectocarpus_siliculosus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011514968.1\|1387259_1390163_-	sensor histidine kinase KdpD	Q8QKV7	Ectocarpus_siliculosus_virus	6.6e-10	23.6
WP_011514967.1\|1390311_1390923_-	potassium-transporting ATPase subunit KdpC	NA	NA	NA	NA
WP_011514966.1\|1390944_1393176_-	potassium-transporting ATPase subunit KdpB	M1HBF8	Paramecium_bursaria_Chlorella_virus	6.4e-21	25.4

DBSCAN-SWA_102

1399402 : 1400589

Acinetobacter_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960481.1\|1399402_1400589_-\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7

DBSCAN-SWA_103

1412613 : 1415721

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011514951.1\|1412613_1414200_-	MFS transporter	S4TR35	Salmonella_phage	2.4e-06	23.4
WP_011514950.1\|1414407_1414848_-	CBS domain-containing protein	NA	NA	NA	NA
WP_011514949.1\|1415037_1415721_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.1e-15	28.7

DBSCAN-SWA_104

1419562 : 1420600

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011514944.1\|1419562_1420600_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.7e-22	35.0

DBSCAN-SWA_105

1428522 : 1432349

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011514937.1\|1428522_1431048_-	DNA topoisomerase (ATP-hydrolyzing) subunit B	G3M9Z3	Bacillus_virus	1.8e-11	56.7
WP_008650852.1\|1431233_1432349_-	DNA polymerase III subunit beta	R9TRR6	Rhizobium_phage	7.8e-44	31.2

DBSCAN-SWA_106

1462618 : 1465771

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011518004.1\|1462618_1465771_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	8.9e-53	21.6

DBSCAN-SWA_107

1478867 : 1479881

Paramecium_bursaria_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008642764.1\|1478867_1479881_-	D-2-hydroxyacid dehydrogenase family protein	M1HBE3	Paramecium_bursaria_Chlorella_virus	4.9e-13	23.8

DBSCAN-SWA_108

1489335 : 1496727

Acanthamoeba_polyphaga_mimivirus(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517984.1\|1489335_1492011_-	DNA topoisomerase III	A0A0G2YA05	Acanthamoeba_polyphaga_mimivirus	2.3e-17	24.3
WP_011517983.1\|1492186_1492576_-	thioredoxin family protein	NA	NA	NA	NA
WP_011517982.1\|1492612_1493728_-	DNA-protecting protein DprA	S6BFL3	Thermus_phage	6.6e-19	35.8
WP_029306835.1\|1493766_1494942_-	LysM peptidoglycan-binding domain-containing protein	NA	NA	NA	NA
WP_011517980.1\|1495106_1495613_+	peptide deformylase	E3SLL2	Synechococcus_phage	1.8e-19	41.8
WP_029306836.1\|1495728_1496727_+\|tRNA	methionyl-tRNA formyltransferase	E3SNR5	Prochlorococcus_phage	6.6e-10	31.6

DBSCAN-SWA_109

1523667 : 1526225

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029306842.1\|1523667_1524399_-	aquaporin family protein	A0A1V0SCL5	Indivirus	1.2e-05	33.7
WP_141192907.1\|1524727_1525621_-	DUF2272 domain-containing protein	NA	NA	NA	NA
WP_011517956.1\|1525717_1525957_+	hypothetical protein	NA	NA	NA	NA
WP_008640984.1\|1525946_1526225_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	4.3e-12	45.6

DBSCAN-SWA_110

1544669 : 1552173

uncultured_virus(25.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517944.1\|1544669_1547111_+	copper-translocating P-type ATPase	A0A218MNH6	uncultured_virus	4.9e-99	36.3
WP_008648660.1\|1547107_1547527_+	Cu(I)-responsive transcriptional regulator	NA	NA	NA	NA
WP_029306851.1\|1547633_1548554_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011517942.1\|1548634_1550302_+\|holin	choline dehydrogenase	A0A1V0S9J5	Catovirus	3.0e-47	27.7
WP_008648866.1\|1550661_1551435_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.5e-14	24.4
WP_008648867.1\|1551447_1552173_+	ABC transporter ATP-binding protein	A0A076FI99	Aureococcus_anophage	1.1e-06	25.5

DBSCAN-SWA_111

1559917 : 1563537

Cedratvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517935.1\|1559917_1561771_+	branched-chain amino acid ABC transporter ATP-binding protein/permease	A0A1M7XV31	Cedratvirus	5.1e-16	30.0
WP_011517934.1\|1561780_1562524_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-11	26.0
WP_011517933.1\|1562634_1563537_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	4.7e-23	26.6

DBSCAN-SWA_112

1568550 : 1570263

Natrialba_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517928.1\|1568550_1569324_+	ParA family protein	Q8JL10	Natrialba_phage	1.3e-21	35.1
WP_029306859.1\|1569369_1570263_+	ParB/RepB/Spo0J family partition protein	A0A1C9EHW0	Gordonia_phage	1.6e-15	35.0

DBSCAN-SWA_113

1578968 : 1579925

Acanthamoeba_polyphaga_lentillevirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517920.1\|1578968_1579925_+	alpha/beta hydrolase	J3IZC7	Acanthamoeba_polyphaga_lentillevirus	2.0e-24	27.1

DBSCAN-SWA_114

1596402 : 1606491

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517911.1\|1596402_1599327_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	2.0e-261	51.4
WP_008647396.1\|1599412_1599793_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_011517910.1\|1599896_1601024_-	glycine cleavage system aminomethyltransferase GcvT	NA	NA	NA	NA
WP_011517909.1\|1601514_1601736_-	glycine zipper 2TM domain-containing protein	NA	NA	NA	NA
WP_011517908.1\|1602029_1604117_+	AAA family ATPase	A7KV33	Bacillus_phage	4.2e-99	36.6
WP_017514019.1\|1604441_1605173_+	response regulator	NA	NA	NA	NA
WP_011517906.1\|1605177_1606491_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.2e-12	24.0

DBSCAN-SWA_115

1613022 : 1618268

Pandoravirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517899.1\|1613022_1614414_+	FAD-binding oxidoreductase	A0A0B5JBT9	Pandoravirus	9.1e-34	28.0
WP_029306872.1\|1614462_1614867_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_011517897.1\|1615073_1618268_+	cytochrome P450	V5UQK0	Mycobacterium_phage	4.2e-82	38.3

DBSCAN-SWA_116

1623910 : 1625422

Heterosigma_akashiwo_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517891.1\|1623910_1625422_-	polyamine aminopropyltransferase	A0A1C9C533	Heterosigma_akashiwo_virus	1.8e-14	28.9

DBSCAN-SWA_117

1628824 : 1632371

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517887.1\|1628824_1629211_+	adenosylmethionine decarboxylase	A0A1D7SEZ2	Cyanophage	2.2e-14	40.4
WP_008646161.1\|1629277_1629712_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_011517885.1\|1630251_1630689_+	nucleoside diphosphate kinase regulator	NA	NA	NA	NA
WP_008646158.1\|1630977_1631325_+	hypothetical protein	NA	NA	NA	NA
WP_011517883.1\|1631477_1632371_-	neutral zinc metallopeptidase	A0A1I9SA48	Rhodococcus_phage	1.1e-37	36.7

DBSCAN-SWA_118

1637444 : 1639235

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517879.1\|1637444_1639235_-	glyoxylate carboligase	E5EQ70	Micromonas_sp._RCC1109_virus	9.9e-41	27.1

DBSCAN-SWA_119

1648903 : 1654968

uncultured_Caudovirales_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029306874.1\|1648903_1649464_-	N-acetyltransferase	A0A2H4J136	uncultured_Caudovirales_phage	1.2e-21	39.3
WP_011517868.1\|1649666_1650026_+	arsenate reductase (glutaredoxin)	A0A2H4J8T1	uncultured_Caudovirales_phage	8.1e-19	44.4
WP_008646132.1\|1650117_1650348_-	hypothetical protein	NA	NA	NA	NA
WP_011517867.1\|1650555_1651203_-	exonuclease	A0A2L0UZL4	Agrobacterium_phage	7.7e-36	40.5
WP_017510795.1\|1651206_1651857_-	MBL fold metallo-hydrolase	NA	NA	NA	NA
WP_029306876.1\|1652255_1652909_+	septal ring lytic transglycosylase RlpA family protein	F5B3X9	Synechococcus_phage	1.9e-18	53.9
WP_011517864.1\|1652993_1653893_-	16S rRNA (cytidine(1402)-2'-O)-methyltransferase	M1PLC5	Streptococcus_phage	4.8e-36	40.6
WP_011517863.1\|1653945_1654350_+	YraN family protein	NA	NA	NA	NA
WP_008646124.1\|1654380_1654968_+	phosphoheptose isomerase	A0A067XQR2	Caulobacter_phage	2.0e-14	34.0

DBSCAN-SWA_120

1680251 : 1681637

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517838.1\|1680251_1681637_-	MFS transporter	Q6JIH2	Burkholderia_virus	2.5e-116	51.7

DBSCAN-SWA_121

1720773 : 1723075

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011515355.1\|1720773_1722300_+\|transposase	IS21 family transposase	A0A2L1IVA1	Escherichia_phage	5.2e-14	25.6
WP_011515356.1\|1722289_1723075_+	ATP-binding protein	A0A2L1IVB6	Escherichia_phage	3.0e-34	36.2

DBSCAN-SWA_122

1736036 : 1737222

Acinetobacter_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960481.1\|1736036_1737222_+\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7

DBSCAN-SWA_123

1750516 : 1751707

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517774.1\|1750516_1751707_+	elongation factor Tu	M4M9V7	Vibrio_phage	9.9e-05	57.8

DBSCAN-SWA_124

1755976 : 1764440

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649192.1\|1755976_1760083_+	DNA-directed RNA polymerase subunit beta	A0A0N9R0J7	Chrysochromulina_ericina_virus	1.2e-20	27.5
WP_011517781.1\|1760198_1764440_+	DNA-directed RNA polymerase subunit beta'	A0A2I7QNZ7	Vibrio_phage	9.8e-71	28.1

DBSCAN-SWA_125

1768784 : 1775489

Acanthamoeba_polyphaga_moumouvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308637.1\|1768784_1770632_+	DNA helicase RecQ	L7RCS0	Acanthamoeba_polyphaga_moumouvirus	1.2e-76	35.5
WP_008649178.1\|1770935_1771313_+	30S ribosomal protein S12	NA	NA	NA	NA
WP_011517776.1\|1771520_1771991_+	30S ribosomal protein S7	NA	NA	NA	NA
WP_011517775.1\|1772109_1774221_+	elongation factor G	A0A2K5B2A5	Erysipelothrix_phage	3.4e-56	27.6
WP_011517774.1\|1774298_1775489_+	elongation factor Tu	M4M9V7	Vibrio_phage	9.9e-05	57.8

DBSCAN-SWA_126

1806917 : 1807451

Sinorhizobium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517754.1\|1806917_1807451_+	RNA polymerase sigma factor	A0A0F6TH34	Sinorhizobium_phage	1.1e-06	27.7

DBSCAN-SWA_127

1817990 : 1820123

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517740.1\|1817990_1820123_+	type IV pilus secretin PilQ	R9TEZ5	Vibrio_phage	6.7e-20	28.9

DBSCAN-SWA_128

1832726 : 1833566

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_141192943.1\|1832726_1833566_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.9e-18	30.5

DBSCAN-SWA_129

1837195 : 1838146

Pithovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008643041.1\|1837195_1838146_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	9.0e-25	31.8

DBSCAN-SWA_130

1850170 : 1854023

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008643069.1\|1850170_1850953_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.9e-28	32.9
WP_029309858.1\|1851207_1852350_+	porin	NA	NA	NA	NA
WP_011517715.1\|1852826_1854023_-	Do family serine endopeptidase	A0A1B1IRD3	uncultured_Mediterranean_phage	3.5e-10	30.7

DBSCAN-SWA_131

1859185 : 1865627

Pseudomonas_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517709.1\|1859185_1859683_+\|protease	ClpXP protease specificity-enhancing factor	A0A1S5R3H3	Pseudomonas_phage	1.2e-20	39.6
WP_035821295.1\|1859984_1861676_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-14	35.7
WP_011517707.1\|1862144_1863044_+	endo alpha-1,4 polygalactosaminidase	NA	NA	NA	NA
WP_011517706.1\|1863057_1863555_-	M48 family metallopeptidase	NA	NA	NA	NA
WP_011517705.1\|1863596_1863818_-	hypothetical protein	NA	NA	NA	NA
WP_008643099.1\|1863959_1865627_+	energy-dependent translational throttle protein EttA	A0A2K9L0W2	Tupanvirus	5.8e-43	26.3

DBSCAN-SWA_132

1872627 : 1874130

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517697.1\|1872627_1874130_+	acyl-CoA synthetase	A0A2H4PQM9	Staphylococcus_phage	3.4e-26	26.2

DBSCAN-SWA_133

1885658 : 1886741

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029308602.1\|1885658_1886741_-	peptide chain release factor 1	A0A0S4KWG0	Pseudomonas_phage	1.1e-07	46.6

DBSCAN-SWA_134

1902886 : 1912087

Acinetobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517667.1\|1902886_1904233_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	2.5e-28	37.4
WP_008647147.1\|1904243_1905989_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_011517665.1\|1906319_1906607_+	acylphosphatase	NA	NA	NA	NA
WP_011517664.1\|1906668_1907439_-	uracil-DNA glycosylase	T2FKU3	Suid_alphaherpesvirus	4.9e-45	48.0
WP_011517663.1\|1907438_1908062_-	CYTH domain-containing protein	NA	NA	NA	NA
WP_011517662.1\|1908069_1908882_-	indole-3-glycerol phosphate synthase TrpC	A0A0P0IR83	Acinetobacter_phage	1.6e-62	51.5
WP_011517661.1\|1908888_1909971_-	anthranilate phosphoribosyltransferase	A0A0N7IRD9	Acinetobacter_phage	1.6e-81	46.2
WP_008647587.1\|1909967_1910537_-	aminodeoxychorismate/anthranilate synthase component II	A0A0P0IKJ1	Acinetobacter_phage	1.2e-72	65.8
WP_008647586.1\|1910560_1912087_-	anthranilate synthase component I	S4VT78	Pandoravirus	1.2e-39	30.9

DBSCAN-SWA_135

1942633 : 1952123

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517638.1\|1942633_1943632_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-15	27.9
WP_011517637.1\|1943628_1944693_+	ABC transporter ATP-binding protein	NA	NA	NA	NA
WP_011517636.1\|1944751_1945948_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011517633.1\|1946268_1948374_+	molybdopterin oxidoreductase family protein	A0A077SK27	Escherichia_phage	6.4e-47	27.6
WP_011517632.1\|1948370_1949528_+	aminopeptidase	NA	NA	NA	NA
WP_011517631.1\|1949557_1950259_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_011517630.1\|1950440_1952123_+	long-chain fatty acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	4.0e-36	27.1

DBSCAN-SWA_136

1978409 : 1981679

Cyanophage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517616.1\|1978409_1978916_+	peroxiredoxin	A0A0C5AE74	Cyanophage	4.0e-24	41.6
WP_008650320.1\|1979069_1979987_+	UDP-3-O-acyl-N-acetylglucosamine deacetylase	NA	NA	NA	NA
WP_011517615.1\|1980134_1980638_-	DUF721 domain-containing protein	NA	NA	NA	NA
WP_011517614.1\|1980746_1981679_+	M23 family metallopeptidase	A0A292GJG6	Xanthomonas_phage	2.0e-24	47.2

DBSCAN-SWA_137

1999221 : 2000340

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008647250.1\|1999221_2000340_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	3.0e-64	43.9

DBSCAN-SWA_138

2003667 : 2005309

Ralstonia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517599.1\|2003667_2004423_+	lytic transglycosylase domain-containing protein	A0A1L7N0Z2	Ralstonia_phage	1.2e-08	35.6
WP_011517598.1\|2004427_2005309_+	hypothetical protein	A0A2N9QVW2	Dishui_lake_phycodnavirus	5.2e-19	34.6

DBSCAN-SWA_139

2016208 : 2023577

Pseudomonas_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517588.1\|2016208_2019148_+	ribonucleoside-diphosphate reductase subunit alpha	A0A2H4P767	Pseudomonas_phage	2.0e-168	43.8
WP_011517587.1\|2019288_2020476_+	ribonucleotide-diphosphate reductase subunit beta	C9DFZ8	Deftia_phage	2.4e-27	28.1
WP_029307157.1\|2020569_2021529_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011517585.1\|2021647_2022610_+	zinc-binding alcohol dehydrogenase family protein	NA	NA	NA	NA
WP_011517584.1\|2022638_2023577_-	recombination-associated protein RdgC	A0A218M310	Acidovorax_phage	3.2e-59	42.2

DBSCAN-SWA_140

2046853 : 2047594

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008645603.1\|2046853_2047594_+	3-oxoacyl-ACP reductase FabG	W8CYX9	Bacillus_phage	9.5e-06	40.8

DBSCAN-SWA_141

2056167 : 2056665

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517552.1\|2056167_2056665_-	CinA family protein	B5TK85	Pseudomonas_phage	7.0e-29	47.7

DBSCAN-SWA_142

2062381 : 2063518

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003056224.1\|2062381_2063518_+	DUF1016 domain-containing protein	A0A0U2BZN7	Salmonella_phage	5.1e-51	63.6

DBSCAN-SWA_143

2070288 : 2081844

Sphingobium_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003056217.1\|2070288_2070639_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	8.4e-29	60.0
WP_011517545.1\|2070702_2070981_+	hypothetical protein	NA	NA	NA	NA
WP_003056213.1\|2071123_2071423_-	hypothetical protein	NA	NA	NA	NA
WP_049799789.1\|2071570_2071792_-	hypothetical protein	NA	NA	NA	NA
WP_003056211.1\|2072358_2073186_+	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	2.4e-42	37.7
WP_003056209.1\|2073261_2075328_+	ParB/RepB/Spo0J family partition protein	NA	NA	NA	NA
WP_003056207.1\|2075390_2075600_+	hypothetical protein	NA	NA	NA	NA
WP_011517543.1\|2075730_2076249_-	N-acetyltransferase	A0A1P8CWJ6	Bacillus_phage	4.4e-10	32.8
WP_003056203.1\|2077070_2077385_+	DUF736 domain-containing protein	NA	NA	NA	NA
WP_003056202.1\|2077738_2078032_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_003056199.1\|2078255_2078603_+	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	7.1e-20	46.4
WP_011517541.1\|2078944_2079703_+	DUF2285 domain-containing protein	NA	NA	NA	NA
WP_023123353.1\|2079786_2080068_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_011517539.1\|2080094_2080952_+	replication initiator protein A	NA	NA	NA	NA
WP_003056189.1\|2081205_2081844_+	AAA family ATPase	B0ZSI1	Halomonas_phage	5.6e-31	39.6

DBSCAN-SWA_144

2087206 : 2090602

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517534.1\|2087206_2087872_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-23	32.4
WP_011517533.1\|2087875_2089288_+	two-component sensor histidine kinase	NA	NA	NA	NA
WP_003056165.1\|2089301_2090009_-	VIT family protein	NA	NA	NA	NA
WP_011517532.1\|2090050_2090602_-	cytochrome b	A0A0U2QLA7	Escherichia_phage	3.1e-17	42.1

DBSCAN-SWA_145

2098930 : 2099545

Shigella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517527.1\|2098930_2099545_+	recombinase family protein	A0A0C4UR34	Shigella_phage	6.0e-38	47.6

DBSCAN-SWA_146

2109216 : 2110056

Organic_Lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003056095.1\|2109216_2110056_+	phosphonate ABC transporter ATP-binding protein	F2Y302	Organic_Lake_phycodnavirus	3.6e-09	27.4

DBSCAN-SWA_147

2113294 : 2114833

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003056089.1\|2113294_2114833_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	6.1e-47	37.1

DBSCAN-SWA_148

2129276 : 2134979

Staphylococcus_phage(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517508.1\|2129276_2131898_+\|tRNA	leucine--tRNA ligase	A0A2H4PQS0	Staphylococcus_phage	1.3e-174	40.6
WP_008641875.1\|2131934_2132450_+	hypothetical protein	NA	NA	NA	NA
WP_011517507.1\|2132501_2133572_+	DNA polymerase III subunit delta	NA	NA	NA	NA
WP_011517506.1\|2133698_2134979_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	9.8e-83	43.6

DBSCAN-SWA_149

2147148 : 2148525

Bodo_saltans_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641901.1\|2147148_2148525_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	8.0e-107	46.5

DBSCAN-SWA_150

2157743 : 2162489

uncultured_Mediterranean_phage(100.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517487.1\|2157743_2158718_-	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	7.3e-46	37.3
WP_029310041.1\|2158742_2160608_-	protein translocase subunit SecD	NA	NA	NA	NA
WP_011517484.1\|2160812_2161139_-	preprotein translocase subunit YajC	A0A1B1IVR5	uncultured_Mediterranean_phage	1.3e-10	39.3
WP_008641921.1\|2161358_2162489_-\|tRNA	tRNA guanosine(34) transglycosylase Tgt	A0A1B1IVQ4	uncultured_Mediterranean_phage	3.7e-86	44.0

DBSCAN-SWA_151

2166011 : 2167898

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517481.1\|2166011_2166968_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	7.7e-08	23.1
WP_029307173.1\|2167135_2167327_+	hypothetical protein	NA	NA	NA	NA
WP_008641932.1\|2167412_2167898_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	5.2e-21	38.3

DBSCAN-SWA_152

2172841 : 2173336

Canarypox_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641942.1\|2172841_2173336_+	glutathione peroxidase	Q6VZR0	Canarypox_virus	4.7e-25	39.9

DBSCAN-SWA_153

2184131 : 2200840

Hokovirus(11.11%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517467.1\|2184131_2186078_+	molecular chaperone DnaK	A0A1V0SH73	Hokovirus	1.4e-144	49.5
WP_008641963.1\|2186252_2187392_+	molecular chaperone DnaJ	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	1.2e-23	35.5
WP_049799786.1\|2187475_2189371_+	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	1.1e-50	34.9
WP_011517465.1\|2189401_2190091_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-16	32.5
WP_011517464.1\|2190087_2190786_-	ABC transporter permease subunit	NA	NA	NA	NA
WP_011517463.1\|2190793_2191615_-	3-methyl-2-oxobutanoate hydroxymethyltransferase	A0A0P0BXC9	Ostreococcus_lucimarinus_virus	1.5e-36	33.3
WP_011517462.1\|2191751_2192393_-	deoxynucleoside kinase	A0A1J0F9Q3	Only_Syngen_Nebraska_virus	6.3e-06	27.0
WP_011517461.1\|2192416_2192938_-	2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase	NA	NA	NA	NA
WP_011517460.1\|2192939_2194529_-	polynucleotide adenylyltransferase PcnB	A0A1B0V011	Roseobacter_phage	4.5e-21	31.2
WP_011517459.1\|2194530_2195205_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_011517458.1\|2195328_2196036_-	DnaA regulatory inactivator Hda	NA	NA	NA	NA
WP_008641981.1\|2196228_2197281_+	phosphoribosylformylglycinamidine cyclo-ligase	Q58MH8	Prochlorococcus_phage	5.4e-71	45.3
WP_011517457.1\|2197352_2197844_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011517456.1\|2197908_2198856_-\|tRNA	tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA	NA	NA	NA	NA
WP_011517455.1\|2198872_2200840_-	DNA mismatch repair endonuclease MutL	A0A1B2LRQ5	Wolbachia_phage	4.4e-82	32.2

DBSCAN-SWA_154

2302178 : 2303483

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008644107.1\|2302178_2303483_+	sulfate adenylyltransferase subunit 1	A0A1V0SA87	Catovirus	1.9e-17	27.3

DBSCAN-SWA_155

2307202 : 2308735

Mycoplasma_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517376.1\|2307202_2308735_+	leucyl aminopeptidase	Q6GYZ8	Mycoplasma_phage	3.3e-53	41.2

DBSCAN-SWA_156

2320629 : 2322183

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517362.1\|2320629_2322183_+	malonyl-CoA synthase	A0A2H4PQM9	Staphylococcus_phage	1.4e-30	26.8

DBSCAN-SWA_157

2325425 : 2327441

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035820517.1\|2325425_2327441_+	TonB-dependent receptor	A0A0P0I887	Acinetobacter_phage	1.5e-05	34.6

DBSCAN-SWA_158

2337735 : 2338398

Halomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517348.1\|2337735_2338398_+	ParA family protein	B0ZSI1	Halomonas_phage	1.7e-14	29.0

DBSCAN-SWA_159

2349423 : 2352477

Indivirus(50.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517339.1\|2349423_2351496_-\|tRNA	methionine--tRNA ligase	A0A1V0SDF2	Indivirus	2.0e-53	27.2
WP_008651772.1\|2351841_2352477_-	OmpA family protein	G3M9Z0	Bacillus_virus	1.5e-07	37.4

DBSCAN-SWA_160

2358503 : 2365981

Escherichia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517333.1\|2358503_2361581_+	molybdopterin-dependent oxidoreductase	A0A077SK27	Escherichia_phage	2.0e-20	25.6
WP_011517332.1\|2361595_2362276_+	4Fe-4S dicluster domain-containing protein	NA	NA	NA	NA
WP_011517331.1\|2362272_2362506_+	hypothetical protein	NA	NA	NA	NA
WP_011517330.1\|2362525_2363719_+	formate dehydrogenase subunit gamma	NA	NA	NA	NA
WP_011517328.1\|2363816_2364392_+	superoxide dismutase family protein	Q0IKZ0	Leucania_separata_nucleopolyhedrovirus	2.6e-19	43.1
WP_011517327.1\|2364454_2365291_+	formate dehydrogenase accessory sulfurtransferase FdhD	NA	NA	NA	NA
WP_008646296.1\|2365414_2365981_+	dCTP deaminase	S5VM63	Pseudomonas_phage	9.0e-73	69.9

DBSCAN-SWA_161

2380184 : 2386452

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517319.1\|2380184_2381411_-	acyltransferase	A0A088CPR9	Enterobacteria_phage	5.5e-43	32.8
WP_011517318.1\|2381495_2383037_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.5e-58	29.7
WP_011517317.1\|2383102_2383819_+	pseudouridine synthase	NA	NA	NA	NA
WP_008646285.1\|2383906_2384479_+	YqgE/AlgH family protein	NA	NA	NA	NA
WP_029307246.1\|2384471_2384909_+	Holliday junction resolvase RuvX	NA	NA	NA	NA
WP_011517314.1\|2384905_2385430_+	bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR	NA	NA	NA	NA
WP_008646281.1\|2385480_2386452_+	aspartate carbamoyltransferase	A0A1J0F9B8	Only_Syngen_Nebraska_virus	3.6e-29	34.4

DBSCAN-SWA_162

2391183 : 2394599

Enterobacteria_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517309.1\|2391183_2392248_+	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	8.4e-88	48.5
WP_011517308.1\|2392237_2393158_+	dTDP-4-dehydrorhamnose reductase	A0A291LA50	Escherichia_phage	4.6e-26	34.3
WP_011517307.1\|2393169_2394048_+	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	3.7e-97	59.2
WP_011517306.1\|2394044_2394599_+	dTDP-4-dehydrorhamnose 3,5-epimerase	I7HJC4	Enterobacteria_phage	8.3e-55	59.2

DBSCAN-SWA_163

2397876 : 2404761

uncultured_marine_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517301.1\|2397876_2398995_+	glycosyltransferase family 4 protein	A0A0F7L8V0	uncultured_marine_virus	2.0e-07	33.9
WP_029309739.1\|2399050_2400196_+	glycosyltransferase family 4 protein	NA	NA	NA	NA
WP_011517299.1\|2400372_2400966_+	sugar transferase	NA	NA	NA	NA
WP_011517297.1\|2401639_2402815_+	DegT/DnrJ/EryC1/StrS aminotransferase family protein	A0A2K9L0G1	Tupanvirus	5.4e-104	46.6
WP_152560165.1\|2402886_2404761_+	NAD-dependent epimerase/dehydratase family protein	L7Y3T9	Megavirus	4.8e-14	23.0

DBSCAN-SWA_164

2412037 : 2413423

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517288.1\|2412037_2413423_+	phosphomannomutase/phosphoglucomutase	A0A127AWJ1	Bacillus_phage	1.4e-55	29.9

DBSCAN-SWA_165

2436576 : 2442701

Staphylococcus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517267.1\|2436576_2437086_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.1e-18	35.3
WP_011517266.1\|2437164_2438280_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.1e-53	36.5
WP_011517265.1\|2438515_2439550_+	CoA transferase	NA	NA	NA	NA
WP_104670064.1\|2439618_2440455_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011517263.1\|2440598_2440790_+	putative motility protein	NA	NA	NA	NA
WP_011517262.1\|2440919_2441552_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	3.5e-25	36.4
WP_011517261.1\|2441579_2442701_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.4e-47	33.5

DBSCAN-SWA_166

2448249 : 2449497

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029307301.1\|2448249_2449497_-	serine hydroxymethyltransferase	A0A219Y950	Aeromonas_phage	4.9e-95	52.1

DBSCAN-SWA_167

2455651 : 2459055

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517247.1\|2455651_2456335_+	7-cyano-7-deazaguanine synthase QueC	A0A126HGA1	Vibrio_phage	4.3e-21	32.9
WP_011517246.1\|2456405_2457521_+	YeeE/YedE family protein	NA	NA	NA	NA
WP_080710327.1\|2457891_2459055_+	site-specific DNA-methyltransferase	H9YPY1	environmental_Halophage	1.6e-47	32.2

DBSCAN-SWA_168

2464399 : 2466298

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517235.1\|2464399_2466298_+	DNA primase activity	A0A0M4R1L8	Mycobacterium_phage	2.6e-31	29.2

DBSCAN-SWA_169

2480898 : 2482140

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008646259.1\|2480898_2482140_-	class I SAM-dependent methyltransferase	A0A2I2L5L3	Orpheovirus	9.6e-43	35.9

DBSCAN-SWA_170

2487064 : 2506957

Bacillus_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085960491.1\|2487064_2487883_+\|tRNA	tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA	S4VW33	Pandoravirus	8.0e-14	34.4
WP_011517214.1\|2487871_2488450_-	ATP-binding protein	NA	NA	NA	NA
WP_011517213.1\|2488583_2489066_+	bacteriohemerythrin	NA	NA	NA	NA
WP_011517212.1\|2489097_2489940_-	thioredoxin	A0A1J0GW78	Streptomyces_phage	2.8e-14	40.8
WP_011517211.1\|2490174_2491875_+	long-chain fatty acid--CoA ligase	A0A1V0SBX8	Catovirus	3.0e-15	25.6
WP_080710328.1\|2491910_2492663_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_008649807.1\|2492741_2493509_-	gamma-glutamylcyclotransferase	NA	NA	NA	NA
WP_008649808.1\|2493696_2494017_+	hypothetical protein	NA	NA	NA	NA
WP_011517207.1\|2494125_2495025_-	UTP--glucose-1-phosphate uridylyltransferase GalU	A0A127AW70	Bacillus_phage	4.8e-68	46.5
WP_011517206.1\|2495139_2498007_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	5.1e-140	37.5
WP_011517205.1\|2498225_2500589_+	AAA family ATPase	A7KV33	Bacillus_phage	1.7e-104	35.3
WP_011517204.1\|2500640_2501444_-	hypothetical protein	NA	NA	NA	NA
WP_011517203.1\|2501450_2502437_-	homoserine kinase	NA	NA	NA	NA
WP_008649820.1\|2502606_2503026_-	DUF2782 domain-containing protein	NA	NA	NA	NA
WP_008649826.1\|2503200_2503920_-	TIGR00730 family Rossman fold protein	A0A1D8KU27	Synechococcus_phage	3.2e-22	39.6
WP_011517202.1\|2504152_2506957_+	DNA polymerase I	A0A218MKQ4	uncultured_virus	8.7e-68	30.7

DBSCAN-SWA_171

2520697 : 2528905

Moraxella_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649849.1\|2520697_2521738_-\|tRNA	tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex transferase subunit TsaD	A0A0R6PI74	Moraxella_phage	5.7e-97	54.0
WP_029309728.1\|2521887_2523129_+	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_008649856.1\|2523290_2523503_+	30S ribosomal protein S21	NA	NA	NA	NA
WP_011517189.1\|2523627_2524077_+	GatB/YqeY domain-containing protein	A0A292GL36	Xanthomonas_phage	3.8e-18	45.2
WP_011517187.1\|2524304_2526146_+	DNA primase	A0A1S5RG58	Helicobacter_phage	1.1e-47	33.3
WP_029307327.1\|2526228_2526609_-	hypothetical protein	NA	NA	NA	NA
WP_029309727.1\|2526625_2528905_+	RNA polymerase sigma factor RpoD	A0A2I7SAT0	Vibrio_phage	2.3e-34	30.5

DBSCAN-SWA_172

2540770 : 2542060

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517173.1\|2540770_2542060_+	hypothetical protein	M1PNR1	Moumouvirus	6.1e-16	41.0

DBSCAN-SWA_173

2555106 : 2556603

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029307339.1\|2555106_2556603_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.8e-49	32.2

DBSCAN-SWA_174

2563293 : 2563911

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517154.1\|2563293_2563911_+	oligoribonuclease	Q8B5Y0	Diachasmimorpha_longicaudata_entomopoxvirus	6.7e-29	39.5

DBSCAN-SWA_175

2567714 : 2569812

Ralstonia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517149.1\|2567714_2568215_-	dihydrofolate reductase	A0A0A8JB64	Ralstonia_phage	1.6e-28	46.1
WP_011517148.1\|2568211_2569006_-	thymidylate synthase	A6M9A2	Geobacillus_virus	9.6e-113	68.6
WP_011517147.1\|2569113_2569812_-	TerC family protein	W8EBD0	Pseudomonas_phage	1.2e-26	43.9

DBSCAN-SWA_176

2572935 : 2574840

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517144.1\|2572935_2574840_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.2e-48	31.8

DBSCAN-SWA_177

2581108 : 2582657

Ralstonia_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517133.1\|2581108_2581318_+	hypothetical protein	A0A2D2W511	Ralstonia_phage	3.7e-08	51.6
WP_085959070.1\|2581459_2582657_+\|transposase	IS3-like element IS1087B family transposase	A0A1B0Z042	Pseudomonas_phage	6.5e-97	61.9

DBSCAN-SWA_178

2593300 : 2593630

Acinetobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517120.1\|2593300_2593630_-	multidrug transporter	E5E3Y9	Acinetobacter_phage	4.1e-09	30.8

DBSCAN-SWA_179

2614082 : 2615633

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517101.1\|2614082_2615633_+	long-chain-fatty-acid--CoA ligase	A0A2H4PQM9	Staphylococcus_phage	1.8e-35	24.4

DBSCAN-SWA_180

2618742 : 2630881

Bacillus_virus(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517099.1\|2618742_2620668_+	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.3e-43	28.7
WP_011517098.1\|2620864_2622076_-	MFS transporter	NA	NA	NA	NA
WP_008649957.1\|2622277_2624272_+	type IIA DNA topoisomerase subunit B	G3M9Z3	Bacillus_virus	4.9e-89	33.5
WP_029307360.1\|2624341_2625127_+	transglycosylase SLT domain-containing protein	K4NWI2	Pseudomonas_phage	2.5e-12	34.6
WP_011517095.1\|2625281_2627612_+	DNA topoisomerase IV subunit A	G3M9Z5	Bacillus_virus	7.7e-78	36.1
WP_011517094.1\|2627931_2628513_+	chromate transporter	NA	NA	NA	NA
WP_011517093.1\|2628509_2629040_+	chromate transporter	NA	NA	NA	NA
WP_011517092.1\|2629048_2630881_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.6e-28	25.9

DBSCAN-SWA_181

2640392 : 2642294

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008648084.1\|2640392_2642294_+	molecular chaperone HtpG	A0A1B1ISV4	uncultured_Mediterranean_phage	9.9e-116	36.0

DBSCAN-SWA_182

2671746 : 2673215

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649372.1\|2671746_2672514_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-15	26.0
WP_011517064.1\|2672513_2673215_+	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.3e-16	28.6

DBSCAN-SWA_183

2684507 : 2685443

Phaeocystis_globosa_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517056.1\|2684507_2685443_+	site-specific DNA-methyltransferase	R4THJ7	Phaeocystis_globosa_virus	9.8e-32	31.2

DBSCAN-SWA_184

2690314 : 2694908

Mollivirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008648427.1\|2690314_2691847_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	1.4e-83	40.5
WP_011517050.1\|2691883_2693092_+	O-succinylhomoserine sulfhydrylase	S4VRH6	Pandoravirus	7.0e-14	30.2
WP_011517049.1\|2693137_2693995_-	nodulation protein NodJ	NA	NA	NA	NA
WP_011517048.1\|2693996_2694908_-	Nod factor export ATP-binding protein I	W6JKT0	Anomala_cuprea_entomopoxvirus	1.3e-28	26.5

DBSCAN-SWA_185

2698251 : 2705262

Bacillus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008648409.1\|2698251_2699355_-	NAD(P)/FAD-dependent oxidoreductase	G3MA85	Bacillus_virus	4.7e-17	26.7
WP_008648407.1\|2699431_2699755_-	ferredoxin family protein	NA	NA	NA	NA
WP_011517043.1\|2700173_2700704_+	hypothetical protein	NA	NA	NA	NA
WP_029307390.1\|2700791_2701970_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	2.5e-56	35.4
WP_011517041.1\|2702045_2702732_+	lactate utilization protein C	NA	NA	NA	NA
WP_011517040.1\|2702830_2704261_+	sodium:proton antiporter	NA	NA	NA	NA
WP_029307391.1\|2704266_2705262_+	D-glycerate dehydrogenase	M1I1Q8	Acanthocystis_turfacea_Chlorella_virus	9.4e-17	27.2

DBSCAN-SWA_186

2714737 : 2718047

Bodo_saltans_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029310031.1\|2714737_2715748_+	RluA family pseudouridine synthase	A0A2H4UV25	Bodo_saltans_virus	5.8e-06	27.6
WP_011517032.1\|2715806_2716466_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_011517031.1\|2716458_2716842_+	Rieske 2Fe-2S domain-containing protein	NA	NA	NA	NA
WP_011517030.1\|2716883_2718047_+	S49 family peptidase	A0A219YA27	Aeromonas_phage	1.8e-11	30.5

DBSCAN-SWA_187

2723882 : 2735063

Trichoplusia_ni_ascovirus(16.67%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011517022.1\|2723882_2724632_+	3-oxoacyl-ACP reductase FabG	Q06VL0	Trichoplusia_ni_ascovirus	3.4e-19	31.7
WP_008644813.1\|2724801_2725041_+	acyl carrier protein	B2ZXV3	Ralstonia_phage	1.4e-11	45.9
WP_011517021.1\|2725252_2726485_+	beta-ketoacyl-ACP synthase II	NA	NA	NA	NA
WP_008644807.1\|2726740_2727340_+	RNA polymerase sigma factor RpoE	A0A0F6TH34	Sinorhizobium_phage	2.0e-06	28.7
WP_011517020.1\|2727476_2728133_+	anti-sigma factor	NA	NA	NA	NA
WP_011517019.1\|2728141_2729221_+	sugar dehydratase	NA	NA	NA	NA
WP_011517017.1\|2729350_2730856_+\|protease	DegQ family serine endoprotease	A0A1B1IT49	uncultured_Mediterranean_phage	2.5e-21	30.2
WP_011517015.1\|2731103_2732897_+	elongation factor 4	E4ZFJ7	Streptococcus_phage	1.4e-23	24.0
WP_011517014.1\|2732942_2733842_+	signal peptidase I	NA	NA	NA	NA
WP_029307403.1\|2733940_2734288_+	DUF4845 domain-containing protein	NA	NA	NA	NA
WP_008644793.1\|2734292_2735063_+	ribonuclease III	A0A2P0VNZ5	Tetraselmis_virus	1.6e-16	41.3

DBSCAN-SWA_188

2764432 : 2772416

Bacillus_virus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003149817.1\|2764432_2765056_-	cytochrome c biogenesis heme-transporting ATPase CcmA	G3M9Y6	Bacillus_virus	1.5e-07	27.4
WP_003149815.1\|2765224_2765893_+	response regulator	NA	NA	NA	NA
WP_011516271.1\|2766966_2767995_-\|transposase	IS30-like element IS1088 family transposase	W5R8L2	Staphylococcus_phage	3.0e-42	35.6
WP_003149811.1\|2768534_2770133_-	apolipoprotein N-acyltransferase	NA	NA	NA	NA
WP_011517003.1\|2770157_2772416_-	cation-translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.8e-48	27.1

DBSCAN-SWA_189

2803458 : 2805433

Acidithiobacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003050245.1\|2803458_2803929_+	helix-turn-helix domain-containing protein	K4ICM4	Acidithiobacillus_phage	5.2e-34	53.5
WP_003153636.1\|2803925_2804501_+	PIN domain-containing protein	K4HZX4	Acidithiobacillus_phage	2.3e-55	58.0
WP_003050256.1\|2804518_2805433_+	AAA family ATPase	A0A0K1Y7P8	Apis_mellifera_filamentous_virus	4.0e-06	29.0

DBSCAN-SWA_190

2824012 : 2829828

Yersinia_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003116824.1\|2824012_2824840_-	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	2.3e-45	36.8
WP_003116825.1\|2824985_2825891_-	DUF3577 domain-containing protein	NA	NA	NA	NA
WP_003098923.1\|2826201_2826486_-	hypothetical protein	Q6JIG5	Burkholderia_virus	2.1e-30	73.8
WP_031629745.1\|2826793_2827078_-	DUF3085 domain-containing protein	NA	NA	NA	NA
WP_003098932.1\|2828139_2829828_-	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	3.0e-39	28.8

DBSCAN-SWA_191

2836524 : 2844392

Streptococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005408895.1\|2836524_2839479_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	1.5e-150	43.3
WP_003098965.1\|2839528_2839927_+	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_003098972.1\|2841002_2841638_+	cation transporter	NA	NA	NA	NA
WP_003116834.1\|2842361_2844392_-	DNA topoisomerase III	A0A0G2Y4W4	Acanthamoeba_polyphaga_mimivirus	1.5e-13	23.0

DBSCAN-SWA_192

2850676 : 2851552

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003098988.1\|2850676_2851552_-	ParA family protein	W8EH12	Mycobacterium_phage	9.5e-05	31.3

DBSCAN-SWA_193

2862304 : 2874917

Apis_mellifera_filamentous_virus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516980.1\|2862304_2864620_+	AAA family ATPase	A0A0K1Y7P8	Apis_mellifera_filamentous_virus	9.9e-09	32.5
WP_011516979.1\|2864609_2865422_-	glutamate racemase	NA	NA	NA	NA
WP_008642400.1\|2865598_2867122_-	fumarate hydratase	NA	NA	NA	NA
WP_011516977.1\|2867274_2867829_-	TIGR00645 family protein	K4K6D8	Caulobacter_phage	2.9e-23	33.0
WP_011516976.1\|2867922_2868849_-	DMT family transporter	NA	NA	NA	NA
WP_011516974.1\|2869145_2871128_+	acetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.6e-79	43.0
WP_011516973.1\|2871236_2873288_+	cation acetate symporter	NA	NA	NA	NA
WP_011515352.1\|2873666_2874917_+\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8

DBSCAN-SWA_194

2880029 : 2880743

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516964.1\|2880029_2880743_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	7.2e-19	40.8

DBSCAN-SWA_195

2884998 : 2887572

Acanthocystis_turfacea_chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516958.1\|2884998_2887572_-	UDP-forming cellulose synthase catalytic subunit	A7KA83	Acanthocystis_turfacea_chlorella_virus	4.0e-27	31.6

DBSCAN-SWA_196

2902424 : 2903705

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516948.1\|2902424_2903705_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.9e-09	34.8

DBSCAN-SWA_197

2912251 : 2914478

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516940.1\|2912251_2913376_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-12	26.3
WP_011516939.1\|2913377_2914478_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.0e-16	27.9

DBSCAN-SWA_198

2919778 : 2921743

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_035821978.1\|2919778_2921743_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.2e-16	34.9

DBSCAN-SWA_199

2926779 : 2927568

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516928.1\|2926779_2927568_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.7e-30	33.5

DBSCAN-SWA_200

2937073 : 2941816

Acanthocystis_turfacea_Chlorella_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516918.1\|2937073_2939812_-	cation-transporting P-type ATPase	M1IAU8	Acanthocystis_turfacea_Chlorella_virus	2.2e-76	28.1
WP_011516916.1\|2940630_2941356_-	DNA polymerase III subunit epsilon	A0A1X9SH08	Bradyrhizobium_phage	9.9e-40	40.8
WP_011516915.1\|2941378_2941816_-	ribonuclease HI	H8ZJH4	Ostreococcus_tauri_virus	1.5e-30	46.8

DBSCAN-SWA_201

2946503 : 2948393

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516910.1\|2946503_2948393_+	propionate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.9e-58	30.9

DBSCAN-SWA_202

2953793 : 2957795

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516905.1\|2953793_2955455_+	AMP-binding protein	A0A2H4PQU7	Staphylococcus_phage	3.4e-51	30.6
WP_011516904.1\|2955457_2955877_+	acyl-CoA thioesterase	NA	NA	NA	NA
WP_011516903.1\|2955912_2956326_+	RidA family protein	NA	NA	NA	NA
WP_011516902.1\|2956646_2957795_+	glutamine-hydrolyzing carbamoyl-phosphate synthase small subunit	R4TGJ8	Halovirus	2.5e-45	32.2

DBSCAN-SWA_203

2964639 : 2975990

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008641654.1\|2964639_2966541_+	ATP-dependent metallopeptidase FtsH/Yme1/Tma family protein	M4QMW8	Micromonas_pusilla_virus	2.8e-110	41.3
WP_011516894.1\|2966653_2967523_+	dihydropteroate synthase	A0A0B5J4J5	Pandoravirus	1.1e-26	36.0
WP_011516893.1\|2967528_2968872_+	phosphoglucosamine mutase	NA	NA	NA	NA
WP_011516892.1\|2969175_2970207_+	phosphate ABC transporter substrate-binding protein PstS	A0A222YW41	Synechococcus_phage	5.7e-49	38.6
WP_011516891.1\|2970320_2971286_+	phosphate ABC transporter permease PstC	NA	NA	NA	NA
WP_011516890.1\|2971282_2972185_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_008641660.1\|2972206_2972995_+	phosphate ABC transporter ATP-binding protein PstB	W8CYL7	Bacillus_phage	9.1e-15	32.4
WP_008641661.1\|2973065_2973770_+	phosphate signaling complex protein PhoU	NA	NA	NA	NA
WP_008641662.1\|2973806_2974514_+	phosphate regulon transcriptional regulatory protein PhoB	W8CYM9	Bacillus_phage	7.9e-34	39.8
WP_011516889.1\|2974637_2975990_+	phosphate regulon sensor histidine kinase PhoR	W8CYF6	Bacillus_phage	6.8e-34	36.2

DBSCAN-SWA_204

2983229 : 2984480

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516882.1\|2983229_2984480_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.5e-16	34.9

DBSCAN-SWA_205

3008687 : 3011081

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_049799783.1\|3008687_3011081_-	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	4.9e-35	28.6

DBSCAN-SWA_206

3018653 : 3020627

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516855.1\|3018653_3020627_-	MBL fold metallo-hydrolase	A0A2P0VMX1	Tetraselmis_virus	9.3e-141	43.8

DBSCAN-SWA_207

3026753 : 3030525

Planktothrix_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516850.1\|3026753_3028403_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-22	32.5
WP_008641698.1\|3028760_3029441_+	C40 family peptidase	B6V2P9	Bacillus_phage	4.0e-19	39.3
WP_011516849.1\|3029574_3030525_-	patatin-like phospholipase family protein	A0A1X7QFZ0	Faustovirus	2.2e-07	29.2

DBSCAN-SWA_208

3039593 : 3039920

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008647939.1\|3039593_3039920_-	thioredoxin TrxA	A0A1J0GW78	Streptomyces_phage	8.1e-18	45.2

DBSCAN-SWA_209

3047600 : 3052583

Loktanella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516841.1\|3047600_3050099_+	adenosylcobalamin-dependent ribonucleoside-diphosphate reductase	M4QT32	Loktanella_phage	1.9e-154	41.1
WP_011516840.1\|3050195_3052583_+	DNA polymerase III subunit gamma/tau	A0A1L2BWV7	Bacteriophage	4.8e-43	39.2

DBSCAN-SWA_210

3059240 : 3070625

uncultured_Mediterranean_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516834.1\|3059240_3060053_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.6e-33	36.6
WP_011516833.1\|3060080_3060872_+	ABC transporter permease	NA	NA	NA	NA
WP_029309763.1\|3060940_3061915_-	NADPH:quinone oxidoreductase family protein	NA	NA	NA	NA
WP_011516831.1\|3062093_3062846_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	3.6e-69	51.6
WP_011516830.1\|3062934_3063843_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.7e-33	47.8
WP_011516829.1\|3063851_3064739_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	1.3e-06	33.3
WP_011516828.1\|3064745_3065906_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.4e-32	34.8
WP_011516827.1\|3065902_3066739_+	3'-5' exonuclease	NA	NA	NA	NA
WP_011516826.1\|3066740_3067595_-	endonuclease	NA	NA	NA	NA
WP_029309762.1\|3067685_3069086_+	23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD	A0A2K5B251	Erysipelothrix_phage	6.6e-24	25.3
WP_011516824.1\|3069151_3069859_-	Bax inhibitor-1/YccA family protein	NA	NA	NA	NA
WP_011516823.1\|3070199_3070625_+	nucleoside-diphosphate kinase	A0A167REB2	Powai_lake_megavirus	3.9e-20	42.1

DBSCAN-SWA_211

3085587 : 3094460

Megavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516809.1\|3085587_3086931_+	adenylosuccinate synthase	G5CQQ4	Megavirus	6.0e-75	36.7
WP_029307566.1\|3087057_3087627_+	phosphoribosyltransferase	NA	NA	NA	NA
WP_011516807.1\|3087756_3088368_-	NAD(P)-dependent oxidoreductase	NA	NA	NA	NA
WP_011516806.1\|3088431_3088866_-	Rrf2 family transcriptional regulator	NA	NA	NA	NA
WP_011516805.1\|3089285_3091916_+	ribonuclease R	Q0GXV6	Lactococcus_phage	3.0e-70	33.2
WP_011516804.1\|3091959_3092703_+	23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB	NA	NA	NA	NA
WP_011516803.1\|3092705_3093440_+	NAD-dependent deacylase	H6W7Z8	Escherichia_phage	4.2e-14	30.5
WP_011516802.1\|3093503_3094460_-	transaldolase	M4QQ61	Prochlorococcus_phage	2.1e-13	34.1

DBSCAN-SWA_212

3106960 : 3108514

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516788.1\|3106960_3108514_-	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	3.7e-20	46.5

DBSCAN-SWA_213

3117109 : 3122179

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516782.1\|3117109_3121060_+	ATP-dependent RNA helicase HrpA	A0A1V0SBU4	Catovirus	3.6e-51	28.9
WP_011516781.1\|3121192_3122179_+	beta-propeller fold lactonase family protein	A0A2H4JCI3	uncultured_Caudovirales_phage	9.4e-17	67.3

DBSCAN-SWA_214

3129018 : 3130182

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516771.1\|3129018_3130182_+	signal transduction histidine kinase	Q8QKV7	Ectocarpus_siliculosus_virus	1.2e-07	24.6

DBSCAN-SWA_215

3138222 : 3140060

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516763.1\|3138222_3139326_+	sn-glycerol-3-phosphate import ATP-binding protein UgpC	G9BWD6	Planktothrix_phage	2.0e-23	32.3
WP_011516762.1\|3139322_3140060_+	glycerophosphodiester phosphodiesterase	A0A1J0F961	Only_Syngen_Nebraska_virus	3.4e-19	32.3

DBSCAN-SWA_216

3144671 : 3150011

Erysipelothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516759.1\|3144671_3146096_+	dihydrolipoyl dehydrogenase	A0A2K5B2C5	Erysipelothrix_phage	8.1e-46	29.2
WP_011516758.1\|3146181_3147279_+	cell division protein ZapE	NA	NA	NA	NA
WP_011516756.1\|3147425_3150011_+	heavy metal translocating P-type ATPase	A0A218MNH6	uncultured_virus	2.8e-76	30.5

DBSCAN-SWA_217

3157835 : 3158744

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516749.1\|3157835_3158744_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	7.3e-24	34.7

DBSCAN-SWA_218

3163040 : 3198202

Bodo_saltans_virus(20.0%)

transposase,integrase,capsid,tRNA

attL 3184548:3184607|attR 3194265:3197346

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516746.1\|3163040_3165980_+	translation initiation factor IF-2	A0A2H4UTS4	Bodo_saltans_virus	5.8e-22	23.8
WP_011516745.1\|3166044_3166416_+	30S ribosome-binding factor RbfA	NA	NA	NA	NA
WP_011516744.1\|3166475_3167420_+\|tRNA	tRNA pseudouridine(55) synthase TruB	NA	NA	NA	NA
WP_011516743.1\|3167494_3169108_-	DHA2 family efflux MFS transporter permease subunit	NA	NA	NA	NA
WP_011516742.1\|3169127_3170369_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_035820801.1\|3170415_3171930_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_035820798.1\|3172000_3172507_-	MarR family transcriptional regulator	NA	NA	NA	NA
WP_011516738.1\|3172702_3174526_+	translational GTPase TypA	NA	NA	NA	NA
WP_035820795.1\|3174612_3175524_-	sterol desaturase family protein	NA	NA	NA	NA
WP_029309788.1\|3175669_3176752_+	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_011516735.1\|3176845_3177406_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	6.1e-13	34.0
WP_029310307.1\|3177904_3178249_-	hypothetical protein	NA	NA	NA	NA
WP_011516733.1\|3178389_3178794_+	hypothetical protein	NA	NA	NA	NA
WP_152560298.1\|3178831_3179419_-	hypothetical protein	NA	NA	NA	NA
WP_080710403.1\|3179366_3180302_+	DUF2971 domain-containing protein	NA	NA	NA	NA
WP_152560299.1\|3180367_3180949_-	hypothetical protein	NA	NA	NA	NA
WP_035822924.1\|3181205_3182546_-\|capsid	phage major capsid protein	A0A0R6PHC6	Moraxella_phage	3.0e-58	35.0
WP_011516728.1\|3182923_3183220_-	hypothetical protein	NA	NA	NA	NA
WP_011516727.1\|3183236_3183527_-	hypothetical protein	NA	NA	NA	NA
WP_011516726.1\|3183519_3183876_-	hypothetical protein	NA	NA	NA	NA
WP_011516725.1\|3183982_3184462_-	hypothetical protein	NA	NA	NA	NA
3184548:3184607	attL	NA	NA	NA	NA
WP_008651547.1\|3184734_3185007_-	hypothetical protein	NA	NA	NA	NA
WP_008651548.1\|3185003_3185837_-	AAA family ATPase	NA	NA	NA	NA
WP_008651549.1\|3185833_3187273_-\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_124682078.1\|3187384_3187930_-\|transposase	transposase	NA	NA	NA	NA
WP_011516724.1\|3188055_3188922_-	hypothetical protein	NA	NA	NA	NA
WP_011516723.1\|3188924_3189227_-	hypothetical protein	NA	NA	NA	NA
WP_011516722.1\|3189234_3189627_-	hypothetical protein	NA	NA	NA	NA
WP_011516721.1\|3189734_3190340_-	hypothetical protein	NA	NA	NA	NA
WP_155877854.1\|3190336_3191242_-\|integrase	tyrosine-type recombinase/integrase	K7PHM9	Enterobacterial_phage	5.0e-17	37.3
WP_008651549.1\|3191598_3193038_+\|transposase	IS481 family transposase	NA	NA	NA	NA
WP_008651548.1\|3193034_3193868_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|3193864_3194137_+	hypothetical protein	NA	NA	NA	NA
WP_029310228.1\|3194315_3195155_-	DUF4102 domain-containing protein	NA	NA	NA	NA
WP_011516719.1\|3195737_3196184_-	phosphate-starvation-inducible PsiE family protein	NA	NA	NA	NA
WP_152560283.1\|3196700_3196988_-	hypothetical protein	NA	NA	NA	NA
WP_085959070.1\|3197003_3198202_-\|transposase	IS3-like element IS1087B family transposase	A0A1B0Z042	Pseudomonas_phage	6.5e-97	61.9
3194265:3197346	attR	NA	NA	NA	NA

DBSCAN-SWA_219

3206746 : 3216580

Faecalibacterium_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516701.1\|3206746_3207403_-	transcriptional repressor LexA	A0A2K9V3G4	Faecalibacterium_phage	2.0e-15	33.3
WP_011516700.1\|3207608_3208610_+	asparaginase	NA	NA	NA	NA
WP_008650672.1\|3208727_3209102_+	30S ribosomal protein S6	NA	NA	NA	NA
WP_011516699.1\|3209122_3209422_+	primosomal replication protein N	NA	NA	NA	NA
WP_006163606.1\|3209425_3209704_+	30S ribosomal protein S18	NA	NA	NA	NA
WP_011516698.1\|3209734_3210187_+	50S ribosomal protein L9	NA	NA	NA	NA
WP_011516697.1\|3210307_3211699_+	replicative DNA helicase	C7BGG1	Burkholderia_phage	2.6e-137	58.5
WP_008650676.1\|3211849_3212476_+	DUF47 domain-containing protein	NA	NA	NA	NA
WP_008650677.1\|3212489_3213500_+	inorganic phosphate transporter	NA	NA	NA	NA
WP_011516696.1\|3213560_3214199_-	C40 family peptidase	A0A1V0DZX6	Clostridioides_phage	3.4e-20	39.3
WP_011516695.1\|3214247_3214724_-	hypothetical protein	NA	NA	NA	NA
WP_011516694.1\|3214885_3216580_-	AAA family ATPase	A0A2I7SAD7	Vibrio_phage	2.3e-71	36.4

DBSCAN-SWA_220

3224482 : 3230114

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008645434.1\|3224482_3224863_+	fluoride efflux transporter CrcB	A0A2H4J148	uncultured_Caudovirales_phage	2.5e-26	50.5
WP_011516685.1\|3225140_3227309_+	D-(-)-3-hydroxybutyrate oligomer hydrolase	NA	NA	NA	NA
WP_011516684.1\|3227525_3230114_+	ATP-dependent chaperone ClpB	A0A223W0B1	Agrobacterium_phage	2.9e-118	33.1

DBSCAN-SWA_221

3241535 : 3245178

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516677.1\|3241535_3242825_-	MFS transporter	Q6JIH2	Burkholderia_virus	5.8e-67	37.8
WP_011516675.1\|3243079_3244429_-	HAMP domain-containing protein	NA	NA	NA	NA
WP_006576352.1\|3244455_3245178_-	two-component system response regulator OmpR	W8CYM9	Bacillus_phage	1.4e-33	35.8

DBSCAN-SWA_222

3256650 : 3258760

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516666.1\|3256650_3257664_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.9e-19	33.3
WP_011516665.1\|3257680_3258760_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.1e-16	29.8

DBSCAN-SWA_223

3272552 : 3274205

Enterococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516654.1\|3272552_3274205_+	FAD-binding protein	A0A249XZT7	Enterococcus_phage	1.3e-18	27.2

DBSCAN-SWA_224

3289790 : 3290528

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516636.1\|3289790_3290528_-	sterol desaturase family protein	A0A2K9L1K6	Tupanvirus	7.9e-61	48.3

DBSCAN-SWA_225

3293752 : 3295465

Ostreococcus_lucimarinus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516630.1\|3293752_3295465_+	pyruvate oxidase	A0A0P0CDR3	Ostreococcus_lucimarinus_virus	9.2e-20	22.4

DBSCAN-SWA_226

3310949 : 3315816

Agrobacterium_phage(33.33%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008651661.1\|3310949_3311600_+	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	A0A223W000	Agrobacterium_phage	4.1e-53	54.1
WP_011516610.1\|3311880_3313158_+\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.0e-132	57.0
WP_011516609.1\|3313404_3315816_+	endopeptidase La	A0A0R6PGP8	Moraxella_phage	2.0e-225	52.6

DBSCAN-SWA_227

3319254 : 3319953

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029307819.1\|3319254_3319953_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.9e-20	35.4

DBSCAN-SWA_228

3329511 : 3342912

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516598.1\|3329511_3331272_-	cellulose biosynthesis regulator YedQ	A0A127AWB9	Bacillus_phage	1.3e-16	32.1
WP_011516596.1\|3331551_3332139_+	winged helix DNA-binding protein	NA	NA	NA	NA
WP_011516594.1\|3332366_3336413_+	phosphoribosylformylglycinamidine synthase	A9YX36	Burkholderia_phage	4.5e-182	74.4
WP_011516593.1\|3336541_3336889_-	hypothetical protein	NA	NA	NA	NA
WP_008650253.1\|3337078_3337873_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011516592.1\|3337877_3338192_-	BolA family transcriptional regulator	NA	NA	NA	NA
WP_008650249.1\|3338243_3338783_-	septation protein A	NA	NA	NA	NA
WP_008650248.1\|3338878_3339286_-	peptide-methionine (R)-S-oxide reductase MsrB	NA	NA	NA	NA
WP_029310112.1\|3339334_3340885_-	YdiU family protein	A0A075BSJ0	Microcystis_phage	6.8e-38	28.0
WP_029307825.1\|3341286_3342912_+	fatty-acid--CoA ligase	A0A1V0SBX8	Catovirus	1.4e-17	21.9

DBSCAN-SWA_229

3346689 : 3348179

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516586.1\|3346689_3347469_+	ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	7.4e-09	25.1
WP_011516585.1\|3347465_3348179_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.4e-14	25.4

DBSCAN-SWA_230

3363622 : 3364144

Scale_drop_disease_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008650222.1\|3363622_3364144_-	O-acetyl-ADP-ribose deacetylase	A0A0K1L687	Scale_drop_disease_virus	6.4e-33	43.9

DBSCAN-SWA_231

3370402 : 3383101

Escherichia_phage(42.86%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516566.1\|3370402_3371041_-	aldolase	A0A077SK32	Escherichia_phage	5.8e-44	49.5
WP_011516565.1\|3371037_3372306_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.2e-93	48.8
WP_011516564.1\|3372328_3373225_-	NAD-binding protein	A0A077SLF7	Escherichia_phage	2.9e-81	56.1
WP_011516563.1\|3373284_3374028_-	FadR family transcriptional regulator	NA	NA	NA	NA
WP_011516562.1\|3374205_3374649_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011516561.1\|3374672_3375527_-	hypothetical protein	A0A0M3ZEJ9	Turkeypox_virus	4.1e-29	32.0
WP_011516560.1\|3375605_3375896_-	DUF4936 family protein	NA	NA	NA	NA
WP_011516559.1\|3375915_3376926_-	folate-binding protein YgfZ	NA	NA	NA	NA
WP_011516558.1\|3377112_3378111_+	endolytic transglycosylase MltG	NA	NA	NA	NA
WP_011516557.1\|3378115_3378718_+	dTMP kinase	A0A1L2BX49	Bacteriophage	3.3e-25	37.8
WP_011516556.1\|3378804_3379818_+	DNA polymerase III subunit delta'	A0A1U9WR94	Streptococcus_virus	6.5e-05	30.8
WP_011516555.1\|3379923_3380334_+	type IV fimbrial biogenesis protein PilZ	NA	NA	NA	NA
WP_011516554.1\|3380499_3381297_+	TatD family hydrolase	NA	NA	NA	NA
WP_017513406.1\|3381289_3382006_+	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_011516552.1\|3382063_3383101_-	J domain-containing protein	A0A0P0YMJ9	Yellowstone_lake_phycodnavirus	4.6e-06	41.3

DBSCAN-SWA_232

3417707 : 3418412

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516521.1\|3417707_3418412_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.9e-35	39.4

DBSCAN-SWA_233

3434971 : 3436363

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516507.1\|3434971_3436363_-	FAD-binding oxidoreductase	S4VRT3	Pandoravirus	5.3e-34	27.9

DBSCAN-SWA_234

3447867 : 3453327

Moraxella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516494.1\|3447867_3449460_+	TerC family protein	A0A0R6PEZ3	Moraxella_phage	1.3e-36	43.5
WP_104670233.1\|3449505_3450114_-	hypothetical protein	NA	NA	NA	NA
WP_011516492.1\|3450445_3451354_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_011516491.1\|3451662_3453327_-	ATP-binding cassette domain-containing protein	A0A2K9L3Z8	Tupanvirus	2.0e-59	31.0

DBSCAN-SWA_235

3459767 : 3465227

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516483.1\|3459767_3461177_-	heavy metal sensor histidine kinase	W8CYF6	Bacillus_phage	1.9e-18	27.9
WP_011516482.1\|3461176_3461851_-	heavy metal response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-36	37.0
WP_011516481.1\|3462029_3465227_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.3e-62	22.0

DBSCAN-SWA_236

3477454 : 3479431

Acanthocystis_turfacea_Chlorella_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516469.1\|3477454_3479431_+	glycosyltransferase	M1HVH2	Acanthocystis_turfacea_Chlorella_virus	3.1e-27	27.9

DBSCAN-SWA_237

3501440 : 3503087

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516451.1\|3501440_3503087_-	fatty acid--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.0e-23	25.4

DBSCAN-SWA_238

3516350 : 3521615

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516435.1\|3516350_3519542_-	multidrug efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.7e-59	23.0
WP_011516434.1\|3519538_3520777_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_011516433.1\|3520856_3521111_-	RNA-binding protein	NA	NA	NA	NA
WP_011516432.1\|3521240_3521615_-	response regulator	A0A1J0GWE0	Alteromonas_phage	4.1e-05	34.9

DBSCAN-SWA_239

3532909 : 3534385

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152560158.1\|3532909_3534385_-	diguanylate cyclase	G3MA91	Bacillus_virus	1.1e-24	36.6

DBSCAN-SWA_240

3538142 : 3544850

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516413.1\|3538142_3540902_+	ribosome-associated ATPase/putative transporter RbbA	A0A2H4PQG7	Staphylococcus_phage	3.3e-19	28.4
WP_029309709.1\|3540970_3542095_+	ABC transporter permease	NA	NA	NA	NA
WP_011516411.1\|3542181_3543417_-	MFS transporter	NA	NA	NA	NA
WP_011516410.1\|3543707_3544850_+	3-deoxy-7-phosphoheptulonate synthase	A0A0B5IW14	Pandoravirus	1.3e-81	47.2

DBSCAN-SWA_241

3557047 : 3557718

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155877858.1\|3557047_3557718_-\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	5.0e-38	44.2

DBSCAN-SWA_242

3567091 : 3567761

Escherichia_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_155877859.1\|3567091_3567761_+\|transposase	IS6 family transposase	A0A077SL39	Escherichia_phage	6.5e-38	44.2

DBSCAN-SWA_243

3574507 : 3575206

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516380.1\|3574507_3575206_+	two-component system response regulator CreB	W8CYM9	Bacillus_phage	1.2e-29	34.2

DBSCAN-SWA_244

3582289 : 3584659

Yellowstone_lake_phycodnavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516373.1\|3582289_3584659_+	DNA polymerase II	A0A0P0YM26	Yellowstone_lake_phycodnavirus	1.0e-29	24.6

DBSCAN-SWA_245

3606904 : 3608341

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516355.1\|3606904_3608341_+	sensor histidine kinase	W8CYF6	Bacillus_phage	5.5e-18	25.3

DBSCAN-SWA_246

3613209 : 3627264

Tupanvirus(16.67%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516350.1\|3613209_3614283_-	histone deacetylase family protein	A0A2K9L0J7	Tupanvirus	3.5e-41	32.0
WP_011516349.1\|3614330_3616034_-	thiamine pyrophosphate-binding protein	A0A0P0YLY7	Yellowstone_lake_phycodnavirus	1.2e-35	26.6
WP_011516348.1\|3616030_3616330_-	cupin	NA	NA	NA	NA
WP_011516347.1\|3616352_3617615_-	4-aminobutyrate--2-oxoglutarate transaminase	A0A1V0SKB7	Klosneuvirus	2.0e-27	28.5
WP_011516346.1\|3617657_3619301_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.4e-20	30.8
WP_011516345.1\|3619312_3620152_-	ABC transporter permease	NA	NA	NA	NA
WP_024569757.1\|3620148_3621153_-	ABC transporter permease	NA	NA	NA	NA
WP_085960481.1\|3622134_3623320_+\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7
WP_011516342.1\|3624212_3625556_-	ArgE/DapE family deacylase	NA	NA	NA	NA
WP_029307968.1\|3625668_3627264_+	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	7.5e-16	23.6

DBSCAN-SWA_247

3640162 : 3646477

Mycobacterium_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516326.1\|3640162_3643534_-	cell division protein FtsK	S5VNE3	Mycobacterium_phage	4.7e-84	49.9
WP_011516325.1\|3643693_3644278_-	DUF4136 domain-containing protein	NA	NA	NA	NA
WP_008649650.1\|3644291_3644705_-	DoxX family protein	NA	NA	NA	NA
WP_011516271.1\|3645448_3646477_+\|transposase	IS30-like element IS1088 family transposase	W5R8L2	Staphylococcus_phage	3.0e-42	35.6

DBSCAN-SWA_248

3666531 : 3670323

Tupanvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516310.1\|3666531_3668154_-	ABC-F family ATPase	A0A2K9L3Z8	Tupanvirus	6.0e-53	26.4
WP_011516309.1\|3668338_3669259_-	muramoyltetrapeptide carboxypeptidase	NA	NA	NA	NA
WP_011516308.1\|3669255_3669825_-\|tRNA	tRNA adenosine(34) deaminase TadA	S4VYT2	Pandoravirus	5.8e-11	35.9
WP_008649701.1\|3669846_3670323_-	6-carboxytetrahydropterin synthase	A0A1U9WRB3	Streptococcus_virus	9.7e-12	30.6

DBSCAN-SWA_249

3694636 : 3751460

Staphylococcus_phage(33.33%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_003049965.1\|3694636_3697552_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
WP_049799711.1\|3697727_3698111_+	Dabb family protein	NA	NA	NA	NA
WP_011516282.1\|3698100_3699030_-	response regulator	NA	NA	NA	NA
WP_011516281.1\|3699026_3700766_-	hydrogenase maturation protein	NA	NA	NA	NA
WP_011516280.1\|3700864_3701914_-	hydrogenase expression/formation protein HypE	NA	NA	NA	NA
WP_011516279.1\|3701987_3703130_-	hydrogenase formation protein HypD	NA	NA	NA	NA
WP_041240127.1\|3703126_3703363_-	HypC/HybG/HupF family hydrogenase formation chaperone	NA	NA	NA	NA
WP_011516277.1\|3703367_3705725_-	carbamoyltransferase HypF	NA	NA	NA	NA
WP_011516276.1\|3705738_3706719_-	hydrogenase nickel incorporation protein HypB	NA	NA	NA	NA
WP_011516275.1\|3706752_3707094_-	hydrogenase maturation nickel metallochaperone HypA	NA	NA	NA	NA
WP_146209070.1\|3707086_3707455_-	hypothetical protein	NA	NA	NA	NA
WP_041240122.1\|3707445_3707745_-	hypothetical protein	NA	NA	NA	NA
WP_011516273.1\|3707844_3708681_-	nickel transporter	NA	NA	NA	NA
WP_011516272.1\|3708742_3710116_-	NAD(P)(+) transhydrogenase (Re/Si-specific) subunit beta	NA	NA	NA	NA
WP_041240119.1\|3710112_3710418_-	NAD(P) transhydrogenase subunit alpha	NA	NA	NA	NA
WP_011516271.1\|3710879_3711908_+\|transposase	IS30-like element IS1088 family transposase	W5R8L2	Staphylococcus_phage	3.0e-42	35.6
WP_082219896.1\|3712865_3712997_-	hypothetical protein	NA	NA	NA	NA
WP_011516270.1\|3713006_3713510_-	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_110070725.1\|3713522_3714002_-\|protease	hydrogenase maturation protease	NA	NA	NA	NA
WP_011516268.1\|3714012_3715479_-	Ni/Fe hydrogenase subunit alpha	NA	NA	NA	NA
WP_041240501.1\|3715496_3716072_-	NADP oxidoreductase	NA	NA	NA	NA
WP_011516266.1\|3716122_3716833_-	2Fe-2S iron-sulfur cluster binding domain-containing protein	NA	NA	NA	NA
WP_011516265.1\|3716829_3718638_-	NADP oxidoreductase	NA	NA	NA	NA
WP_011516264.1\|3718763_3719423_-	ribose-5-phosphate isomerase RpiA	NA	NA	NA	NA
WP_011516263.1\|3719422_3720241_-	triose-phosphate isomerase	NA	NA	NA	NA
WP_011516262.1\|3720276_3721695_-	pyruvate kinase	NA	NA	NA	NA
WP_011516261.1\|3721709_3722747_-	fructose-bisphosphate aldolase class II	NA	NA	NA	NA
WP_011516260.1\|3722806_3723625_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_011516259.1\|3723621_3724812_-	phosphoglycerate kinase	NA	NA	NA	NA
WP_011516258.1\|3724808_3725816_-	type I glyceraldehyde-3-phosphate dehydrogenase	NA	NA	NA	NA
WP_011516257.1\|3725812_3726544_-	HAD-IA family hydrolase	NA	NA	NA	NA
WP_011516256.1\|3726545_3728600_-	transketolase	NA	NA	NA	NA
WP_011516255.1\|3728599_3729484_-	phosphoribulokinase	NA	NA	NA	NA
WP_011516254.1\|3729516_3730614_-	class 1 fructose-bisphosphatase	A0A1V0SKX4	Klosneuvirus	6.7e-48	34.5
WP_155877856.1\|3730640_3730784_-	hypothetical protein	NA	NA	NA	NA
WP_011516253.1\|3730793_3731492_-	ribulose-phosphate 3-epimerase	NA	NA	NA	NA
WP_155877857.1\|3731509_3731674_-	hypothetical protein	NA	NA	NA	NA
WP_011516252.1\|3731779_3732703_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_003049965.1\|3734148_3737064_+\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA
WP_011515352.1\|3738352_3739603_-\|transposase	IS256-like element IS1090 family transposase	A0A218MNI5	uncultured_virus	4.0e-41	42.8
WP_011516248.1\|3739781_3740663_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_011516247.1\|3740787_3742209_+	form I ribulose bisphosphate carboxylase large subunit	NA	NA	NA	NA
WP_011516246.1\|3742286_3742643_+	ribulose bisphosphate carboxylase small subunit	NA	NA	NA	NA
WP_011516245.1\|3742792_3743596_+	CbbQ/NirQ/NorQ/GpvN family protein	NA	NA	NA	NA
WP_011516244.1\|3743608_3745966_+	nitric oxide reductase activation protein NorD	NA	NA	NA	NA
WP_011516243.1\|3745974_3746271_+	hypothetical protein	NA	NA	NA	NA
WP_011516242.1\|3746286_3746661_+	hypothetical protein	NA	NA	NA	NA
WP_011516241.1\|3747571_3748432_+	class II fructose-bisphosphate aldolase family protein	NA	NA	NA	NA
WP_003049965.1\|3748544_3751460_-\|transposase	Tn3-like element IS1071 family transposase	NA	NA	NA	NA

DBSCAN-SWA_250

3756074 : 3756713

Halomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516235.1\|3756074_3756713_-	AAA family ATPase	B0ZSI1	Halomonas_phage	5.6e-31	39.6

DBSCAN-SWA_251

3762969 : 3769319

Emiliania_huxleyi_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516227.1\|3762969_3765012_-	ParB/RepB/Spo0J family partition protein	G8DH78	Emiliania_huxleyi_virus	4.0e-22	27.0
WP_011516226.1\|3765076_3765907_-	DUF945 domain-containing protein	A0A2C9CYF8	Yersinia_phage	8.9e-45	37.7
WP_011516224.1\|3766652_3767003_-	DUF2958 domain-containing protein	A0A1W6DX76	Sphingobium_phage	3.8e-29	60.4
WP_011516223.1\|3767784_3768024_+	hypothetical protein	NA	NA	NA	NA
WP_011516222.1\|3768076_3768382_+	helix-turn-helix transcriptional regulator	A0A1W6JPB6	Staphylococcus_phage	7.4e-05	40.3
WP_011516221.1\|3768347_3769319_+	RNA-directed DNA polymerase	A0A0F7LDS3	Escherichia_phage	4.3e-22	29.4

DBSCAN-SWA_252

3774799 : 3791853

Hokovirus(28.57%)

integrase

attL 3773278:3773292|attR 3789159:3789173

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
3773278:3773292	attL	NA	NA	NA	NA
WP_011516215.1\|3774799_3775324_-	DNA-binding protein	J9Q7G7	Salmonella_phage	4.1e-11	36.0
WP_011516214.1\|3775328_3775604_-	hypothetical protein	NA	NA	NA	NA
WP_011516213.1\|3775804_3777061_-\|integrase	tyrosine-type recombinase/integrase	A0A1X9TCT6	Enterobacter_phage	5.0e-116	52.8
WP_011516212.1\|3777362_3778982_-	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	4.5e-16	30.6
WP_011516211.1\|3778956_3779598_-	hypothetical protein	NA	NA	NA	NA
WP_011516210.1\|3779685_3781149_-	IMP dehydrogenase	A0A1V0SHK8	Klosneuvirus	1.7e-94	40.0
WP_011516209.1\|3781274_3782234_+	DMT family transporter	NA	NA	NA	NA
WP_011516208.1\|3782328_3782868_+	DUF4124 domain-containing protein	NA	NA	NA	NA
WP_011516207.1\|3783033_3783399_-	RnfH family protein	NA	NA	NA	NA
WP_011516206.1\|3783373_3783823_-	type II toxin-antitoxin system RatA family toxin	NA	NA	NA	NA
WP_008652065.1\|3783999_3784452_+	SsrA-binding protein SmpB	W5RAM5	Staphylococcus_phage	4.6e-27	45.1
WP_011516204.1\|3784537_3785476_-	SPFH/Band 7/PHB domain protein	NA	NA	NA	NA
WP_011516203.1\|3785525_3785960_-	NfeD family protein	NA	NA	NA	NA
WP_011516202.1\|3786140_3788525_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.5e-164	36.0
WP_011516201.1\|3788898_3789711_+	kinase/pyrophosphorylase	NA	NA	NA	NA
3789159:3789173	attR	NA	NA	NA	NA
WP_152560300.1\|3789915_3790341_+	hypothetical protein	NA	NA	NA	NA
WP_011516199.1\|3790374_3791163_-	RNA methyltransferase	NA	NA	NA	NA
WP_011516198.1\|3791172_3791853_-	ribonuclease HII	V5LS49	Emiliania_huxleyi_virus	7.1e-24	38.8

DBSCAN-SWA_253

3802038 : 3802809

Flavobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516189.1\|3802038_3802809_-	isoprenyl transferase	R9W0U9	Flavobacterium_phage	7.5e-22	37.6

DBSCAN-SWA_254

3814598 : 3817321

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516180.1\|3814598_3815132_-	peptide deformylase	E3SLL2	Synechococcus_phage	5.4e-11	35.0
WP_011516179.1\|3815155_3817321_-	NAD-dependent DNA ligase LigA	A0A0K2QQN8	Ralstonia_phage	1.7e-140	42.9

DBSCAN-SWA_255

3841783 : 3847786

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516163.1\|3841783_3843676_-	dipeptide ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.3e-18	29.4
WP_011516162.1\|3843677_3844646_-	isoaspartyl peptidase/L-asparaginase	NA	NA	NA	NA
WP_029310235.1\|3844671_3845574_-	MurR/RpiR family transcriptional regulator	NA	NA	NA	NA
WP_011516160.1\|3845863_3847786_+	ATP-binding cassette domain-containing protein	A0A2K9L0W2	Tupanvirus	3.0e-59	29.0

DBSCAN-SWA_256

3858703 : 3858973

Catovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649110.1\|3858703_3858973_+	acyl-CoA-binding protein	A0A1V0S9E7	Catovirus	8.5e-05	37.5

DBSCAN-SWA_257

3874466 : 3875570

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516139.1\|3874466_3875570_-	sulfate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.5e-26	31.7

DBSCAN-SWA_258

3879113 : 3879989

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516134.1\|3879113_3879989_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	4.7e-28	35.6

DBSCAN-SWA_259

3917337 : 3918084

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011516098.1\|3917337_3918084_-	acetoacetyl-CoA reductase	Q06VL0	Trichoplusia_ni_ascovirus	6.0e-16	30.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046332

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

63223 : 101458

Streptococcus_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001138070.1\|63223_66190_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.9
WP_124682078.1\|67137_67683_+\|transposase	transposase	NA	NA	NA	NA
WP_008651549.1\|67794_69234_+\|transposase	IS481 family transposase	O12274	Simian_T-lymphotropic_virus	4.1e-05	37.8
WP_008651548.1\|69230_70064_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|70060_70333_+	hypothetical protein	NA	NA	NA	NA
WP_008645747.1\|71600_73529_-	c-type cytochrome	NA	NA	NA	NA
WP_008645748.1\|73650_74088_-	Cd(II)/Pb(II)-responsive transcriptional regulator	NA	NA	NA	NA
WP_011229367.1\|74174_76574_+	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	6.2e-147	48.1
WP_011229366.1\|76570_77647_+	signal peptidase II	NA	NA	NA	NA
WP_017514740.1\|77721_77922_-	hypothetical protein	NA	NA	NA	NA
WP_104670213.1\|78374_78680_+	hypothetical protein	NA	NA	NA	NA
WP_011229361.1\|82527_82791_-	hypothetical protein	NA	NA	NA	NA
WP_011229360.1\|82875_83886_+\|transposase	IS30-like element ISRme10 family transposase	Q9MBM9	Staphylococcus_prophage	1.2e-40	34.3
WP_080672772.1\|85656_85872_-	hypothetical protein	NA	NA	NA	NA
WP_133428599.1\|85847_86240_-\|transposase	transposase	NA	NA	NA	NA
WP_080709916.1\|88511_89036_+	cytochrome c	NA	NA	NA	NA
WP_008650714.1\|91198_91444_-	hypothetical protein	NA	NA	NA	NA
WP_008650720.1\|92878_94486_+	glycosyl transferase	NA	NA	NA	NA
WP_008650722.1\|94482_94866_+	GtrA family protein	NA	NA	NA	NA
WP_008650723.1\|94862_95984_+	glycosyltransferase family 2 protein	U5P087	Shigella_phage	3.3e-74	48.3
WP_008650724.1\|96216_96519_+	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_011514822.1\|96576_99066_-	heavy metal translocating P-type ATPase	E4ZFI9	Streptococcus_phage	3.9e-112	39.0
WP_008650726.1\|99565_99988_-	flagellar basal body rod protein FlgB	NA	NA	NA	NA
WP_085960481.1\|100272_101458_+\|transposase	IS3-like element ISRme13 family transposase	A0A0P0I4A4	Acinetobacter_phage	3.2e-56	39.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

4. NZ_CP046330

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

28407 : 68135

Acidithiobacillus_phage(25.0%)

integrase,transposase

attL 53898:53919|attR 66761:66782

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011239934.1\|28407_29553_+\|integrase	tyrosine-type recombinase/integrase	A8ATJ6	Listeria_phage	9.5e-05	27.1
WP_011514892.1\|29527_31186_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_029309944.1\|31182_33096_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514894.1\|33092_33593_+	hypothetical protein	NA	NA	NA	NA
WP_029309942.1\|33894_35337_-	hypothetical protein	NA	NA	NA	NA
WP_011514896.1\|35336_39761_-	ATP-binding protein	NA	NA	NA	NA
WP_011514897.1\|40429_41959_+	RHS repeat protein	NA	NA	NA	NA
WP_011239931.1\|41963_42719_-	ATP-binding protein	K4HZD4	Acidithiobacillus_phage	4.0e-84	62.7
WP_011239930.1\|42726_44280_-\|transposase	IS21-like element ISRme9 family transposase	K4I413	Acidithiobacillus_phage	8.3e-161	54.6
WP_124682111.1\|44292_44514_+	hypothetical protein	NA	NA	NA	NA
WP_080709891.1\|44529_45909_+	RHS repeat protein	NA	NA	NA	NA
WP_011514931.1\|45918_46134_+	hypothetical protein	NA	NA	NA	NA
WP_029309940.1\|46247_46913_-	alpha/beta hydrolase	NA	NA	NA	NA
WP_011514900.1\|47253_50073_+	RHS repeat protein	NA	NA	NA	NA
WP_011514935.1\|50085_50301_+	hypothetical protein	NA	NA	NA	NA
WP_029309938.1\|50776_51727_+	phage Gp37/Gp68 family protein	Q8W6R4	Burkholderia_virus	2.0e-88	54.9
WP_011514902.1\|52011_52257_+	hypothetical protein	NA	NA	NA	NA
WP_008648655.1\|52351_52942_+	hypothetical protein	NA	NA	NA	NA
WP_011239925.1\|52995_53886_+	DNA/RNA non-specific endonuclease	H6X497	Enterobacteria_phage	6.9e-19	35.6
53898:53919	attL	NA	NA	NA	NA
WP_029306690.1\|53976_54894_-	hypothetical protein	NA	NA	NA	NA
WP_011514905.1\|55663_56410_+	hypothetical protein	NA	NA	NA	NA
WP_011239922.1\|56802_57939_-	hypothetical protein	NA	NA	NA	NA
WP_011239921.1\|58552_59707_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011239920.1\|60835_61861_+	PRTRC system protein D	NA	NA	NA	NA
WP_008649401.1\|62559_62772_-	hypothetical protein	NA	NA	NA	NA
WP_011514906.1\|62868_63936_-	zinc-binding protein	A0A0H5AWB1	Pseudomonas_phage	2.8e-19	28.9
WP_011239918.1\|64201_64774_-	single-stranded DNA-binding protein	C5IHK5	Burkholderia_virus	2.4e-49	70.6
WP_035821539.1\|64785_65484_-	hypothetical protein	NA	NA	NA	NA
WP_008649407.1\|65575_66007_-	hypothetical protein	NA	NA	NA	NA
WP_011514908.1\|66105_66414_-	hypothetical protein	NA	NA	NA	NA
WP_011239917.1\|67115_68135_-\|transposase	IS30-like element IS1086 family transposase	W5R8L2	Staphylococcus_phage	4.9e-45	36.4
66761:66782	attR	NA	NA	NA	NA

DBSCAN-SWA_2

107289 : 165602

Salmonella_phage(22.22%)

integrase,transposase

attL 141099:141115|attR 156364:156380

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_008649488.1\|107289_108486_-\|integrase	site-specific integrase	A0A160DFH7	Gordonia_phage	1.0e-04	27.2
WP_011239987.1\|108711_109542_+	hypothetical protein	NA	NA	NA	NA
WP_029306646.1\|110080_110284_-	hypothetical protein	NA	NA	NA	NA
WP_029306645.1\|110427_110991_+	hypothetical protein	NA	NA	NA	NA
WP_029306644.1\|110971_111196_+	hypothetical protein	NA	NA	NA	NA
WP_011514918.1\|111287_112097_+	TIGR02391 family protein	A0A1S5SBU1	Streptococcus_phage	1.5e-25	33.5
WP_011514919.1\|112145_113585_+	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_152560224.1\|113649_117444_-	hypothetical protein	NA	NA	NA	NA
WP_011514921.1\|117649_118918_+	hypothetical protein	NA	NA	NA	NA
WP_011514922.1\|118992_119265_+	hypothetical protein	NA	NA	NA	NA
WP_029306746.1\|120397_120883_+	hypothetical protein	NA	NA	NA	NA
WP_150982636.1\|121004_122036_+	hypothetical protein	NA	NA	NA	NA
WP_011514926.1\|122093_122444_-	hypothetical protein	NA	NA	NA	NA
WP_124682078.1\|123504_124050_+\|transposase	transposase	NA	NA	NA	NA
WP_008651549.1\|124161_125601_+\|transposase	IS481 family transposase	O12274	Simian_T-lymphotropic_virus	4.1e-05	37.8
WP_008651548.1\|125597_126431_+	AAA family ATPase	NA	NA	NA	NA
WP_008651547.1\|126427_126700_+	hypothetical protein	NA	NA	NA	NA
WP_012435589.1\|129727_130084_-	cupin domain-containing protein	NA	NA	NA	NA
WP_011514928.1\|130217_130778_-	hypothetical protein	NA	NA	NA	NA
WP_011342942.1\|131184_131469_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_011342941.1\|131465_131744_-	hypothetical protein	NA	NA	NA	NA
WP_003131969.1\|132344_132779_-	mercury resistance transcriptional regulator MerR	NA	NA	NA	NA
WP_006224622.1\|132850_133201_+	mercuric ion transporter MerT	NA	NA	NA	NA
WP_003131987.1\|133213_133489_+	mercury resistance system periplasmic binding protein MerP	NA	NA	NA	NA
WP_003158917.1\|133560_135246_+	mercury(II) reductase	A0A2K5B2C5	Erysipelothrix_phage	2.1e-40	29.3
WP_000995360.1\|135263_135629_+	mercury resistance co-regulator MerD	NA	NA	NA	NA
WP_003132004.1\|135625_135862_+	broad-spectrum mercury transporter MerE	NA	NA	NA	NA
WP_003132006.1\|135858_136848_+	DUF3330 domain-containing protein	NA	NA	NA	NA
WP_011239984.1\|136977_137538_+	recombinase family protein	A0A1B0V7I5	Salmonella_phage	1.5e-51	89.4
WP_011239983.1\|137540_140510_+\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	0.0e+00	72.9
WP_011514870.1\|140566_141001_+	hypothetical protein	NA	NA	NA	NA
141099:141115	attL	NA	NA	NA	NA
WP_150982641.1\|141283_142099_+	hypothetical protein	A0A1V0SKX7	Klosneuvirus	2.6e-20	31.4
WP_011239982.1\|142182_142605_+	DNA-binding protein	NA	NA	NA	NA
WP_011514872.1\|142969_143923_+	DNA-binding protein	NA	NA	NA	NA
WP_011239980.1\|143919_145407_+\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_011514873.1\|145594_146641_-	YncE family protein	NA	NA	NA	NA
WP_011514874.1\|146657_147584_-	DUF1259 domain-containing protein	NA	NA	NA	NA
WP_011239977.1\|147641_148883_-	MFS transporter	NA	NA	NA	NA
WP_011514875.1\|148905_149214_-	hypothetical protein	NA	NA	NA	NA
WP_128646515.1\|149233_149554_-	hypothetical protein	NA	NA	NA	NA
WP_011239976.1\|149651_150074_-	chromate resistance protein	NA	NA	NA	NA
WP_011239975.1\|150070_150412_-	rhodanese family chromate resistance protein ChrE	NA	NA	NA	NA
WP_011239974.1\|150429_151023_-	superoxide dismutase [Fe]	NA	NA	NA	NA
WP_011514877.1\|151042_152248_-	chromate transporter	NA	NA	NA	NA
WP_011514878.1\|152290_153265_-	protein ChrB	NA	NA	NA	NA
WP_029310258.1\|153545_153914_+	regulatory protein ChrI	NA	NA	NA	NA
WP_128646513.1\|154022_154154_-	YHYH domain-containing protein	NA	NA	NA	NA
WP_011239971.1\|154428_154716_+	cobalt/nickel resistance anti-sigma factor CnrY	NA	NA	NA	NA
WP_011239970.1\|154712_155159_+	periplasmic nickel sensor CnrX	NA	NA	NA	NA
WP_011239969.1\|155155_155731_+	nickel resistance ECF sigma factor CnrH	NA	NA	NA	NA
WP_011239968.1\|155803_157060_+	nickel efflux RND transporter outer membrane subunit CnrC	NA	NA	NA	NA
156364:156380	attR	NA	NA	NA	NA
WP_011239967.1\|157056_158244_+	nickel efflux RND transporter periplasmic adaptor subunit CnrB	NA	NA	NA	NA
WP_011239966.1\|158240_161471_+	nickel efflux RND transporter permease subunit CnrA	S5VTK5	Leptospira_phage	8.3e-54	21.6
WP_011239965.1\|161516_162572_+	nickel diffusion facilitator CnrT	NA	NA	NA	NA
WP_011239964.1\|162662_165602_-\|transposase	Tn3 family transposase	A0A125RQ78	Bacillus_phage	1.1e-33	20.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046333

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046331

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046332

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

4. NZ_CP046330

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection