CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	1 crisprs	cas14j,csa3,Cas14u_CAS-V,RT	2	2	24	2
NZ_CP040346	Bacillus albus strain DLOU-Yingkou plasmid unnamed2, complete sequence	0 crisprs	NA	0	0	2	0
NZ_CP040344	Bacillus albus strain DLOU-Yingkou chromosome, complete genome	4 crisprs	DEDDh,cas3,c2c9_V-U4,csa3,cas14k,WYL,DinG,cas14j	9	26	9	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040345_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040345_1

46190-46483

Unclear

Consensus_repeat	Method
AAAACCAGAAACAAAACCAGAGACAAANCC	CRT

5 spacers

The CRISPR arrays of NZ_CP040345_1

>merge|NZ_CP040345|1|46190-46483|CRT
AAAACCAGAAACAAAACCAGAAATAAAGCCAGAGACAAAACCAGAAATAAAGCCAGAGACAAAACCAGAAACAAAACCAGAGACAAAGCCGGAGACAAAACCAGAGACAAAACCAGAAACAAAACCAGAGACAAAGCCGGAGACAAAACCAGAGACAAAGCCGGAGACAAAACCAGAAACAAAACCAGAGACAAAACCAGAGACAAAGCCAGAGACAAAACCAGAAACAAAGCCAGAGACAAAGCCAGAGACAAAACCAGAAACAAAGCCAGAAACGAAACCAGAGACAAAACC

>NZ_CP040345|1|1|46190-46483|CRT
AAAACCAGAAACAAAACCAGAAATAAAGCC	AGAGACAAAACCAGAAATAAAGCCAGAGAC
AAAACCAGAAACAAAACCAGAGACAAAGCC	GGAGACAAAACCAGAGAC
AAAACCAGAAACAAAACCAGAGACAAAGCC	GGAGACAAAACCAGAGACAAAGCCGGAGAC
AAAACCAGAAACAAAACCAGAGACAAAACC	AGAGACAAAGCCAGAGAC
AAAACCAGAAACAAAGCCAGAGACAAAGCC	AGAGACAAAACCAGAAAC
AAAGCCAGAAACGAAACCAGAGACAAAACC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040345.1\|WP_157410354.1\|40373_40766_+\|SnoaL-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|226158
NZ_CP040345.1\|WP_157410351.1\|38755_39376_+\|DsbA-family-protein	unknown	unknown	gnl\|CDD\|239323
NZ_CP040345.1\|WP_157410357.1\|41671_42637_-\|zinc-metalloprotease	unknown	unknown	gnl\|CDD\|239802
NZ_CP040345.1\|WP_157410359.1\|44383_45343_+\|S8-family-serine-peptidase	unknown	unknown	gnl\|CDD\|173803
NZ_CP040345.1\|WP_157410358.1\|42928_43852_-\|M20/M25/M40-family-metallo-hydrolase	unknown	unknown	gnl\|CDD\|367920
NZ_CP040345.1\|WP_098650555.1\|42722_42914_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_001233791.1\|51127_51400_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_097816455.1\|52414_52525_+\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_157410363.1\|50492_50630_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|379001
NZ_CP040345.1\|WP_157410362.1\|49639_50200_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|173412
NZ_CP040345.1\|WP_157410356.1\|40920_41448_+\|SnoaL-like-domain-containing-protein	unknown	unknown	gnl\|CDD\|227259
NZ_CP040345.1\|WP_157410366.1\|52971_53535_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_157410352.1\|39547_40369_+\|cytoplasmic-protein	unknown	unknown	gnl\|CDD\|293825
NZ_CP040345.1\|WP_167519267.1\|47748_47886_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_157410361.1\|47882_48977_-\|tetratricopeptide-repeat-protein	unknown	unknown	gnl\|CDD\|376220
NZ_CP040345.1\|WP_154131932.1\|53953_54166_+\|cell-division-protein-FtsK	unknown	unknown	gnl\|CDD\|197911
NZ_CP040345.1\|WP_157410364.1\|52564_52675_+\|YjcZ-family-sporulation-protein	unknown	unknown	unknown
NZ_CP040345.1\|WP_088058124.1\|52713_52839_+\|YjcZ-family-sporulation-protein	unknown	unknown	gnl\|CDD\|312989
NZ_CP040345.1\|WP_157410349.1\|36486_37884_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	unknown	unknown	gnl\|CDD\|273387
NZ_CP040345.1\|WP_157410570.1\|38019_38187_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP040345.1\|WP_157410354.1\|40373_40766_+\|SnoaL-like-domain-containing-protein	gnl\|CDD\|226158	COG3631, COG3631, Ketosteroid isomerase-related protein [General function prediction only].	1.60515e-07
NZ_CP040345.1\|WP_157410351.1\|38755_39376_+\|DsbA-family-protein	gnl\|CDD\|239323	cd03025, DsbA_FrnE_like, DsbA family, FrnE-like subfamily; composed of uncharacterized proteins containing a CXXC motif with similarity to DsbA and FrnE. FrnE is presumed to be a thiol oxidoreductase involved in polyketide biosynthesis, specifically in the production of the aromatic antibiotics frenolicin and nanaomycins.	6.28567e-51
NZ_CP040345.1\|WP_157410357.1\|41671_42637_-\|zinc-metalloprotease	gnl\|CDD\|239802	cd04275, ZnMc_pappalysin_like, Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.	1.68775e-65
NZ_CP040345.1\|WP_157410359.1\|44383_45343_+\|S8-family-serine-peptidase	gnl\|CDD\|173803	cd07477, Peptidases_S8_Subtilisin_subset, Peptidase S8 family domain in Subtilisin proteins. This group is composed of many different subtilisins: Pro-TK-subtilisin, subtilisin Carlsberg, serine protease Pb92 subtilisin, and BPN subtilisins just to name a few. Pro-TK-subtilisin is a serine protease from the hyperthermophilic archaeon Thermococcus kodakaraensis and consists of a signal peptide, a propeptide, and a mature domain. TK-subtilisin is matured from pro-TK-subtilisin upon autoprocessing and degradation of the propeptide. Unlike other subtilisins though, the folding of the unprocessed form of pro-TK-subtilisin is induced by Ca2+ binding which is almost completed prior to autoprocessing. Ca2+ is required for activity unlike the bacterial subtilisins. The propeptide is not required for folding of the mature domain unlike the bacterial subtilases because of the stability produced from Ca2+ binding. Subtilisin Carlsberg is extremely similar in structure to subtilisin BPN'/Novo thought it has a 30% difference in amino acid sequence. The substrate binding regions are also similar and 2 possible Ca2+ binding sites have been identified recently. Subtilisin Carlsberg possesses the highest commercial importance as a proteolytic additive for detergents. Serine protease Pb92, the serine protease from the alkalophilic Bacillus strain PB92, also contains two calcium ions and the overall folding of the polypeptide chain closely resembles that of the subtilisins. Members of the peptidases S8 and S35 clan include endopeptidases, exopeptidases and also a tripeptidyl-peptidase. The S8 family has an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The S53 family contains a catalytic triad Glu/Asp/Ser. The stability of these enzymes may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.	4.0882e-93
NZ_CP040345.1\|WP_157410358.1\|42928_43852_-\|M20/M25/M40-family-metallo-hydrolase	gnl\|CDD\|367920	pfam04389, Peptidase_M28, Peptidase family M28.	3.99422e-47
NZ_CP040345.1\|WP_157410363.1\|50492_50630_+\|hypothetical-protein	gnl\|CDD\|379001	pfam12960, DUF3849, Protein of unknown function (DUF3849). A family of uncharacterized proteins found by clustering human gut metagenomic sequences. This domain frequently seen with DUF3848.	0.0091285
NZ_CP040345.1\|WP_157410362.1\|49639_50200_-\|hypothetical-protein	gnl\|CDD\|173412	PTZ00121, PTZ00121, MAEBL; Provisional.	7.42436e-06
NZ_CP040345.1\|WP_157410356.1\|40920_41448_+\|SnoaL-like-domain-containing-protein	gnl\|CDD\|227259	COG4922, COG4922, Uncharacterized protein conserved in bacteria [Function unknown].	1.03849e-36
NZ_CP040345.1\|WP_157410352.1\|39547_40369_+\|cytoplasmic-protein	gnl\|CDD\|293825	cd07739, metallo-hydrolase-like_MBL-fold, uncharacterized subgroup of the MBL-fold_metallo-hydrolase superfamily; MBL-fold metallo hydrolase domain. Members of the MBL-fold metallohydrolase superfamily are mainly hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	7.31361e-57
NZ_CP040345.1\|WP_157410361.1\|47882_48977_-\|tetratricopeptide-repeat-protein	gnl\|CDD\|376220	pfam18801, RapH_N, response regulator aspartate phosphatase H, N terminal. Rap proteins consist of a N-terminal 3-helix bundle and a tetratricopeptide domain. This entry represents the conserved region of the C-terminal bundle.	1.13333e-22
NZ_CP040345.1\|WP_154131932.1\|53953_54166_+\|cell-division-protein-FtsK	gnl\|CDD\|197911	smart00843, Ftsk_gamma, This domain directs oriented DNA translocation and forms a winged helix structure. Mutated proteins with substitutions in the FtsK gamma DNA-recognition helix are impaired in DNA binding.	1.60547e-23
NZ_CP040345.1\|WP_157410349.1\|36486_37884_+\|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit	gnl\|CDD\|273387	TIGR01000, Mesentericin_Y105_secretion_protein_MesE, bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193. [Transport and binding proteins, Other].	7.66708e-21
NZ_CP040345.1\|WP_088058124.1\|52713_52839_+\|YjcZ-family-sporulation-protein	gnl\|CDD\|312989	pfam09680, Tiny_TM_bacill, Protein of unknown function (Tiny_TM_bacill). This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.	0.000470989

>NZ_CP040345.1|WP_157410359.1|44383_45343_+|S8-family-serine-peptidase
MSHRNSFVNGQNAISLIPFQVLEMASSIAEIPSGVKLIHAPSVWEKSEKGKDIVIAVLDTGCNTEHIDLKDRIIGGYNFTTDYESDPNNFLDNHGHGTHVAGIIAASENNTGVIGVAPLAKLLILKVFDGKGKSSNEWITDGIINAINWRGPKGEKVRIISMSLSGKKDAYCIHEAIKLAVNNNILVVCAAGNDGDCREETNELRYPGAYQEVVEVGSVDINKKIACKSNSNNHLDLVAPGEEIWSTDKDGGYAKLSGTSMATPHVSGAAALIIKQSEKEFKRILSESEIYAQLIKRTTNIGYSPFLVGNGIIDLSREC
>NZ_CP040345.1|WP_157410358.1|42928_43852_-|M20/M25/M40-family-metallo-hydrolase
MREPIVPGGTNDTENELLISGSFHNQSTLVNSIQSLVNQVSENQFQSYLTHLVSYPTRFSTSSFYEEAATWTREILNEMGYTTSSETIRVNNEDSQNVIANKMGTNRDEEKHLIIITAHLDSVNHSGGPSSNAPGADDNGSGSAGVLEIARVFKDIPVQHDLRFILFGGEEQGLLGSKQYVENLPTPDKNRIRAVINMDMIGKLNTSTPAVLIEGSPISEELINGLKNAASLYTNLDVNVSLNPFDSDHVSFLNKGIPAVLTIEGEDSLNPNDHTANDTLEHIHYPLALDILRMNIGFIASQITNLE
>NZ_CP040345.1|WP_098650555.1|42722_42914_-|hypothetical-protein
MKNSTHEESFNNTTDDSKETSPIRRNCGTMCMHENLLKESKEYREEREKIEKMTEEFIKNKKQ
>NZ_CP040345.1|WP_157410357.1|41671_42637_-|zinc-metalloprotease
MPNQTNSSERTNTPTLRRCATIELHQKLLEESEQYKNARAEIERVTNEFLNSARLESERPVVKIPVVVHVVWNTEEQNISDEQVQSQMDVLNRDFRATNPDIANVPSAFKDSVSDARVEFFLATKDPNGNQTNGITRSHTTNQSFLMRNNPVKFKNKGGTDAWPSDKYLNLWVCPQILDDDGDEVLGYAQFPGGSTKTDGVVIEYKYFGTTGTATVPYHLGRTATHEIGHWFNLYHIWGDDQRLPDICSGSDRVDDTPNQGEPNYGKPTFPHTSCNNGPNGDMFMNFMDYVHDDTMFMFTKGQVDRIDACLAGPRSSFLTN
>NZ_CP040345.1|WP_157410356.1|40920_41448_+|SnoaL-like-domain-containing-protein
MKLEKNLIVIIISVFILGIVSTLIFQASTGNTKGHSTKSKNVATVSKDNVTEKEQNKKMVVDFYNEVFNKHNINIIPKYVSEDYKQHNPFVADGRKAFMDFFKEDFVKNPNSSAEIKRVVAEGDTVALHVHSRTNSQDKGVAIVDIFRIKDGKIVEHWDVIQEIPSEAANNNTMF
>NZ_CP040345.1|WP_157410354.1|40373_40766_+|SnoaL-like-domain-containing-protein
MNEYQKLLHETYVLTGEGKLDAFKTYLSENVSWTEAAGFPYAGTYIGPDEVVKNVHERLGTEWDNYSAKDEIYAFNNNTVIVYGKYSGTYKVTGKSFIADFCHLYEFDENDKVKKFIQIVDSATVNEVLS
>NZ_CP040345.1|WP_157410352.1|39547_40369_+|cytoplasmic-protein
MFKTIDTNQKDVKLTVFSSDEKSFMVTATLVEKAGHAFLINSKFTQSDSKEIVDYLKNNNLSLDKIFIIHGDPDYYFGLESIKAAYPDAIAYATQSTVEHIVHSVLGKLKVWKDALGENAPSNVVLPQVFKEKSIDFQGLTFELVGLDDYRTSLFNRELKLLIGGIDVFNEIHLFLADTSSKAAMEAWIENLKVLQALNADVIVPSHGSIEKSLDNQAITATMDYLRTAIQASEESKNSNDFVAKLDAAYPGYTNKGVLELSAKVVTKEMPWG
>NZ_CP040345.1|WP_157410351.1|38755_39376_+|DsbA-family-protein
MEKKQDNLIYVWDAYCGWCYGFSESIKGFYKEHTEMPLTVLCGGLFLDDLPIKNFSYIEEGNKRINQLTGAEFGPSYQKLVEEGTFKMNSKDAAMGFSALRSLAPDRLLEFTSAMQKAFYYDGQSLSDPETYRKIAIEHGLDPEQVLERLNAQETIVDVQNDFNKVRQLGVNSYPSLLLQKDNQIIPIGGGVMTPDKIEARFKNLY
>NZ_CP040345.1|WP_157410570.1|38019_38187_+|hypothetical-protein
MSSVILRLLHGGLPITAMSMGIVFAVLYHKKSVLTGIILHITWDLIIGFLKVLLF
>NZ_CP040345.1|WP_157410349.1|36486_37884_+|HlyD-family-efflux-transporter-periplasmic-adaptor-subunit
MSRIYSFDQLTDSVELLERKPPRFITGLLVFLLLSVLTFAIWAYIGKVDIVSKGTAMIQGKSDASVSRTQIVGVVDQVAVKSGDEVKKGDTLLELKNRELTDKQNQMDQVVKHLEKQKEMLVQLKTSIQSHSPSFSDKVDIKIREEYKAYEQGYQALQNEKEHEVTAIENSKMSNEQDEVLQGLLVEKENIQNEINLIKKQKTRDNTSEEQKTTANILEEQKMGDIVLTEQKTKEKILEEQKKAYDDKIEILESQQNTLEKRIQQRKKALEQERNKVDVLKEEKQEQKKDALNRYKEEAFISINQRIQSVEQDLFIKNQELDGLHHQSETTTIRAIKDGIVQFPSIVQQGDLIDPGQEVVSIIPKESEKKVKILLPAQEIKGIKKGDKIQYSFKLKHTDKQMGQVTYISAHPIFDKDSKAYMYELEATIEKQELQELHTGLIGRASVITGEEPVWKFILRKLDFI
>NZ_CP040345.1|WP_167519267.1|47748_47886_-|hypothetical-protein
MKKLVLGLMGVLTALTLTTGISSDKGNNKSVTPVIMMMEHGDHGG
>NZ_CP040345.1|WP_157410361.1|47882_48977_-|tetratricopeptide-repeat-protein
MNVSVKGNDKITQLLNEWYIEIRARRISQAHRLKEEIAKKINNIEEDQNLLLYYSLLDFRFQYIVDNLGVSASSFDKVEAFEIPTNTFLTYYYHFFKAIHTSGIGNYAIAKEHFDKAESLLELVPDEIEKAEFYYKLGAFHYDIYESLNSVKYTSKAKEIFEQHENYERNVGFCENLLGTACTKLREWALSEEHLIKAMDIFQKLNEEKYILMVRHNLGYMYSSQNLSSLAIRYLSEVINHNPKHHKAIFLKAREHYKLNETDTAKDLVDKGYSICLELGNTEYIHLFSILNCLISNVSGEDLEKTALEGISYFESESLYEYVEDSQEYLAVKFYEERNHIKSCEYFYLATKTRQKIKERESLK
>NZ_CP040345.1|WP_157410362.1|49639_50200_-|hypothetical-protein
MAKAINEKEEKKRRGCGCFGCLGIIILLIILIGSCAKDSGNDKSDKAATTIKQEETKKSEESKEDEKKQQDFQKQQEEQKKQEELKKQEAEQKRQQELQKQRDEQQKQQELKKQQEQQKKQEAATQPKTNQVTEQNGTCTIKGNKNSRGEKIYHMPGQQFYDKTKAEEMFCSEADAKSAGYRASKK
>NZ_CP040345.1|WP_157410363.1|50492_50630_+|hypothetical-protein
MANAKIGFCLSTFTASEVVIDQFGLEKLQSIQGRYMKENSEWFST
>NZ_CP040345.1|WP_001233791.1|51127_51400_-|hypothetical-protein
MRKYFGFVSMFLTSILFFSSFSRYIHFDFFTAIFILSISIILAILAPKGDTAKKITFTMLIILGILIACVLIIATIIGAGLAESQLQHLK
>NZ_CP040345.1|WP_097816455.1|52414_52525_+|YjcZ-family-sporulation-protein
MATGKGYGHGYSNCGGFALLVVLFILLIIVGAACFC
>NZ_CP040345.1|WP_157410364.1|52564_52675_+|YjcZ-family-sporulation-protein
MAAEKGYGRGCCFSGGFALLVVLFILLIIVGTAWIC
>NZ_CP040345.1|WP_088058124.1|52713_52839_+|YjcZ-family-sporulation-protein
MTTEKGYGNSCGFGGGFALLVVLFILLIIVGASCWGGGYGA
>NZ_CP040345.1|WP_157410366.1|52971_53535_+|hypothetical-protein
MKSNPYFHKDVSYQTLSIPTNEVVQKKIKIITVETITLPQLPNELINETTDETAHETTDKTIDETTDETAHETTDKTIDETADETTDEITEKTTDEITDETINKQENNTLDSSPFQINIPYFNIKITSTEILGVAKSVFMQTLLKKIQDPVFLMNLMNSEGGKKLLNLAGNFFKDTSTKSENDNDAK
>NZ_CP040345.1|WP_154131932.1|53953_54166_+|cell-division-protein-FtsK
MEEKIKEYVDGVYEAVKEWVITRKIISTTMLQRRFRIGYTRAARIINRLEENNIIEPREGRGPRKVLANK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040345_1	1.5\|46436\|18\|NZ_CP040345\|CRT	46436-46453	18	NZ_CP040345.1	46184-46201	0	1.0
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345.1	468423-468452	1	0.967

1. spacer 1.5|46436|18|NZ_CP040345|CRT matches to position: 46184-46201, mismatch: 0, identity: 1.0

agagacaaaaccagaaac	CRISPR spacer
agagacaaaaccagaaac	Protospacer
******************

2. spacer 1.1|46220|30|NZ_CP040345|CRT matches to position: 468423-468452, mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaattaagccagagac	Protospacer
****************** ***********

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46220-46249	0	1.0
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297149-297178	0	1.0
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297173-297202	0	1.0
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46328-46357	0	1.0
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46196-46225	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46400-46429	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	468423-468452	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33871-33900	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385298-385327	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387569-387598	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409337-409366	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297053-297082	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297209-297238	1	0.967
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297113-297142	1	0.967
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46244-46273	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46292-46321	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46376-46405	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46436-46465	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33967-33996	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385394-385423	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387665-387694	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409241-409270	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297017-297046	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53256-53285	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53388-53417	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53424-53453	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31028-31057	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31076-31105	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31160-31189	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31316-31345	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257402-257431	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257474-257503	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257498-257527	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151649-151678	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151721-151750	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151745-151774	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83157-83186	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83229-83258	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83265-83294	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83313-83342	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83409-83438	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83481-83510	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83709-83738	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297125-297154	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46256-46285	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46304-46333	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46376-46405	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53388-53417	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53424-53453	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31028-31057	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31076-31105	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31316-31345	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257474-257503	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257498-257527	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151721-151750	2	0.933
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151745-151774	2	0.933
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46352-46381	3	0.9
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297089-297118	3	0.9
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	99922-99951	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297053-297082	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297077-297106	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46400-46429	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53220-53249	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53232-53261	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53316-53345	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53328-53357	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53340-53369	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53352-53381	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53364-53393	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53376-53405	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53412-53441	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP031069	Bacillus sp. JAS24-2 plasmid pl626, complete sequence	53436-53465	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	30980-31009	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31016-31045	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31148-31177	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31232-31261	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31244-31273	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31256-31285	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31268-31297	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_011775	Bacillus cereus G9842 plasmid pG9842_209, complete sequence	31280-31309	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257450-257479	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257462-257491	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053953	Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence	257510-257539	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151697-151726	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151709-151738	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP053950	Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence	151757-151786	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83133-83162	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83505-83534	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83529-83558	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83565-83594	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP023002	Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence	137653-137682	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_AP019732	Bacillus anthracis strain PCr plasmid PCr-pXO1	132260-132289	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP029324	Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence	155715-155744	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP015592	Bacillus cereus strain AR156 plasmid pAR460, complete sequence	393620-393649	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409289-409318	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409301-409330	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409337-409366	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP007665	Bacillus anthracis str. Vollum plasmid unnamed, complete sequence	133584-133613	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP024688	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence	99922-99951	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009340	Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence	8587-8616	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009696	Bacillus anthracis strain RA3 plasmid pXO1, complete sequence	128799-128828	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009463	Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence	174655-174684	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009699	Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence	137705-137734	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009540	Bacillus anthracis str. Sterne plasmid pXO1, complete sequence	107082-107111	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009324	Bacillus anthracis strain PAK-1 plasmid 1, complete sequence	131727-131756	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009980	Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence	39397-39426	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP047132	Bacillus anthracis str. BF1 plasmid pXO1, complete sequence	154835-154864	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_KT186230	Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence	68406-68435	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP022045	Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence	5250-5279	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_007322	Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence	68341-68370	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33871-33900	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33907-33936	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	33919-33948	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_012579	Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence	68647-68676	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP015777	Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence	68341-68370	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP018904	Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence	68445-68474	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_AP018444	Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence	68425-68454	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_012656	Bacillus anthracis str. A0248 plasmid pXO1, complete sequence	68605-68634	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_010934	Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence	126449-126478	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP019589	Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence	68341-68370	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP010853	Bacillus anthracis strain A1144 plasmid pXO1, complete sequence	68310-68339	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385298-385327	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385334-385363	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385346-385375	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP008847	Bacillus anthracis strain HYU01 plasmid pX01, complete sequence	68427-68456	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP006743	Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence	68330-68359	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_AP014834	Bacillus anthracis strain Shikan-NIID plasmid pXO1	68425-68454	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP029806	Bacillus anthracis strain London_499 plasmid pX01, complete sequence	67327-67356	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NC_001496	Bacillus anthracis virulence plasmid PX01, complete sequence	68290-68319	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP014177	Bacillus anthracis strain Stendal plasmid pXO1, complete sequence	68341-68370	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009597	Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence	42012-42041	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009901	Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence	39251-39280	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009592	Bacillus cereus G9241 plasmid pBCX01, complete sequence	7819-7848	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009543	Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence	154931-154960	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP010321	Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence	136516-136545	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009330	Bacillus anthracis strain K3 plasmid 1, complete sequence	106217-106246	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP009327	Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence	112142-112171	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP001975	Bacillus anthracis str. A16R plasmid pXO1, complete sequence	68426-68455	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP001971	Bacillus anthracis str. A16 plasmid pXO1, complete sequence	68426-68455	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387569-387598	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387605-387634	3	0.9
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387617-387646	3	0.9
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46184-46213	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	468447-468476	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP011350	Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence	34003-34032	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP004860	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence	385430-385459	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP010090	Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence	387701-387730	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP007616	Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence	409205-409234	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	371689-371718	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297221-297250	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP004877	Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence	373769-373798	4	0.867
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	79999-80028	5	0.833
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP036355	Bacillus sp. SYJ plasmid unnamed1, complete sequence	80035-80064	5	0.833
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP040345	Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence	46160-46189	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP053657	Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence	297245-297274	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83673-83702	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83817-83846	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP011154	Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence	360795-360824	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	NZ_CP011152	Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence	186091-186120	6	0.8
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP022446	Bacillus cereus C1L plasmid pC1L1, complete sequence	382132-382161	6	0.8
NZ_CP040345_1	1.1\|46220\|30\|NZ_CP040345\|CRT	46220-46249	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83781-83810	7	0.767
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83781-83810	7	0.767
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83817-83846	7	0.767
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	NZ_CP022191	Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence	56018-56047	7	0.767
NZ_CP040345_1	1.3\|46328\|30\|NZ_CP040345\|CRT	46328-46357	30	CP013001	Bacillus thuringiensis strain XL6 plasmid, complete sequence	83673-83702	8	0.733

1. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaataaagccagagac	Protospacer
******************************

2. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 0, identity: 1.0

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
******************************

3. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 0, identity: 1.0

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
******************************

4. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 0, identity: 1.0

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
ggagacaaaaccagagacaaagccggagac	Protospacer
******************************

5. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agaaacaaaaccagaaataaagccagagac	Protospacer
***.**************************

6. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

7. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaattaagccagagac	Protospacer
****************** ***********

8. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

9. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

10. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

11. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

12. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
*****************.************

13. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 1, identity: 0.967

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agaaacaaaaccagaaataaagccagagac	Protospacer
***.**************************

14. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 1, identity: 0.967

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccggagac	Protospacer
.*****************************

15. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagac	Protospacer
*****************.***.********

16. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagac	Protospacer
*****************.***.********

17. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

18. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

19. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaactaagccagagac	Protospacer
*****************. ***********

20. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaactaagccagagac	Protospacer
*****************. ***********

21. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaactaagccagagac	Protospacer
*****************. ***********

22. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaactaagccagagac	Protospacer
*****************. ***********

23. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

24. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagac	Protospacer
*****************.***.********

25. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

26. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

27. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

28. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

29. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagagac	Protospacer
*********.*******.************

30. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

31. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaagccagaaattaagccagagac	Protospacer
*********.******** ***********

32. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

33. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

34. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaagccagaaattaagccagagac	Protospacer
*********.******** ***********

35. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

36. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
***************.*.************

37. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

38. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

39. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacgaagccagagac	Protospacer
*****************..***********

40. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacgaagccagagac	Protospacer
*****************..***********

41. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

42. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaagccagaaac	Protospacer
*****************.*********.**

43. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 2, identity: 0.933

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaagccagaaacaaagccagagac	Protospacer
*********.*******.************

44. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
ggagacaaaaccagagacaaaaccagagac	Protospacer
*********************.**.*****

45. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agaaacaaaaccagagacaaagccggagac	Protospacer
.**.**************************

46. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agaaacaaaaccagagacaaagccggagac	Protospacer
.**.**************************

47. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

48. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

49. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

50. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

51. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

52. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

53. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

54. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

55. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

56. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 2, identity: 0.933

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagagac	Protospacer
.***********************.*****

57. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaaaccagaaataaagccagagac	CRISPR spacer
ggagacaaaaccagaaacaaaaccagagac	Protospacer
.****************.***.********

58. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaaaccagaaataaagccagagac	CRISPR spacer
ggagacaaaaccagaaacaaaaccagagac	Protospacer
.****************.***.********

59. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 3, identity: 0.9

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tgagacaaaaccagaaacaaagcctgagac	Protospacer
 ****************.****** *****

60. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

61. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agaaacaaaaccagagacaaagccagagac	Protospacer
.**.********************.*****

62. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

63. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

64. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

65. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

66. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

67. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

68. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

69. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

70. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

71. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

72. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP031069 (Bacillus sp. JAS24-2 plasmid pl626, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
.********.**************.*****

73. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

74. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

75. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

76. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

77. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

78. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

79. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

80. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_011775 (Bacillus cereus G9842 plasmid pG9842_209, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

81. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

82. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

83. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053953 (Bacillus cereus strain FDAARGOS_798 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
.********.**************.*****

84. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

85. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

86. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP053950 (Bacillus cereus strain FDAARGOS_799 plasmid unnamed2, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
.********.**************.*****

87. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agaaacaaaaccagagacaaagccagagac	Protospacer
.**.********************.*****

88. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaagccagagacaaagccagagac	Protospacer
.********.**************.*****

89. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacgaagccagagac	Protospacer
.*****************.*****.*****

90. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

91. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP023002 (Bacillus anthracis strain 14RA5914 plasmid pX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

92. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_AP019732 (Bacillus anthracis strain PCr plasmid PCr-pXO1) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

93. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP029324 (Bacillus anthracis strain 17OD930 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

94. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP015592 (Bacillus cereus strain AR156 plasmid pAR460, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

95. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

96. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

97. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

98. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP007665 (Bacillus anthracis str. Vollum plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

99. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP024688 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-4-144K, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
tgagacaaaaccagaaacaaagcctgagac	Protospacer
 **************.******** *****

100. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009340 (Bacillus anthracis strain Ohio ACB plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

101. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009696 (Bacillus anthracis strain RA3 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

102. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009463 (Bacillus anthracis strain SK-102 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

103. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009699 (Bacillus anthracis strain BA1035 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

104. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009540 (Bacillus anthracis str. Sterne plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

105. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009324 (Bacillus anthracis strain PAK-1 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

106. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009980 (Bacillus anthracis strain Ames isolate BACI008 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

107. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP047132 (Bacillus anthracis str. BF1 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

108. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_KT186230 (Bacillus anthracis strain P.NO2 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

109. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP022045 (Bacillus anthracis strain FDAARGOS_341 plasmid unnamed1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

110. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_007322 (Bacillus anthracis str. 'Ames Ancestor' plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

111. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

112. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

113. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

114. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_012579 (Bacillus anthracis str. CDC 684 plasmid pX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

115. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP015777 (Bacillus anthracis strain Tangail-1 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

116. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP018904 (Bacillus anthracis strain Tyrol 4675 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

117. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_AP018444 (Bacillus anthracis strain CZC5 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

118. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_012656 (Bacillus anthracis str. A0248 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

119. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_010934 (Bacillus cereus strain G9241 plasmid pBCXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

120. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP019589 (Bacillus anthracis strain SPV842_15 plasmid pX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

121. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP010853 (Bacillus anthracis strain A1144 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

122. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

123. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

124. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

125. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP008847 (Bacillus anthracis strain HYU01 plasmid pX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

126. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP006743 (Bacillus anthracis str. SVA11 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

127. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_AP014834 (Bacillus anthracis strain Shikan-NIID plasmid pXO1) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

128. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP029806 (Bacillus anthracis strain London_499 plasmid pX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

129. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NC_001496 (Bacillus anthracis virulence plasmid PX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

130. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP014177 (Bacillus anthracis strain Stendal plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

131. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009597 (Bacillus anthracis str. V770-NP-1R plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

132. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009901 (Bacillus anthracis strain 2002013094 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

133. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009592 (Bacillus cereus G9241 plasmid pBCX01, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

134. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009543 (Bacillus anthracis strain BA1015 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

135. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP010321 (Bacillus anthracis strain Canadian Bison isolate A0369 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

136. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009330 (Bacillus anthracis strain K3 plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

137. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP009327 (Bacillus anthracis strain Vollum 1B plasmid 1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

138. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP001975 (Bacillus anthracis str. A16R plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

139. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP001971 (Bacillus anthracis str. A16 plasmid pXO1, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagactaagccagagac	Protospacer
.***************** *****.*****

140. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaagccagagac	Protospacer
.**************.********.*****

141. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccagagac	Protospacer
.********************.**.*****

142. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 3, identity: 0.9

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaagccagaaac	Protospacer
.***********************.**.**

143. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagaaat	Protospacer
*****************.***.*****.*.

144. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agaagaaaaaccagaagtaaagccagagac	Protospacer
***.. **********.*************

145. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP011350 (Bacillus thuringiensis strain YC-10 plasmid pYC1, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagga	Protospacer
*****************.***.******.

146. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP004860 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB422, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagga	Protospacer
*****************.***.******.

147. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP010090 (Bacillus thuringiensis serovar galleriae strain 4G5 plasmid pBMB426, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagga	Protospacer
*****************.***.******.

148. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP007616 (Bacillus thuringiensis serovar kurstaki str. YBT-1520 plasmid pBMB400, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagga	Protospacer
*****************.***.******.

149. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agaaacaaaaccagaagtaaagccagaccc	Protospacer
***.************.**********  *

150. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagaaat	Protospacer
*****************.***.*****.*.

151. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP004877 (Bacillus thuringiensis serovar kurstaki str. HD-1 plasmid pBMB431, complete sequence) position: , mismatch: 4, identity: 0.867

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagagga	Protospacer
*****************.***.******.

152. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tgaaacaaaaccagaagtaaagccagaccc	Protospacer
 **.************.**********  *

153. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP036355 (Bacillus sp. SYJ plasmid unnamed1, complete sequence) position: , mismatch: 5, identity: 0.833

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tgaaacaaaaccagaagtaaagccagaccc	Protospacer
 **.************.**********  *

154. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP040345 (Bacillus albus strain DLOU-Yingkou plasmid unnamed1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tgtgaacaaaccagaaacaaaaccagagac	Protospacer
 * **  **********.***.********

155. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP053657 (Bacillus cereus strain CTMA_1571 plasmid p.1, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tgtgaacaaaccagaaacaaaaccagagac	Protospacer
 * **  **********.***.********

156. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagtaga	Protospacer
*****************.***.**** ..

157. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
tggaaataaaccagaaacaaagccagagac	Protospacer
 *..*  **********.************

158. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP011154 (Bacillus cereus strain CMCC P0011 plasmid pRML05, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
aggaacaaaaccagaagtaaaaccagaccc	Protospacer
**..************.****.*****  *

159. spacer 1.1|46220|30|NZ_CP040345|CRT matches to NZ_CP011152 (Bacillus cereus strain CMCC P0021 plasmid pRML04, complete sequence) position: , mismatch: 6, identity: 0.8

agagacaaaaccagaaataaagccagagac	CRISPR spacer
aggaacaaaaccagaagtaaaaccagaccc	Protospacer
**..************.****.*****  *

160. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP022446 (Bacillus cereus C1L plasmid pC1L1, complete sequence) position: , mismatch: 6, identity: 0.8

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagagacaaaaccaggggt	Protospacer
.********************.**.*.*..

161. spacer 1.1|46220|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

agagacaaaaccagaaataaagccagagac	CRISPR spacer
ggagacaaaaccagaaacaaaaccagtaga	Protospacer
.****************.***.**** ..

162. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
ggagacaaaaccagaaacaaaaccagtaga	Protospacer
***************.*****.**.* ..

163. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 7, identity: 0.767

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
tggaaataaaccagaaacaaagccagagac	Protospacer
 *..*  ********.********.*****

164. spacer 1.3|46328|30|NZ_CP040345|CRT matches to NZ_CP022191 (Yangia pacifica strain YSBP01 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.767

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
catgacaaaacaagagaaaaagccggtcac	Protospacer
 . ******** ***** ********  **

165. spacer 1.3|46328|30|NZ_CP040345|CRT matches to CP013001 (Bacillus thuringiensis strain XL6 plasmid, complete sequence) position: , mismatch: 8, identity: 0.733

ggagacaaaaccagagacaaagccggagac	CRISPR spacer
agagacaaaaccagaaacaaaaccagtaga	Protospacer
.**************.*****.**.* ..

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 6401

Bacillus_phage(100.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098506284.1\|1570_1750_+	hypothetical protein	NA	NA	NA	NA
WP_157410309.1\|2179_3844_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	1.4e-33	25.6
WP_098506287.1\|3836_4076_+	hypothetical protein	NA	NA	NA	NA
WP_157410311.1\|4538_6401_+	DUF1611 domain-containing protein	A0A217EQY2	Bacillus_phage	9.1e-13	29.0

DBSCAN-SWA_2

11849 : 58976

Bacillus_phage(38.46%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410319.1\|11849_12329_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_157410321.1\|13419_15177_+	HAMP domain-containing protein	NA	NA	NA	NA
WP_001167047.1\|15342_15558_+	alpha/beta-type small acid-soluble spore protein	A0A1P8CX76	Bacillus_phage	3.7e-19	68.7
WP_157410323.1\|15633_16047_-	hypothetical protein	NA	NA	NA	NA
WP_157410325.1\|16618_17740_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	4.7e-174	81.5
WP_098520569.1\|18222_18516_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_157410327.1\|18654_18942_-	hypothetical protein	NA	NA	NA	NA
WP_157410329.1\|19330_19714_+	NUDIX domain-containing protein	A0A0B5CYJ3	Rhizoctonia_fumigata_mycovirus	9.3e-05	32.4
WP_157410330.1\|20595_21519_+	HNH endonuclease	NA	NA	NA	NA
WP_157410332.1\|21575_21938_+	hypothetical protein	NA	NA	NA	NA
WP_157410334.1\|22006_22336_+	nucleotide pyrophosphohydrolase	NA	NA	NA	NA
WP_167519265.1\|22483_24544_+	hypothetical protein	NA	NA	NA	NA
WP_157410336.1\|24950_26633_+	DUF2075 domain-containing protein	NA	NA	NA	NA
WP_157410569.1\|26972_27212_+	hypothetical protein	NA	NA	NA	NA
WP_157410338.1\|27627_29274_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_157410339.1\|29376_30630_+	MFS transporter	NA	NA	NA	NA
WP_167519266.1\|31365_31620_+	hypothetical protein	NA	NA	NA	NA
WP_157410343.1\|32304_32775_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_087983713.1\|32918_33140_+	helix-turn-helix transcriptional regulator	A0A0A8WHR3	Clostridium_phage	9.1e-05	42.6
WP_157410345.1\|33139_33571_+	hypothetical protein	NA	NA	NA	NA
WP_001095955.1\|33622_33838_-	hypothetical protein	NA	NA	NA	NA
WP_000453242.1\|33853_34078_-	hypothetical protein	NA	NA	NA	NA
WP_157410346.1\|34280_36494_+	peptide cleavage/export ABC transporter	W8CYL7	Bacillus_phage	1.0e-47	29.6
WP_157410349.1\|36486_37884_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_157410570.1\|38019_38187_+	hypothetical protein	NA	NA	NA	NA
WP_157410351.1\|38755_39376_+	DsbA family protein	NA	NA	NA	NA
WP_157410352.1\|39547_40369_+	cytoplasmic protein	F2NZ47	Diadromus_pulchellus_ascovirus	5.0e-24	29.8
WP_157410354.1\|40373_40766_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_157410356.1\|40920_41448_+	SnoaL-like domain-containing protein	NA	NA	NA	NA
WP_157410357.1\|41671_42637_-\|protease	zinc metalloprotease	A0A2K9L5D3	Tupanvirus	2.3e-20	29.6
WP_098650555.1\|42722_42914_-	hypothetical protein	NA	NA	NA	NA
WP_157410358.1\|42928_43852_-	M20/M25/M40 family metallo-hydrolase	NA	NA	NA	NA
WP_157410359.1\|44383_45343_+	S8 family serine peptidase	A0A127AWU5	Bacillus_phage	2.4e-86	55.1
WP_157410360.1\|45557_47048_+	cell surface protein	NA	NA	NA	NA
WP_167519267.1\|47748_47886_-	hypothetical protein	NA	NA	NA	NA
WP_157410361.1\|47882_48977_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	6.4e-91	47.7
WP_157410362.1\|49639_50200_-	hypothetical protein	G3MAY5	Bacillus_virus	1.9e-06	54.3
WP_157410363.1\|50492_50630_+	hypothetical protein	NA	NA	NA	NA
WP_001233791.1\|51127_51400_-	hypothetical protein	NA	NA	NA	NA
WP_097816455.1\|52414_52525_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_157410364.1\|52564_52675_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_088058124.1\|52713_52839_+	YjcZ family sporulation protein	NA	NA	NA	NA
WP_157410366.1\|52971_53535_+	hypothetical protein	NA	NA	NA	NA
WP_154131932.1\|53953_54166_+	cell division protein FtsK	NA	NA	NA	NA
WP_157410368.1\|54574_54880_+	hypothetical protein	NA	NA	NA	NA
WP_157410370.1\|54959_55274_+	hypothetical protein	NA	NA	NA	NA
WP_098521839.1\|55352_55565_-	hypothetical protein	NA	NA	NA	NA
WP_157410372.1\|56214_56691_+	hypothetical protein	NA	NA	NA	NA
WP_048562783.1\|56895_57975_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	2.2e-19	33.0
WP_157410373.1\|57980_58382_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	2.6e-50	71.2
WP_048529718.1\|58751_58976_+	hypothetical protein	A0A1B1P780	Bacillus_phage	1.9e-26	88.9

DBSCAN-SWA_3

69018 : 126654

Clostridium_phage(20.0%)

bacteriocin,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410382.1\|69018_69420_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	3.4e-50	70.5
WP_157410384.1\|69425_70505_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	2.2e-19	33.0
WP_157410385.1\|71499_72078_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_001043944.1\|72265_72538_-	HU family DNA-binding protein	A7KV42	Bacillus_phage	9.7e-25	67.8
WP_157410386.1\|72675_73041_-	hypothetical protein	NA	NA	NA	NA
WP_157410387.1\|75011_76103_-	tetratricopeptide repeat protein	A0A2H4J8G3	uncultured_Caudovirales_phage	3.0e-88	46.6
WP_157410388.1\|76880_79745_-	hypothetical protein	NA	NA	NA	NA
WP_157410389.1\|80701_81151_+	hypothetical protein	NA	NA	NA	NA
WP_157410390.1\|81219_81582_+	hypothetical protein	NA	NA	NA	NA
WP_167519268.1\|82716_83676_+	hypothetical protein	NA	NA	NA	NA
WP_157410392.1\|83713_83869_-	hypothetical protein	NA	NA	NA	NA
WP_157410393.1\|84057_84252_+	hypothetical protein	NA	NA	NA	NA
WP_167519269.1\|84454_84631_+\|transposase	transposase	NA	NA	NA	NA
WP_157410394.1\|84609_85233_+\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	4.5e-33	46.5
WP_157410395.1\|85258_85642_-	DUF1524 domain-containing protein	NA	NA	NA	NA
WP_157410396.1\|85638_87117_-	DUF262 domain-containing protein	NA	NA	NA	NA
WP_157410397.1\|87665_88097_+	hypothetical protein	NA	NA	NA	NA
WP_157410398.1\|88870_90277_+	deoxyguanosinetriphosphate triphosphohydrolase	NA	NA	NA	NA
WP_088045241.1\|90302_90995_+	hypothetical protein	NA	NA	NA	NA
WP_157410399.1\|93407_93821_-	hypothetical protein	NA	NA	NA	NA
WP_157410400.1\|93826_95101_-	hypothetical protein	NA	NA	NA	NA
WP_167519270.1\|95149_96241_-	DUF4297 domain-containing protein	NA	NA	NA	NA
WP_157410402.1\|96623_97610_+	excinuclease ABC subunit C	NA	NA	NA	NA
WP_047387797.1\|98044_98404_-	helix-turn-helix transcriptional regulator	A0A0A8WFJ2	Clostridium_phage	3.2e-15	44.8
WP_157410403.1\|98556_98754_+	helix-turn-helix domain-containing protein	A0A142LP09	Marinitoga_camini_virus	9.5e-06	44.1
WP_157410404.1\|98849_99260_+	hypothetical protein	NA	NA	NA	NA
WP_157410405.1\|99766_100636_-	DUF421 domain-containing protein	NA	NA	NA	NA
WP_157410406.1\|101101_101281_-	small acid-soluble spore protein H	NA	NA	NA	NA
WP_000746491.1\|101744_101888_-	hypothetical protein	NA	NA	NA	NA
WP_116777500.1\|103136_103754_+	DUF2238 domain-containing protein	NA	NA	NA	NA
WP_157410407.1\|103986_104340_+	hypothetical protein	NA	NA	NA	NA
WP_157410408.1\|104830_105622_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_157410409.1\|105798_108354_+	glycosyltransferase	A0A1V0SAH6	Catovirus	7.6e-10	32.0
WP_157410410.1\|108373_109504_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	NA	NA	NA	NA
WP_157410411.1\|109496_110063_+	acyltransferase	NA	NA	NA	NA
WP_157410412.1\|110758_111085_-	helix-turn-helix domain-containing protein	A0A0P0IZG9	Lactobacillus_phage	2.8e-10	39.0
WP_157410413.1\|111230_111449_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_071758254.1\|111575_111986_+	hypothetical protein	NA	NA	NA	NA
WP_157410414.1\|112477_113404_-	aldo/keto reductase	NA	NA	NA	NA
WP_142321033.1\|113535_113733_+	hypothetical protein	NA	NA	NA	NA
WP_098346266.1\|113866_114325_-	hypothetical protein	NA	NA	NA	NA
WP_157410415.1\|114415_115384_-	hypothetical protein	NA	NA	NA	NA
WP_098346268.1\|115536_116361_-	hypothetical protein	NA	NA	NA	NA
WP_098343417.1\|116519_117161_-	hypothetical protein	NA	NA	NA	NA
WP_098346269.1\|117311_119603_+	galactose oxidase	NA	NA	NA	NA
WP_098343419.1\|119905_120187_+	hypothetical protein	NA	NA	NA	NA
WP_157410416.1\|120262_120886_+\|bacteriocin	putative bacteriocin export ABC transporter	G9BWD6	Planktothrix_phage	1.6e-25	36.4
WP_157410417.1\|120900_123048_+	DUF1430 domain-containing protein	NA	NA	NA	NA
WP_098346272.1\|123075_123594_+	hypothetical protein	NA	NA	NA	NA
WP_157410418.1\|124168_124444_+	barnase inhibitor	NA	NA	NA	NA
WP_157410419.1\|124563_124851_+	hypothetical protein	NA	NA	NA	NA
WP_157410420.1\|125191_125866_-	hypothetical protein	NA	NA	NA	NA
WP_167519271.1\|126337_126508_+	hypothetical protein	NA	NA	NA	NA
WP_167519272.1\|126531_126654_+\|transposase	IS3 family transposase	NA	NA	NA	NA

DBSCAN-SWA_4

130522 : 131524

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410423.1\|130522_131524_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	3.4e-22	28.2

DBSCAN-SWA_5

142173 : 216695

Tupanvirus(18.75%)

protease,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410431.1\|142173_143058_+\|transposase	Rpn family recombination-promoting nuclease/putative transposase	NA	NA	NA	NA
WP_157410432.1\|143297_145250_+	bifunctional metallophosphatase/5'-nucleotidase	NA	NA	NA	NA
WP_000721369.1\|145570_145729_-	Phr family secreted Rap phosphatase inhibitor	NA	NA	NA	NA
WP_000217987.1\|145728_146829_-	hypothetical protein	A0A2H4J8G3	uncultured_Caudovirales_phage	1.3e-83	45.3
WP_157410433.1\|147412_148534_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	9.9e-164	77.2
WP_088058563.1\|149311_149947_-	MBL fold metallo-hydrolase	A0A1X9I5D3	Streptococcus_phage	5.1e-32	37.2
WP_048524866.1\|150276_150531_-	hypothetical protein	NA	NA	NA	NA
WP_098347610.1\|150789_151521_+	M15 family metallopeptidase	NA	NA	NA	NA
WP_157410572.1\|152204_153326_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	8.9e-173	80.7
WP_157410434.1\|153938_154154_-	hypothetical protein	NA	NA	NA	NA
WP_157410435.1\|155251_156682_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_088083752.1\|156738_156939_-	NUDIX hydrolase	NA	NA	NA	NA
WP_088083753.1\|157039_158056_+	Gfo/Idh/MocA family oxidoreductase	NA	NA	NA	NA
WP_157410436.1\|160487_161231_-\|protease	CPBP family intramembrane metalloprotease	NA	NA	NA	NA
WP_157410437.1\|161864_163766_-	cell wall hydrolase	NA	NA	NA	NA
WP_048529204.1\|164394_165297_+	ATP synthase F0F1 subunit alpha	NA	NA	NA	NA
WP_071757069.1\|165729_166005_+	TIGR04197 family type VII secretion effector	NA	NA	NA	NA
WP_157410438.1\|166405_168256_+	hypothetical protein	NA	NA	NA	NA
WP_098521022.1\|168273_168723_+	hypothetical protein	NA	NA	NA	NA
WP_098347325.1\|170546_171176_+	hypothetical protein	NA	NA	NA	NA
WP_048562768.1\|171175_171811_+	hypothetical protein	NA	NA	NA	NA
WP_157410439.1\|172154_172538_+	hypothetical protein	NA	NA	NA	NA
WP_157410440.1\|172554_173193_+	NERD domain-containing protein	A0A2R2ZH57	Clostridioides_phage	9.3e-18	32.5
WP_157410441.1\|173725_174142_+	VOC family protein	NA	NA	NA	NA
WP_167519273.1\|174560_174719_-	hypothetical protein	NA	NA	NA	NA
WP_088313832.1\|175121_175574_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157410442.1\|175628_176825_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	3.1e-06	22.2
WP_088313837.1\|177218_177653_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157410443.1\|179614_180796_+	aldehyde dehydrogenase family protein	NA	NA	NA	NA
WP_157410444.1\|180815_182468_+	thiamine pyrophosphate-binding protein	H8ZJ31	Ostreococcus_tauri_virus	9.8e-19	22.5
WP_157410445.1\|182471_183839_+	AMP-binding protein	Q75ZG1	Hepacivirus	1.8e-18	21.2
WP_157410446.1\|183835_184540_+	hypothetical protein	NA	NA	NA	NA
WP_157410447.1\|184563_185718_+	ketoacyl-ACP synthase	NA	NA	NA	NA
WP_157410448.1\|186042_187980_+	cyclic peptide export ABC transporter	A0A076FI99	Aureococcus_anophage	5.6e-05	22.1
WP_157410449.1\|187994_195617_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	9.7e-170	27.9
WP_157410450.1\|195660_206115_+	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	4.1e-163	27.2
WP_167519274.1\|206182_208036_+	ABC-F type ribosomal protection protein	A0A2K9L0W2	Tupanvirus	4.3e-47	28.5
WP_157410451.1\|209146_209548_+\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.7e-49	69.7
WP_157410452.1\|209553_210633_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	2.2e-19	33.0
WP_157410453.1\|210851_211559_+	4'-phosphopantetheinyl transferase superfamily protein	NA	NA	NA	NA
WP_157410454.1\|212970_213171_+	hypothetical protein	NA	NA	NA	NA
WP_098521005.1\|213577_213997_+	disulfide bond formation protein B	NA	NA	NA	NA
WP_141539600.1\|214087_214381_+	metalloregulator ArsR/SmtB family transcription factor	NA	NA	NA	NA
WP_087985476.1\|214865_215051_-	RNA chaperone Hfq	NA	NA	NA	NA
WP_157410384.1\|215208_216288_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	A0A0A8WI33	Clostridium_phage	2.2e-19	33.0
WP_046955313.1\|216293_216695_-\|transposase	IS200/IS605 family transposase	Q332K6	Clostridium_botulinum_C_phage	1.5e-50	71.2

DBSCAN-SWA_6

231367 : 232890

Streptococcus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048528540.1\|231367_231766_+\|transposase	IS200/IS605 family transposase	A0A286QN76	Streptococcus_phage	3.6e-52	70.5
WP_157410461.1\|231777_232890_+	helix-turn-helix domain-containing protein	A0A286QQB7	Streptococcus_phage	2.0e-79	45.5

DBSCAN-SWA_7

236476 : 237853

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_071758572.1\|236476_237853_+	chitin-binding protein	G1FGA4	Mycobacterium_phage	5.9e-09	40.2

DBSCAN-SWA_8

248563 : 249469

Moumouvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410466.1\|248563_249469_+	alpha/beta hydrolase fold domain-containing protein	M1PGN2	Moumouvirus	1.4e-14	26.4

DBSCAN-SWA_9

260094 : 266007

Pseudomonas_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410471.1\|260094_261066_+	hypothetical protein	A0A0U4J920	Pseudomonas_phage	3.4e-19	34.5
WP_157410472.1\|261040_261379_+	RidA family protein	NA	NA	NA	NA
WP_157410473.1\|261670_263104_-\|transposase	IS4 family transposase	NA	NA	NA	NA
WP_000995772.1\|263462_263774_+	winged helix-turn-helix transcriptional regulator	A0A218MNF3	uncultured_virus	1.6e-07	43.1
WP_071758577.1\|263894_264983_+	saccharopine dehydrogenase	NA	NA	NA	NA
WP_157410474.1\|265701_266007_+	arsenical resistance operon transcriptional regulator ArsR	A0A2H4PQT4	Staphylococcus_phage	1.3e-06	37.2

DBSCAN-SWA_10

270883 : 272989

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410478.1\|270883_272989_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	7.3e-27	22.7

DBSCAN-SWA_11

281794 : 283141

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410484.1\|281794_283141_-	FAD-binding protein	A0A0B5JBT9	Pandoravirus	1.0e-50	29.2

DBSCAN-SWA_12

287517 : 289281

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410488.1\|287517_289281_-	sulfate permease	A0A2H4J153	uncultured_Caudovirales_phage	1.2e-38	25.4

DBSCAN-SWA_13

292790 : 293423

Enterobacteria_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410491.1\|292790_293423_-	recombinase family protein	Q1MVP4	Enterobacteria_phage	2.1e-14	30.7

DBSCAN-SWA_14

297285 : 298323

Mycobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410575.1\|297285_298323_-	serine hydrolase	B5U3Z7	Mycobacterium_phage	1.7e-05	21.8

DBSCAN-SWA_15

303939 : 310636

Mycobacterium_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410495.1\|303939_305097_-	serine hydrolase	G1DB24	Mycobacterium_phage	1.3e-20	26.4
WP_157410496.1\|305764_306925_-	serine hydrolase	G1DB24	Mycobacterium_phage	9.6e-21	26.3
WP_157410497.1\|307482_309513_+	serine hydrolase	A0A1I9S919	Mycobacterium_phage	1.7e-09	31.4
WP_063538678.1\|309889_310636_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	4.3e-30	37.2

DBSCAN-SWA_16

322164 : 323979

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048528525.1\|322164_323979_-	acetyltransferase	B5WZU0	Pseudomonas_phage	1.4e-42	33.1

DBSCAN-SWA_17

336530 : 342653

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410505.1\|336530_338240_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	1.6e-11	62.0
WP_157410506.1\|338497_339319_-	polysaccharide deacetylase family protein	NA	NA	NA	NA
WP_157410507.1\|339417_339921_-	DUF3902 family protein	NA	NA	NA	NA
WP_098521571.1\|340523_341078_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_157410508.1\|341225_342653_-	glucosaminidase	G3MAW8	Bacillus_virus	3.2e-26	42.3

DBSCAN-SWA_18

348756 : 355699

Trichoplusia_ni_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410511.1\|348756_349521_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.5e-22	29.1
WP_157410512.1\|350384_351290_-	EamA family transporter	NA	NA	NA	NA
WP_157410513.1\|351399_352791_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	2.7e-25	25.8
WP_157410514.1\|352992_353979_-	DUF4046 domain-containing protein	NA	NA	NA	NA
WP_157410515.1\|354205_355699_+	MFS transporter	A0A0P0IY73	Acinetobacter_phage	2.5e-82	40.9

DBSCAN-SWA_19

370616 : 396525

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410525.1\|370616_385499_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	6.5e-186	28.9
WP_157410526.1\|385495_391966_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	7.1e-190	28.8
WP_157410527.1\|391968_396525_-	amino acid adenylation domain-containing protein	A0A2K9KZV5	Tupanvirus	1.4e-94	28.2

DBSCAN-SWA_20

414912 : 419580

Bacillus_phage(66.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048530221.1\|414912_415257_-	DUF4064 domain-containing protein	A0A0S2MVJ2	Bacillus_phage	1.0e-39	74.6
WP_048530218.1\|415269_415800_-	DUF4352 domain-containing protein	A0A0S2MVG4	Bacillus_phage	5.5e-16	33.7
WP_017673437.1\|416675_416816_+	hypothetical protein	NA	NA	NA	NA
WP_157410533.1\|416808_417735_+\|holin	choline-binding protein A	NA	NA	NA	NA
WP_157410534.1\|418032_419580_+	mosquitocidal toxin protein	Q38196	Clostridium_botulinum_phage	1.1e-08	37.6

DBSCAN-SWA_21

428484 : 431451

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410540.1\|428484_429594_-	peptidoglycan DD-metalloendopeptidase family protein	A7KUS1	Bacillus_phage	4.4e-15	38.3
WP_157410577.1\|429669_431451_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.5e-36	29.7

DBSCAN-SWA_22

444272 : 444437

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167519277.1\|444272_444437_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.4e-18	90.7

DBSCAN-SWA_23

449783 : 449948

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_166689762.1\|449783_449948_+	hypothetical protein	A0A288WGN0	Bacillus_phage	1.3e-08	50.0

DBSCAN-SWA_24

486200 : 487322

Bacillus_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410564.1\|486200_487322_+\|transposase	IS200/IS605 family element transposase accessory protein TnpB	S6AND0	Bacillus_phage	7.3e-175	82.3

Anti-CRISPR protein detection

Acr_ID: NZ_CP040345.1|WP_157410327.1|18654_18942_-|hypothetical-protein

Click the colored protein region to show detailed information

Acr_ID: NZ_CP040345.1|WP_167519266.1|31365_31620_+|hypothetical-protein

Click the colored protein region to show detailed information

Acr ID

Acr position

Acr size

Homology with known anti

Neighbor HTH/AcRanker

Neighbor Aca

In prophage

Protospacer in prophage

NZ_CP040345.1|WP_157410327.1|18654_18942_-|hypothetical-protein

18654_18942_-

95 aa aa

11849-58976

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP040345_1	Unclear	1.5\|46436\|18\|NZ_CP040345\|CRT	46436-46453	18	46184-46201	0

1. spacer 1.5|46436|18|NZ_CP040345|CRT matches to NZ_CP040345 position: 46184-46201, mismatch: 0

agagacaaaaccagaaac	CRISPR spacer
agagacaaaaccagaaac	Protospacer
******************

NZ_CP040345.1|WP_167519266.1|31365_31620_+|hypothetical-protein

31365_31620_+

84 aa aa

11849-58976

yes

CRISPR ID	CRISPR type	Spacer info	Spacer location	Spacer length	Protospacer location	Mismatch
NZ_CP040345_1	Unclear	1.5\|46436\|18\|NZ_CP040345\|CRT	46436-46453	18	46184-46201	0

1. spacer 1.5|46436|18|NZ_CP040345|CRT matches to NZ_CP040345 position: 46184-46201, mismatch: 0

agagacaaaaccagaaac	CRISPR spacer
agagacaaaaccagaaac	Protospacer
******************

2. NZ_CP040346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

11886 : 20436

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_098289465.1\|11886_12168_+	hypothetical protein	D2XR31	Bacillus_phage	1.1e-34	83.9
WP_157410586.1\|12170_12383_+	hypothetical protein	NA	NA	NA	NA
WP_157410587.1\|12382_13150_+	N-acetylmuramoyl-L-alanine amidase	A0A1B1P7G0	Bacillus_phage	6.3e-45	46.6
WP_157410588.1\|13188_13545_-	YolD-like family protein	NA	NA	NA	NA
WP_157410589.1\|13604_13844_-	hypothetical protein	NA	NA	NA	NA
WP_088106220.1\|14027_14255_-	helix-turn-helix transcriptional regulator	A0A0S2MVM0	Bacillus_phage	1.1e-18	59.7
WP_167519279.1\|14403_14739_+	hypothetical protein	O48480	Bacillus_phage	2.2e-10	44.0
WP_157410590.1\|14863_15217_+	glycosyltransferase	W8EK86	Geobacillus_phage	7.2e-36	65.0
WP_157410591.1\|15230_15584_+	hypothetical protein	A0A2I7QIL8	Bacillus_phage	4.8e-32	62.1
WP_157410592.1\|15585_18138_+	ATP-binding protein	W8EEX6	Geobacillus_phage	0.0e+00	65.5
WP_157410593.1\|18264_18855_+	DUF3967 domain-containing protein	A0A1Z1LZN4	Bacillus_phage	3.9e-10	35.1
WP_157410594.1\|18898_19162_-	hypothetical protein	NA	NA	NA	NA
WP_000369031.1\|19256_19616_-	hypothetical protein	NA	NA	NA	NA
WP_157410595.1\|19608_20436_-	AAA family ATPase	F0PIG8	Enterococcus_phage	5.2e-53	41.1

DBSCAN-SWA_2

23588 : 54617

Bacillus_phage(65.12%)

portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157410597.1\|23588_24053_-	stress protein	A0A0K2CZD8	Paenibacillus_phage	6.3e-24	39.9
WP_157410598.1\|24077_24560_-	hypothetical protein	O64019	Bacillus_phage	6.8e-37	46.8
WP_157410644.1\|24747_25092_-	helix-turn-helix domain-containing protein	A0A1B1P888	Bacillus_phage	5.4e-20	46.4
WP_157410599.1\|25596_26736_+	hypothetical protein	D2XQ10	Bacillus_virus	1.0e-200	92.6
WP_167519280.1\|26770_26923_+	hypothetical protein	B5LPU5	Bacillus_virus	2.1e-16	90.0
WP_001052323.1\|27232_27577_-	helix-turn-helix transcriptional regulator	D2XQ11	Bacillus_virus	2.3e-55	96.5
WP_157410600.1\|27831_28098_+	helix-turn-helix domain-containing protein	B5LPU7	Bacillus_virus	1.1e-33	96.2
WP_157410601.1\|28072_28840_+	phage antirepressor Ant	A0A2H4JCR9	uncultured_Caudovirales_phage	1.2e-46	42.2
WP_167519281.1\|28952_29093_+	hypothetical protein	A0A1B1P8A8	Bacillus_phage	7.0e-19	97.8
WP_157410602.1\|29108_29288_+	hypothetical protein	A0A1B1P7L7	Bacillus_phage	6.4e-09	63.3
WP_140972956.1\|29497_29698_+	hypothetical protein	NA	NA	NA	NA
WP_157410603.1\|29699_30635_+	hypothetical protein	S6C475	Thermus_phage	2.0e-101	59.8
WP_157410604.1\|30649_31477_+	recombination protein RecT	S6AVW6	Thermus_phage	1.7e-96	66.3
WP_157410605.1\|31644_31866_+	hypothetical protein	NA	NA	NA	NA
WP_157410606.1\|31866_32649_+	phage replication protein	A0A0M4S6Y4	Bacillus_phage	9.0e-47	59.8
WP_157410645.1\|32599_33481_+	AAA family ATPase	Q2I8C8	Bacillus_phage	1.9e-85	54.8
WP_157410607.1\|33493_33703_+	hypothetical protein	A0A1B1P8D7	Bacillus_phage	1.7e-21	81.0
WP_157410608.1\|33671_33959_+	helix-turn-helix domain-containing protein	A0A1B1P7W1	Bacillus_phage	4.2e-26	61.1
WP_157410609.1\|33955_34222_+	hypothetical protein	W8CYZ5	Bacillus_phage	2.8e-24	60.2
WP_088027311.1\|34233_34686_+	nucleoside permease	A0A0M4R373	Bacillus_phage	1.2e-11	45.2
WP_157410610.1\|34682_35099_+	hypothetical protein	A0A1B1P8A6	Bacillus_phage	1.7e-15	52.2
WP_157410611.1\|35108_35252_+	Fur-regulated basic protein FbpA	A0A1B1P8B6	Bacillus_phage	4.0e-14	84.1
WP_157410612.1\|35593_35830_+	glutaredoxin family protein	A0A1B1P8E0	Bacillus_phage	3.3e-37	93.5
WP_164876602.1\|35840_36017_+	hypothetical protein	NA	NA	NA	NA
WP_157410613.1\|36021_36519_+	hypothetical protein	A0A223LKN9	Bacillus_phage	4.4e-15	32.7
WP_157410614.1\|36557_36848_+	transcriptional regulator	I7ILW5	Bacillus_phage	7.7e-12	63.2
WP_157410615.1\|36885_37467_+	hypothetical protein	A0A0M4RU33	Bacillus_phage	3.5e-11	37.5
WP_000397931.1\|37509_37776_+	hypothetical protein	D2XR50	Bacillus_phage	2.2e-13	42.7
WP_157410616.1\|37819_38047_+	hypothetical protein	A0A288WFX6	Bacillus_phage	4.6e-36	98.7
WP_157410617.1\|38081_38483_+	hypothetical protein	S5MUC4	Brevibacillus_phage	1.0e-09	52.8
WP_167519282.1\|38516_38666_+	hypothetical protein	NA	NA	NA	NA
WP_157410618.1\|38766_38973_+	hypothetical protein	A0A0A0RNI3	Bacillus_phage	1.0e-10	53.7
WP_157410619.1\|39019_39292_+	hypothetical protein	NA	NA	NA	NA
WP_157410620.1\|39306_39489_+	hypothetical protein	A0A223LHD1	Bacillus_phage	3.2e-16	71.9
WP_157410621.1\|39522_39717_+	hypothetical protein	NA	NA	NA	NA
WP_157410622.1\|39753_40143_+	hypothetical protein	A0A0A7AR03	Bacillus_phage	7.6e-31	62.1
WP_157410623.1\|40238_40505_+	hypothetical protein	NA	NA	NA	NA
WP_167519283.1\|40543_40720_+	hypothetical protein	A0A1B1P875	Bacillus_phage	6.5e-22	86.0
WP_157410624.1\|40721_41138_+	RusA family crossover junction endodeoxyribonuclease	S6B1L9	Thermus_phage	1.1e-48	70.1
WP_098672046.1\|41373_41829_+	hypothetical protein	NA	NA	NA	NA
WP_157410625.1\|42604_42943_+	hypothetical protein	NA	NA	NA	NA
WP_157410626.1\|43081_43357_-	hypothetical protein	NA	NA	NA	NA
WP_157410627.1\|43453_44038_+	recombinase family protein	M9Q1K0	Clostridium_phage	1.0e-26	48.6
WP_157410628.1\|44049_44874_+	GIY-YIG nuclease family protein	D2XPX7	Bacillus_virus	7.0e-74	58.8
WP_157410629.1\|45147_46095_+\|terminase	terminase	A0A0A7AR21	Bacillus_phage	1.7e-132	94.6
WP_157410630.1\|46066_47386_+\|terminase	PBSX family phage terminase large subunit	A0A0S2MVC1	Bacillus_phage	1.6e-176	69.4
WP_157410631.1\|47382_48921_+\|portal	phage portal protein	A0A1B1P7C8	Bacillus_phage	9.6e-85	37.2
WP_157410632.1\|48907_49831_+	hypothetical protein	A0A1B1P7D7	Bacillus_phage	1.1e-46	35.7
WP_157410633.1\|49830_50082_+	hypothetical protein	NA	NA	NA	NA
WP_157410634.1\|50096_51302_+	hypothetical protein	A0A1B1P7E4	Bacillus_phage	5.2e-78	45.2
WP_157410635.1\|51317_52235_+\|capsid	phage major capsid protein	A5GYL9	Lactococcus_phage	1.4e-43	33.4
WP_157410636.1\|52253_52445_+	hypothetical protein	NA	NA	NA	NA
WP_157410637.1\|52437_52668_+	hypothetical protein	NA	NA	NA	NA
WP_157410638.1\|52681_53074_+	DUF3199 family protein	A0A1B1P7D6	Bacillus_phage	4.4e-18	39.1
WP_157410639.1\|53073_53454_+	DUF3599 family protein	NA	NA	NA	NA
WP_157410640.1\|53438_53735_+	HK97 gp10 family phage protein	A0A249XXA4	Clostridium_phage	2.8e-17	54.0
WP_157410641.1\|53813_54617_+	hypothetical protein	A0A2R4P8H7	Staphylococcus_phage	2.3e-37	45.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP040344

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP040344_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040344_1

1140202-1140331

Orphan

Consensus_repeat	Method
CCGAACATACATCTTAAACAAACGTTTGATTAACTCCCTATTTTTCTTT	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP040344_1

>merge|NZ_CP040344|1|1140202-1140331|CRISPRCasFinder
CCGAACATACATCTTAAACAAACGTTTGATTAACTCCCTATTTTTCTTTGTTAACCCTTGAGCTACATCCCTTTCTTCCTACCGAACATACATCTTAAACAAACGTTTGATTAACTCCCCATTTTTCTTT

>NZ_CP040344|1|1|1140202-1140331|CRISPRCasFinder
CCGAACATACATCTTAAACAAACGTTTGATTAACTCCCTATTTTTCTTT	GTTAACCCTTGAGCTACATCCCTTTCTTCCTA
CCGAACATACATCTTAAACAAACGTTTGATTAACTCCCCATTTTTCTTT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040344.1\|WP_048528311.1\|1135345_1136011_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224922
NZ_CP040344.1\|WP_128805272.1\|1149820_1152202_-\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	unknown	unknown	gnl\|CDD\|224170
NZ_CP040344.1\|WP_071758617.1\|1145714_1146437_-\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293807
NZ_CP040344.1\|WP_001180555.1\|1144296_1144482_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_128805273.1\|1145162_1145711_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|379115
NZ_CP040344.1\|WP_071758621.1\|1141100_1141748_+\|phosphatase-PAP2-family-protein	unknown	unknown	gnl\|CDD\|239481
NZ_CP040344.1\|WP_048528316.1\|1133631_1134438_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP040344.1\|WP_088313413.1\|1136003_1137029_-\|methionine-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224058
NZ_CP040344.1\|WP_116746363.1\|1146575_1148378_-\|acyl-CoA-dehydrogenase	unknown	unknown	gnl\|CDD\|173850
NZ_CP040344.1\|WP_048528312.1\|1134509_1135322_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|224381
NZ_CP040344.1\|WP_001206342.1\|1148626_1149799_-\|acetyl-CoA-C-acetyltransferase	unknown	unknown	gnl\|CDD\|181072
NZ_CP040344.1\|WP_048528307.1\|1137562_1137907_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_048528298.1\|1144031_1144283_-\|spore-coat-protein	unknown	unknown	gnl\|CDD\|377935
NZ_CP040344.1\|WP_000666176.1\|1141803_1142817_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|379113
NZ_CP040344.1\|WP_048528303.1\|1140429_1140957_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_000218968.1\|1139642_1140008_-\|arsenate-reductase-family-protein	unknown	unknown	gnl\|CDD\|239334
NZ_CP040344.1\|WP_000640869.1\|1138373_1138718_-\|DNA-primase	unknown	unknown	gnl\|CDD\|224572
NZ_CP040344.1\|WP_048528305.1\|1138061_1138361_-\|thioredoxin-family-protein	unknown	unknown	gnl\|CDD\|239245
NZ_CP040344.1\|WP_000026896.1\|1139217_1139601_-\|glycine-cleavage-system-protein-GcvH	unknown	unknown	gnl\|CDD\|234918
NZ_CP040344.1\|WP_000929160.1\|1132607_1133393_-\|Fe-S-cluster-assembly-ATPase-SufC	unknown	unknown	gnl\|CDD\|223473

Protein	Function_ID	Function_description	E-value
NZ_CP040344.1\|WP_048528311.1\|1135345_1136011_-\|ABC-transporter-permease	gnl\|CDD\|224922	COG2011, AbcD, ABC-type metal ion transport system, permease component [Inorganic ion transport and metabolism].	1.37123e-98
NZ_CP040344.1\|WP_128805272.1\|1149820_1152202_-\|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein	gnl\|CDD\|224170	COG1250, FadB, 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism].	1.34944e-82
NZ_CP040344.1\|WP_071758617.1\|1145714_1146437_-\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293807	cd07721, yflN-like_MBL-fold, uncharacterized subgroup which includes Bacillus subtilis yflN; MBL-fold metallo hydrolase domain. This subgroup includes the uncharacterized Bacillus subtilis yflN protein. Members of this subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions. The class B metal beta-lactamases (MBLs) from which this fold was named are only a small fraction of the activities which are included in this superfamily. Activities carried out by superfamily members include class B beta-lactamases, hydroxyacylglutathione hydrolases, AHL (acyl homoserine lactone) lactonases, persulfide dioxygenases, flavodiiron proteins, cleavage and polyadenylation specificity factors such as the Int9 and Int11 subunits of Integrator, Sdsa1-like and AtsA-like arylsulfatases, 5'-exonucleases human SNM1A and yeast Pso2p, ribonuclease J and ribonuclease Z, cyclic nucleotide phosphodiesterases, insecticide hydrolases, and proteins required for natural transformation competence. Classical members of the superfamily are di-, or less commonly mono-, zinc-ion-dependent hydrolases, however the diversity of biological roles is reflected in variations in the active site metallo-chemistry.	1.0331e-71
NZ_CP040344.1\|WP_128805273.1\|1145162_1145711_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|379115	pfam13305, WHG, WHG domain. This presumed domain is around 80 amino acids in length. It is found to the C-terminus of a DNA-binding helix-turn-helix domain. This domain may be involved in binding to an as yet unknown ligand that allows a transcriptional regulation response to that molecule. The domain is named WHG after three conserved residues near the C-terminus of the domain.	2.19562e-24
NZ_CP040344.1\|WP_071758621.1\|1141100_1141748_+\|phosphatase-PAP2-family-protein	gnl\|CDD\|239481	cd03386, PAP2_Aur1_like, PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p or Ipc1p is necessary for the addition of inositol phosphate to ceramide, an essential step in yeast sphingolipid synthesis, and is the target of several antifungal compounds such as aureobasidin.	3.94641e-16
NZ_CP040344.1\|WP_048528316.1\|1133631_1134438_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	1.37833e-111
NZ_CP040344.1\|WP_088313413.1\|1136003_1137029_-\|methionine-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224058	COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism].	1.22934e-175
NZ_CP040344.1\|WP_116746363.1\|1146575_1148378_-\|acyl-CoA-dehydrogenase	gnl\|CDD\|173850	cd01161, VLCAD, Very long chain acyl-CoA dehydrogenase. VLCAD is an acyl-CoA dehydrogenase (ACAD), which is found in the mitochondria of eukaryotes and in some bacteria. It catalyzes the alpha,beta dehydrogenation of the corresponding trans-enoyl-CoA by FAD, which becomes reduced. The reduced form of ACAD is reoxidized in the oxidative half-reaction by electron-transferring flavoprotein (ETF), from which the electrons are transferred to the mitochondrial respiratory chain coupled with ATP synthesis. VLCAD acts as a homodimer.	0
NZ_CP040344.1\|WP_048528312.1\|1134509_1135322_-\|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein	gnl\|CDD\|224381	COG1464, NlpA, ABC-type metal ion transport system, periplasmic component/surface antigen [Inorganic ion transport and metabolism].	5.27917e-112
NZ_CP040344.1\|WP_001206342.1\|1148626_1149799_-\|acetyl-CoA-C-acetyltransferase	gnl\|CDD\|181072	PRK07661, PRK07661, acetyl-CoA C-acetyltransferase.	0
NZ_CP040344.1\|WP_048528298.1\|1144031_1144283_-\|spore-coat-protein	gnl\|CDD\|377935	pfam07875, Coat_F, Coat F domain. The Coat F proteins, which contribute to the Bacillales spore coat. It occurs multiple times in the genomes it is found in.	1.17677e-14
NZ_CP040344.1\|WP_000929160.1\|1132607_1133393_-\|Fe-S-cluster-assembly-ATPase-SufC	gnl\|CDD\|223473	COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones].	8.75164e-150
NZ_CP040344.1\|WP_000218968.1\|1139642_1140008_-\|arsenate-reductase-family-protein	gnl\|CDD\|239334	cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.	6.13259e-61
NZ_CP040344.1\|WP_000640869.1\|1138373_1138718_-\|DNA-primase	gnl\|CDD\|224572	COG1658, COG1658, Small primase-like proteins (Toprim domain) [DNA replication, recombination, and repair].	2.03274e-21
NZ_CP040344.1\|WP_048528305.1\|1138061_1138361_-\|thioredoxin-family-protein	gnl\|CDD\|239245	cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functional TRXs have been reported in most organisms; in eukaryotes, they are located in the cytoplasm and the mitochondria. Higher plants contain more types (at least 20 TRX genes have been detected in the genome of Arabidopsis thaliana), two of which (types f amd m) are located in the same compartment, the chloroplast. Also included in the alignment are TRX-like domains which show sequence homology to TRX but do not contain the redox active CXXC motif. Group II proteins, in addition to either a redox active TRX or a TRX-like domain, also contain additional domains, which may or may not possess homology to known proteins.	1.75217e-18
NZ_CP040344.1\|WP_000026896.1\|1139217_1139601_-\|glycine-cleavage-system-protein-GcvH	gnl\|CDD\|234918	PRK01202, PRK01202, glycine cleavage system protein GcvH.	6.96592e-70
NZ_CP040344.1\|WP_000666176.1\|1141803_1142817_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|379113	pfam13303, PTS_EIIC_2, Phosphotransferase system, EIIC. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. The sugar-specific permease of the PTS consists of three domains (IIA, IIB and IIC). The IIC domain catalyzes the transfer of a phosphoryl group from IIB to the sugar substrate.	1.25572e-86

>NZ_CP040344.1|WP_000218968.1|1139642_1140008_-|arsenate-reductase-family-protein
MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSKEDLRNLHEKSELPLKKFFNTSGMRYRELGLKDKLKDASEDEMYELLASDGMLIKRPIVTDGTNVTLGFNEEQFESVWKKYQ
>NZ_CP040344.1|WP_000026896.1|1139217_1139601_-|glycine-cleavage-system-protein-GcvH
MSIPNNLRYSEEHEWVKTEGNEVVIGITHFAQGELGDIVFVELPEVGATIEADEPFGSVESVKTVSELYAPVSGKVVAVNEELSDQPELVNESPYEGAWMVKVELSDASQVEKLLTAEKYAEMTNQD
>NZ_CP040344.1|WP_000640869.1|1138373_1138718_-|DNA-primase
MIYVEKVIIVEGTSDRRKIESIIREPVEIVCTNGTIGLSKMDELVDQFFDKEVYVLVDADDAGEKLRKQFRKEFPQAEHIYIDRSYREVATAPSSHLANVLWGADIDVYTEYLR
>NZ_CP040344.1|WP_048528305.1|1138061_1138361_-|thioredoxin-family-protein
MIDWTGAEATALIENEEKTVLYVYTPMCGTCQLAKKMLTVVELTIEDLKIGMLDLNYAPHLAKEYGIESVPCLLVFENGTLMKKIYAFHSVEYLYTELK
>NZ_CP040344.1|WP_048528307.1|1137562_1137907_-|hypothetical-protein
MKLYSLLQSFVNYANGQYHLEPLLRQGEKTVNFRFGDESCSLQISRDYIELLHEEIGTEQIVCVDEEDVKQLVNGNVRLQMLMNDGRVQYSGTYRTMLLVESMFHICKPMSVGA
>NZ_CP040344.1|WP_088313413.1|1136003_1137029_-|methionine-ABC-transporter-ATP-binding-protein
MILLENVKKIYKAKSGDVTAVDNANLKIDKGEIFGVIGYSGAGKSSLIRLFNQLEKPTSGQITIANRVISAIKGSELRKARQEIGMIFQHFNLLWSRTVRENIEFPLEIAGVDKAQRRKRVDELIHLVGLEGRGDAYPSQLSGGQKQRVGIARALANNPQVLLCDEATSALDPETTDQILDLLLDINKRLGLTIVLITHEMHVIRKICNRVAVMEKGKIVETGPVLDVFRNPQKDITKRFVQQLTDSEDTNETIESLIEKYPDGRVIRLQFIGEAVERPVLQRLMQRSDIEVSILQGNIAQTNNGSYGSLVVHLNGEETAIQQAIEGIHQDQVELEVIAHG
>NZ_CP040344.1|WP_048528311.1|1135345_1136011_-|ABC-transporter-permease
MDKLLTNVDWNQMLEATGETLYMTAIAALATFVLGLILGLLLFMTAKDNLWENKTVNTAIGAFVNIFRSIPFIILIILLIPFTKILLGTILGASAALPALIIGAAPFYARMVEIALREIDKGVIEASKAMGAKTSTIILKVLIPESLPALVSGITVTTIALVGYTAMAGVVGAGGLGTLAYLEGFQRGNNDVTIVATICVLLVVFFIQWIGDRVTTRIDKR
>NZ_CP040344.1|WP_048528312.1|1134509_1135322_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKLLLTALISTSIFGLAACGGKDKDEKKLVVGASNVPHAEILEKAKPLLEKKGIELEVKKFQDYVLPNKSLADKDLDANYFQHIPYLEKEIKDKKYDFEIAGKIHLEPIGVYSQKYKSLKELPDGATIIMSNSVTDHGRGLAILQKEGILKIKDGVDPVSATPKDIADNPKNLKFKTDIEPGLLPQVYNNKEGDAVLINSNYAIDAKLNPEKDAIAIEGDDSPYANVVAVRKGDKDKKAIKELVEVLHSKEIEDFITKEYKGAVVPVKE
>NZ_CP040344.1|WP_048528316.1|1133631_1134438_-|MetQ/NlpA-family-ABC-transporter-substrate-binding-protein
MKKILLSVVTALSVFTLAACGGKEENKLVVGASNVPHAVILEKAQPILEKKGIKLEIKKFQDYVLPNKALADKEIDANYFQHIPYLDKEIQEKGYKIVNAGKIHLEPMGIYSKKYKSLKDLPEGGTVIMSNNVAERGRMLALLQKGGVIKLKDGVDVVKATVKDVVENPKNLKFKTDVEPGLSPKLYENNEGDALFINSNYAIDAKLNPTKDAIAIEGSDSPYANIIAVRKGDEKKKEIKELVEVLHSKEIQDFITKEYKGAVLPVNE
>NZ_CP040344.1|WP_000929160.1|1132607_1133393_-|Fe-S-cluster-assembly-ATPase-SufC
MAGSTLTVKDLHVSIDGKEILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHPKYEVTEGSIIIDGEDVLEMEVDERAQAGLFLAMQYPSEISGVTNADFLRSAINARREEGDEISLMKFIRTLDKNMEFLEMDPEMAQRYLNEGFSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINEMRGEEFGCLMITHYQRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETTEQEA
>NZ_CP040344.1|WP_048528303.1|1140429_1140957_-|hypothetical-protein
MKRLSYFLVFILICLVGAGCAKDKEGEKLEYNGRALVIGVIGEKPKDTFRNIKFEEMKLEELEKKSKEVDGFLIMKDHFQEASTEQYKNVFSSLKKPVFFIGLQDKSYSIFITKGIEYNSARKDVNAMYTQGFANIGSGEGQQWAVGLSNGGNTEESIHNMYIVVFQTIADYLNR
>NZ_CP040344.1|WP_071758621.1|1141100_1141748_+|phosphatase-PAP2-family-protein
MKKFKLSSFLPLSYILLLVLVSPLYDVLNKSAVHAVDVTTIVDDWIPFVKAFIIPYLLWFPYLYGALIYYCFADRKQYYVTLSSIILGKLACFSIYYFWQTTVPRPTVVGSDVFSELVRYIYSIDQPVNCFPSIHVLTTFIIMLAAFKRREQHAFEYYILMFFGTLIILSTLFTKQHAFVDAISGMTLASILYFGVQLLLAKETVRVPVKQNQKM
>NZ_CP040344.1|WP_000666176.1|1141803_1142817_-|PTS-sugar-transporter-subunit-IIC
MKEYIMSRVFKASAGIAQGIFVSLGIGLLIENIGRIVDIPLLITIGVVAKSLMAPAIGAGIAFMLGANGLVIFSAMVAGAIGAGSISITEAGLIIKTGEPIGALLTATLAVYIGKRLSGKTALDMMLVPFAAILGSGLVGIWLSHNITPVLNTVGAFIKDSSAGSPFIASIVIAVVWGLLLISPASSAALAIALSLDGVAGGAALAGCVAQFIGFSVISAKENNLGGILAQALCTPKVQLPNITKNPMILVPTVVASAIVGPVSALIFQLEAGKEIAGLGLSSLIAPINLISSEGWEVVPAMVITYIIIPVAVSYILYIALKKAGRIHSGDMTVPQS
>NZ_CP040344.1|WP_048528298.1|1144031_1144283_-|spore-coat-protein
MNEKDMVNDYLAGLNASLTSYANYIAQSDNEQLHQTLIQIRNQDEMRQRNMYEYAKQKSYYKPAAPANPMIVQQLKSQLSTEQ
>NZ_CP040344.1|WP_001180555.1|1144296_1144482_-|hypothetical-protein
MQNLTELEVENLRHLIGGHATIINKLEQYAQTCTDPQLKQMLQKDAQDARNTKQQLMTFLG
>NZ_CP040344.1|WP_128805273.1|1145162_1145711_-|TetR/AcrR-family-transcriptional-regulator
MSPRIGLTLQKIVETAAEIADTNGIQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLGIYGMKQLYDRLEEAAEGKRMDEAIHALGEAYVAFVRKHPGLYEATFLRDEEVRKAGDGIVKLCLHVLQQYELEGENALHATRGFRSICHGFASIEQQGGFGLPLDLDTSLHVLLETFIKGLRE
>NZ_CP040344.1|WP_071758617.1|1145714_1146437_-|MBL-fold-metallo-hydrolase
MRMIHEKTVYQLSFLPRVFPVNCYFVEEEDSLTLIDAALPYSAKGILQAAEKIGKPITKIVLTHAHDDHIGALDALKEVLPNVPVYISKRDAKLLEGDATLQEDEPNIPIKGGVPKKVKTVPDVLLEDGDRVGSLLAIMTPGHTPGSMSFLDVRNKALIVGDAFQTRGGMAVSGQMKFWFPFPAMATWSKEISLQSAEKLSEYAPSLLAAGHGKMIKNPGTVIELAIKEAKRNIESRKEG
>NZ_CP040344.1|WP_116746363.1|1146575_1148378_-|acyl-CoA-dehydrogenase
MKEEIFMEKTVGSAVKGGSFLVDEITIDQVFTPEDFSSEHKMIAKTTEDFIVNEVLPELEYLEQHEFDRSVRLLKEAGELGLLGADVPEEYGGIGLDKVSSALIAEKFSRAGGFAITHGAHVGIGSLPIVLFGNEEQKKKYLPLLATGEKLAAYALTEPGSGSDALGAKTTARLNAEGTHYVLNGEKQWITNSAFADVFIVYAKIDGEHFSAFIVEKEYAGVSTSPEEKKMGIKCSSTRTLILEDALVPKENLLGEVGKGHIIAFNILNIGRYKLGVGTVGSAKRAVEISAQYANQRQQFKQPIARFPLIQEKLANMAAKTYAAESSVYRTVGLFESRMSTLSEEEVKDGKAVAASIAEYAIECSLNKVFGSEVLDYTVDEGVQIHGGYGFMAEYEIERMYRDSRINRIFEGTNEINRLIVPGTFLRKAMKGELPLLQKAQKLQEELMMMMPEEVGDEPLALQKYLVSNAKKIGLMVAGLAAQKYGKALDKEQEILVNIADIVSNLYAMESAVLRTEKAIKTTGLEKNKQKVLYTEVFCQEAFNEIEADAKETLIAVENGDMLRMMLSSLRKLTRHTPLNVIPKKREIAAKILEDERYTV
>NZ_CP040344.1|WP_001206342.1|1148626_1149799_-|acetyl-CoA-C-acetyltransferase
MREAVIVAGARTPIGKAKRGSLKTVRPDDLGALVVKETLKRANYEGPIDDLIFGCAMPEAEQGLNMARNIGGLAGLSYDVPAITINRYCSSGLQSIAYGAERIMLGHSEAVLSGGAESMSLVPMMGHVVRPNSRLVEAAPEYYMGMGHTAEQVAVKYGISREEQDAFAVRSHQRAAKALAAGNFADETVSVDVTLRTVGSNNKLQEETIIFAQDEGVRAETTLDILGKLRPAFNVRGSVTAGNSSQMSDGAASVLLMDREKAVSDGMKPLAKFRSFAVAGVPPEVMGIGPIAAIPKALKLAGLELSDIGLFELNEAFASQSIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLIHEMKRRNEQFGIVTMCIGGGMGAAGVFELL
>NZ_CP040344.1|WP_128805272.1|1149820_1152202_-|3-hydroxyacyl-CoA-dehydrogenase/enoyl-CoA-hydratase-family-protein
MFQIKKAAVLGSGVMGSGIAAHLANIGIPTLLLDIVPPALTKEEEAKGLTLEHKSVRNRFSNTALQKLLKQKPAPLTVKGNLALIEAGNLEDDLERLADVDWIIEVVVENLDIKKKLFEKVDAVRKPGSIVSSNTSGISVEKMAEGRSNDFQKHFLGTHFFNPPRYLKLLEVIPTKETDPQVLSFMKLFGEDVLGKGVVIAKDTPNFIGNRIGTYGLLVTLQEMVKRGYSIGEVDSVTGPLIGRPKSATFRTLDVVGLDTFVHVANNVYENVQEEERDVFKVPAFMHDMLDKKWLGSKTGQGFFLKQGKEILELNPETMEYEARKKLKAASIELSKQEKGLSNKLKALVYAKDRAGELLWNIITPTLLYSAKLHKEIADDIVAIDQAMKWGFGWEQGPFEVWDAIGVEKSVQKMEENGVVVPTWVKEMLEKGFTTFYKHDNGDSYYYDNGEYKLIERNKKAISLKQLKAKNGVLKKNSGASLIDLGDGILCLEFHSKSNAIGMDITQMINYAVDEVEKNYKGLVIGNQSKNFCVGANLAMILMEAQDDNYFEIELVVKNFQDAMTKIKYSSKPVVAAPYGMTLGGGTEVCLPAASIQASSETYMGLVEVGVGLIPGGGGNKELYIKHLNKMANGVEFDLQKVANKVFETVAMAKVSTSGQEAVSHNFLGDKDGISVNGDHLLYDAKQKALALYEAGYKAPIRKKIPVVGETGYATLVLGAEAMHLSGYISEHDLHIAKKLAYVIAGGKVPYGTEVDEQYLLDVEREAFISLVSEMKSQARMQHMLVKGKPLRN

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040344_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040344_2

2674579-2674672

Orphan

Consensus_repeat	Method
GGTTTAAATACGTTAAATAGCAAAA	CRISPRCasFinder

1 spacers

WYL

The CRISPR arrays of NZ_CP040344_2

>merge|NZ_CP040344|2|2674579-2674672|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAAGCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGACGGTTTAAATACGTTAAATAGTAAAA

>NZ_CP040344|2|2|2674579-2674672|CRISPRCasFinder
GGTTTAAATACGTTAAATAGCAAAA	GCGGTATAGGGAAATTACAAGATGGATCCGGAAAAGTAACAGAC
GGTTTAAATACGTTAAATAGTAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040344.1\|WP_157409441.1\|2665009_2666362_-\|DUF4026-domain-containing-protein	unknown	unknown	gnl\|CDD\|338635
NZ_CP040344.1\|WP_071758337.1\|2670548_2670947_+\|BlaI/MecI/CopY-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|367747
NZ_CP040344.1\|WP_157409445.1\|2676549_2677260_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_001148850.1\|2669118_2669418_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_157409443.1\|2669472_2670318_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_048526572.1\|2662592_2663528_+\|ferrochelatase	unknown	unknown	gnl\|CDD\|183526
NZ_CP040344.1\|WP_048526570.1\|2661531_2662578_+\|uroporphyrinogen-decarboxylase	unknown	unknown	gnl\|CDD\|234644
NZ_CP040344.1\|WP_157409448.1\|2679434_2680376_-\|WYL-domain-containing-protein	WYL	COG2378_WYL_CAS-I:CAS-III	gnl\|CDD\|225253
NZ_CP040344.1\|WP_000140277.1\|2677852_2678158_+\|DUF2087-domain-containing-protein	unknown	unknown	gnl\|CDD\|378279
NZ_CP040344.1\|WP_048526591.1\|2681935_2682670_+\|MBL-fold-metallo-hydrolase	unknown	unknown	gnl\|CDD\|293802
NZ_CP040344.1\|WP_000963378.1\|2673062_2673635_+\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224228
NZ_CP040344.1\|WP_000567010.1\|2681626_2681755_-\|YhfH-family-protein	unknown	unknown	gnl\|CDD\|379490
NZ_CP040344.1\|WP_128974539.1\|2663548_2664970_+\|protoporphyrinogen-oxidase	unknown	unknown	gnl\|CDD\|237009
NZ_CP040344.1\|WP_157409442.1\|2666601_2668968_+\|endonuclease	unknown	unknown	gnl\|CDD\|225249
NZ_CP040344.1\|WP_071758349.1\|2670952_2672848_+\|M56-family-metallopeptidase	unknown	unknown	gnl\|CDD\|310280
NZ_CP040344.1\|WP_157409447.1\|2678849_2679350_-\|DUF1569-domain-containing-protein	unknown	unknown	gnl\|CDD\|378981
NZ_CP040344.1\|WP_001988614.1\|2677600_2677816_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_157409446.1\|2678229_2678733_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP040344.1\|WP_000103726.1\|2680573_2681587_+\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224525
NZ_CP040344.1\|WP_157409449.1\|2682679_2683669_+\|lipoate--protein-ligase	unknown	unknown	gnl\|CDD\|161920

Protein	Function_ID	Function_description	E-value
NZ_CP040344.1\|WP_157409441.1\|2665009_2666362_-\|DUF4026-domain-containing-protein	gnl\|CDD\|338635	pfam13218, DUF4026, Protein of unknown function (DUF4026). This family of proteins is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 450 amino acids in length. The family is found in association with pfam10077.	3.50912e-175
NZ_CP040344.1\|WP_071758337.1\|2670548_2670947_+\|BlaI/MecI/CopY-family-transcriptional-regulator	gnl\|CDD\|367747	pfam03965, Penicillinase_R, Penicillinase repressor. The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.	2.36613e-45
NZ_CP040344.1\|WP_000567010.1\|2681626_2681755_-\|YhfH-family-protein	gnl\|CDD\|379490	pfam14149, YhfH, YhfH-like protein. The YhfH-like protein family includes the B. subtilis YhfH protein, which is functionally uncharacterized. Its expression is repressed by the Spx paralogue MgsR, which regulates genes involved in stress response. This family of proteins is found in bacteria. Proteins in this family are typically between 42 and 53 amino acids in length.	3.52581e-13
NZ_CP040344.1\|WP_157409449.1\|2682679_2683669_+\|lipoate--protein-ligase	gnl\|CDD\|161920	TIGR00545, Probable_lipoate-protein_ligase_A, lipoyltransferase and lipoate-protein ligase. One member of this group of proteins is bovine lipoyltransferase, which transfers the lipoyl group from lipoyl-AMP to the specific Lys of lipoate-dependent enzymes. However, it does not first activate lipoic acid with ATP to create lipoyl-AMP and pyrophosphate. Another member of this group, lipoate-protein ligase A from E. coli, catalyzes both the activation and the transfer of lipoate. Homology between the two is full-length, except for the bovine mitochondrial targeting signal, but is strongest toward the N-terminus. [Protein fate, Protein modification and repair].	5.44696e-139
NZ_CP040344.1\|WP_048526572.1\|2662592_2663528_+\|ferrochelatase	gnl\|CDD\|183526	PRK12435, PRK12435, ferrochelatase; Provisional.	0
NZ_CP040344.1\|WP_048526570.1\|2661531_2662578_+\|uroporphyrinogen-decarboxylase	gnl\|CDD\|234644	PRK00115, hemE, uroporphyrinogen decarboxylase; Validated.	0
NZ_CP040344.1\|WP_157409448.1\|2679434_2680376_-\|WYL-domain-containing-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	7.20675e-63
NZ_CP040344.1\|WP_000140277.1\|2677852_2678158_+\|DUF2087-domain-containing-protein	gnl\|CDD\|378279	pfam09860, DUF2087, Uncharacterized protein conserved in bacteria (DUF2087). This domain, found in various hypothetical prokaryotic proteins and transcriptional activators, has no known function. Structural modelling suggests this domain may bind nucleic acids.	1.9349e-23
NZ_CP040344.1\|WP_048526591.1\|2681935_2682670_+\|MBL-fold-metallo-hydrolase	gnl\|CDD\|293802	cd07716, RNaseZ_short-form-like_MBL-fold, uncharacterized bacterial subgroup of Ribonuclease Z, short form; MBL-fold metallo-hydrolase domain. The tRNA maturase RNase Z (also known as tRNase Z or 3' tRNase) catalyzes the endonucleolytic removal of the 3' extension of the majority of tRNA precursors. Two forms of RNase Z exist in eukaryotes, one long (ELAC2) and one short form (ELAC1), the former may have resulted from a duplication of the shorter enzyme. Only the short form exists in bacteria. Members of this bacterial subgroup belong to the MBL-fold metallo-hydrolase superfamily which is comprised mainly of hydrolytic enzymes which carry out a variety of biological functions.	1.67793e-85
NZ_CP040344.1\|WP_000963378.1\|2673062_2673635_+\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|224228	COG1309, AcrR, Transcriptional regulator [Transcription].	9.25802e-15
NZ_CP040344.1\|WP_128974539.1\|2663548_2664970_+\|protoporphyrinogen-oxidase	gnl\|CDD\|237009	PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed.	0
NZ_CP040344.1\|WP_157409442.1\|2666601_2668968_+\|endonuclease	gnl\|CDD\|225249	COG2374, COG2374, Predicted extracellular nuclease [General function prediction only].	8.44844e-72
NZ_CP040344.1\|WP_071758349.1\|2670952_2672848_+\|M56-family-metallopeptidase	gnl\|CDD\|310280	pfam05569, Peptidase_M56, BlaR1 peptidase M56. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription. homologs to this peptidase domain, which corresponds to Merops family M56, are also found in a number of other bacterial genome sequences.	4.84015e-47
NZ_CP040344.1\|WP_157409447.1\|2678849_2679350_-\|DUF1569-domain-containing-protein	gnl\|CDD\|378981	pfam12867, DinB_2, DinB superfamily. The DinB family are an uncharacterized family of potential enzymes. The structure of these proteins is composed of a four helix bundle.	5.3044e-10
NZ_CP040344.1\|WP_000103726.1\|2680573_2681587_+\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|224525	COG1609, PurR, Transcriptional regulators [Transcription].	7.99287e-114
NZ_CP040344.1\|WP_157409446.1\|2678229_2678733_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.49647e-15

>NZ_CP040344.1|WP_000963378.1|2673062_2673635_+|TetR/AcrR-family-transcriptional-regulator
MAIDRKRSIIEAATKSFSAFGYKATTMDQVAKLANVGKGTIYTFFKNKEELFGEIISNLITEMKQVAENAIRSDVSFFENVHRALYSILEFRKEHQLMIKLIQEERDMGTKEVQEVMQQVDVEIVSVIQSYLKIAIEKGEISKCDPEITAFIMLRLYVSLIFDWEKNHEPLEKEKIAELFELYLLKGLSN
>NZ_CP040344.1|WP_071758349.1|2670952_2672848_+|M56-family-metallopeptidase
MIDMLINVYLPHFFDWLIETSLMASILVGFILCIKILFRNKLTPRWQYMLWIVLMIRLLLPWSPDSSYSIYSLLSYRSSVSEVIPKNMPSTESKMNIESDRKVELESHAETVTKSGKPEVNVSTEQQTTFSLYKLAMYVWLVGVFLLAVITFITNRRLYSYIKKQPDITDEQVVTVFNRCKQSMKMKKAVSLRLAGKIASPTVFSFFRPKVLLSKKHMKVLNEQQLQYVFYHELAHIKRNDVAVNWIMYSLILLNWFNPILWYAYFCMREDQELACDAYALTFIDKEEQIAYGHTIITLLEQYSYQAPSLANLSRNKRTLKRRIVMIKKFQKKSYRLSLLGVIVIVAIASLSLFNAPTEGKEKQEDKVEQSKDAFQNAVDMLYGTEENAKKEYHYSARVYEEKTDYLYLAEKALTKDEFQQYIKLSKKIINIQKKGAPRDSDYESIVFREERLSKADRDKLYALYDQAKPFDDKVYESLNYTVKEAQQHVDFQIKKPTYTIAGYNLKGENVGYFIKRRPELIIELEYTNGKGNYTTYQSQVFGESKDPFHALFGVEENIEQYELEGNQIFYATDNSDSNLQGMKMIVPAKGKDSAYQIVIINHSLEDRGEAVFDKNVNKKELEKIMISMLK
>NZ_CP040344.1|WP_071758337.1|2670548_2670947_+|BlaI/MecI/CopY-family-transcriptional-regulator
MTNQLPKISEAELEIMKVLWLKSPQTANEIIEELEDAMDWKPKTIRTLINRLVQKEAVSYHQDKGRMYAYYPLVSQDNYLQVETKSLLKRFCGAAFKPLLVNFLKEEKLSSEDINELKRILDEKTEENKRKD
>NZ_CP040344.1|WP_157409443.1|2669472_2670318_-|hypothetical-protein
MIRALRLNIKQAFCNRVSLIIMFSGFVLICIYHYYYVIRYLGDAANGPISTDIKWIGFRDNEMDVYLLLMPIIASLPFSTSYNSDKSDGFKQFVSKGINLFSYSITKYIVTFFCGGLLYTLPFILSLLFCKLTIPDGETPAGSGIINVNGMFANLYEASPIIYITVYIGINFLFAGLMALLGLAASAWSQKDYMSLLFPFAATSIPYVLLNTVFPTIGGAPIHLYDPKQPLDGMSPYILTVQCAFFLFVSLLMYIRGVKRDRKKYRRRLQKRDRCRKAFQV
>NZ_CP040344.1|WP_001148850.1|2669118_2669418_+|hypothetical-protein
MQAQLNGKLMNQLAIFFSTIVMLQFIADVTGLTQNLDITYNLIHTAASYITFSLAVIFTLIGARRELSKYAIISLCLVVGIKAIYFVGVVILWGLAGTP
>NZ_CP040344.1|WP_157409442.1|2666601_2668968_+|endonuclease
MTVKKLLSVFLSFILLLSFTGTLVQAEETTSMSVEKAIQVFKQQGKTKGIVEGYIVGYTQSPSKYTKDPAKFDDTNVAIADSPNETNPDKIMPVQLPKGDVRAAVNVKDHPENIGKKVSLTGTLELYFSSPGLKSVTAHKFQGEGQNRVSDVVASPSGGEVAKGTAVTLTTNTEGATIYYTLDGSNPTNKSVRYNGQIVVNENSVIKAIAEKEGLTSSAISTFSFVIVNNEPVRIHDIQGKSHISPYNGKKVYNVEGVVTALDKNGFYIEDNQPDNDPATSEGMYVYKKDANVAVGDLIQVDGVVEEYVGPGYAERFDTDLTTTEIKASRVAVIANNQPLPAPIVLGENGVKIPDQIIDNDAFGLFDPNEDAIDFYESIEGMRVTMPTPKIIAPQKNGNLYVTVENGGDKVVTKYGTPVLDENQLNPERLSVKVPRDYVAKVGDTFTGDITGVVGYDYGSFRISPITELPSVVDGGFKQVGANIQPRLDKLTVATYNIENFSANKKETTDEKVKALAYSIKYNLKMPDIIGVEEMQDNNGTINDGTTDASLSAKRIIDAVLEIRGPKYEYVEIAPNNNLDGGAPGANIRVGFFYNPSRVKLAAVPKLLNKNVVRIGDENPLFESTRKPLAAEFTFQGQNVVVVANHLNSKIGDATPFGKVQPLVLKSEEKRVQLAQEVNNFVQGIQKKNTNAPVVVLGDMNDFEFAKPLKALEGTNLKNMLNTVPKENRYTYIHEGNAQVLDHILVTNNIAPHTIVDPVHLNSNIMKEHGRVSDHDPVLAQIDLKKAS
>NZ_CP040344.1|WP_157409441.1|2665009_2666362_-|DUF4026-domain-containing-protein
MEVQTETYRAAMNGTLERHFSDMIAVIPTRITIEQLKQRLETISTKVDELKIVYSDETSLIVELHMDETVIPYELHIDEANDPEEYKMYNRQDATIVDRHFEDAAYGTEIFTRTLFVGDVLDCFFQQLQFLWNLAPDLLFVIDSSAAMKVISRSYIEYHVENELLPDIPDLYVIHSVYEDDKEGEPTQYWFHTHGLLRAGVTEIELIIPNRISSYYGIGDLFQTFANNAVENGQVPMNEPIVIAHSQQGSIHTVAVPWEKGLSYIGRKTSMDQFSSIEDEEVKLQPIDAQNTFLGGMDDRDEYHQSPSVLLFKFNTSEEYIESFFQEHEEATGLMFYKTNSETDRMAYNAKNTFGYFSNIFHIEQSNEDFRFLAKFGVSYEEGKSEHMWFEMQSITEDFIQGILINEPYFIKDMSEGNSYHLDFDNLTEWVIYARDAVIKPNNLYMFIGE
>NZ_CP040344.1|WP_128974539.1|2663548_2664970_+|protoporphyrinogen-oxidase
MRKKVVIIGGGITGLTTMYHLQKDIRDKNLPIDTLLIEASGKLGGKIQTVRKDGFTIERGPDSFLARKESAATLAKELGFGDELVNNKAGQSFVLVNNRLHKMPSGSMMGIPTQITPFLFSGLFSPIGKLRAGFDLLMPRSKPVSDQSLGHFFRHRLGNEVVENLIEPLLSGIYAGDIDEMSLMSTFPQMYQIEQKHRSISLGMRTLAPKAEKVEPKKGIFQTVKTGLESIVESLESKMHEGTIIKGTRIEKVAKQGDGYAITLSNGKEIEADAVVVASSHKVLPSMFAQYKQFRFFRNIPSTSVANVAMAFPKSAIQRDIDGTGFVVSRNSDYTITACTWTHKKWPHTAPEGKMLLRCYVGRPGDEAVVEQTEEELVRLVLEDLRKTMDITENPEFTVVSRWKEAMPQYTVGHNERMKKLTTFMEKELPGIYLAGSSYAGSGLPDCIDQGEKAAKLVLSYLEKVMDTELIAQ
>NZ_CP040344.1|WP_048526572.1|2662592_2663528_+|ferrochelatase
MKKKIGLLVMAYGTPYKEEDIERYYTHIRRGRKPSPEMLEDLTERYRAIGGISPLATITLEQAKKLEKRLNEVQDEVEYHMYLGLKHIEPFIEDAVKDMHNDGIQDAIALVLAPHYSTFSVKSYVGRAQEEAEKLGNLTIHGIDSWYKEPKFIQYWVDAVKGIYNGMSEAEREKAVLIVSAHSLPEKIIALGDPYPDQLNETADYIARGAEVANYAVGWQSAGNTPDPWIGPDVQDLTRELNEKYGYTSFVYAPVGFVAEHLEVLYDNDFECKVVTDEIGAKYYRPEMPNASDAFIDCLTDVVLKKKESVM
>NZ_CP040344.1|WP_048526570.1|2661531_2662578_+|uroporphyrinogen-decarboxylase
MVRNINETFLKACRGERTDYVPAWYMRQAGRSQPEYRKIKEKYSLFEITHNPELCAYVTKLPVDQYNVDAAILYKDIMSPLPAIGVDVEIKSGIGPVIDNPIRSLQDVEKLGEINPEDDVPYILDTIRLLTTEMLDVPLIGFSGAPFTLASYMIEGGPSRNYHNTKAFMYAEPKAWFALMDKLADMVITYLKAQINAGAKAVQIFDSWVGTVNVADYRVFIKPAMERIFAEVRTMGVPMIMHGVGAAHLVNEWHDLPLDVVGLDWRLPIEEARARGVHKAVQGNMDPSFLLAPWSVIEEHVKGILDQGMKQPGYIFNLGHGVFPEVNPDTLKRLTTFIHEYSKGQLAK
>NZ_CP040344.1|WP_157409445.1|2676549_2677260_-|hypothetical-protein
MDNLFNQIATFFNISLPQEMMNAFKNPIYLQHKNDFLIRLLSFEEAMEVYLYLHEDVNISEVFPLWTDDNSNYVGVYMLGPLTGKVCFIDPEEIDLSPVYPHVQTLIKALLESPESDWYELPRYYPCSKENTDKLQLKQDVQTINELKNLLKNDELNEAKRTQYLFSIMALTPRAQLHEILPLLDDSDMWVQERAAEILGFHRYVPASEKLNWVKEHGQHNGKLAAELALKRIEME
>NZ_CP040344.1|WP_001988614.1|2677600_2677816_+|hypothetical-protein
MMKGNLTYYFILNPLIIFLVYALSPILFHKEKYINMKDALGILVVYYVLISGYYFMDVVSERMKKNSKDKQ
>NZ_CP040344.1|WP_000140277.1|2677852_2678158_+|DUF2087-domain-containing-protein
MTESEMKFRDATIRNFFDKEGCLKSIPGQKKKKLVLLEHLISKLNAENQYTEKEMNTFIKQYHDDFCTIRREFIVHGFMDREAKMYRINGREVWTKWEELK
>NZ_CP040344.1|WP_157409446.1|2678229_2678733_+|GNAT-family-N-acetyltransferase
MIRLAKETDAEAIMDIRKEIILSKTTTKFFIVSPKKLPNDTNAEREKIRKSNEKGNLYIVYEVDNKVVGFLLFNRYELDRLRHAGTMGIKEAYCNQGIGTKLIEFLIRWAKEQKGLEKICLGVVSVNDRAIKVYKRMGFVEEGRQRKQIKYEDGSYGDDVLMGFYID
>NZ_CP040344.1|WP_157409447.1|2678849_2679350_-|DUF1569-domain-containing-protein
MKKFEELATYYIEELEKYSIEQFRMKPSSEEWSLGQMYNHLIASTYMQLNAITKCKTETPSITNIKTEMGEKVYKLGAFPNIQIKVPNHPGYTPENPATKEEMQEQFLELITIVKNSEPTLSSIPSDYKVEHPGLGYLNAAEWFQLISMHFAHHLRQKERLELKVF
>NZ_CP040344.1|WP_157409448.1|2679434_2680376_-|WYL-domain-containing-protein
MNRTDRLLAILIELQRRQTVTAQSLAEKFETSIRTIYRDMDALNESGVPIYSMPGHGYSLMDGYFLPPIQLTPEEAVTLLLGGDYIEKTFTSSFSVHARSAKEKLEIVLPADQQKKARELRGTFRFLSPIFSQQQPEQEKLENQLILLQESIQKEQAISFSYRKPRETTKMQRTVHPYGLVNISGIWYIVAHCLLRKQIRNFRLDRMDTLQQEQEFFTKPKDFSLQNYKPESNRTVTVHLLFPSHIAHKIIESRYFFIDSYEHRDNSFHVFLKSRNIDEVFQWVLSWGSQVQVLEPKILSEKIRDEAKKMLKI
>NZ_CP040344.1|WP_000103726.1|2680573_2681587_+|LacI-family-DNA-binding-transcriptional-regulator
MSTIEDVAKLAGLSRTTVSRVINNHPYVSDEKKKRVQLAMKHLGFVPNSAARRLRKQKTETIAVLVPRITNPFFSRFIEAIEIAASEHKYKLIICQTRYLPEKEMEYLQLLSTKQVDGIILCSLENPWEDVEPYLQHGPIVLCNEYIEEANVPTVKFDHAQGAYIAAKHVLEQGYRNLIFCRGNETKVVSQQRKMGFLRAITEKSRQVEAIDFLENAFSWEDGKRIFHEVLKDKKNPTAILAGGDEVAAGIISEAKRHDWSIPDDLAVIGFDNQILSQITEPGITTIEQPIDEMARKVVDLMMDKIHTKNYRKKELYEFELELLVKGSTMKDTMLLA
>NZ_CP040344.1|WP_000567010.1|2681626_2681755_-|YhfH-family-protein
MIDQPMEFFRNLPTKTCAHCGKEIDEQHEAYHNKCDDCVHEE
>NZ_CP040344.1|WP_048526591.1|2681935_2682670_+|MBL-fold-metallo-hydrolase
MKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVIAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIAYNPEETLQVGPFSISFLKTVHPVTCFAMRITAGSDAVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPSDLVTEAKQIFSGHITLAHSGYVWNS
>NZ_CP040344.1|WP_157409449.1|2682679_2683669_+|lipoate--protein-ligase
MLFIDNKGITDPRINLAIEEYCLKNLDINETYLLFYINEPSIIIGKNQNTVEEINADYVKEKGIHVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFSNFKKFTEPVTKALGKLGVNAELSGRNDILAEGRKISGNAQFSTKGRMFSHGTLLFDSEIDHVVSALKVKMDKIQSKGIKSIRSRVANITEFLNEKMTTEEFRQLLLETIFEGETEIPTYELTENDWKEIHKLSEERYQNWDWNYGKSPKFNLQHSHRFPVGQVDVRLEVKKGTVTECKIYGDFFGSLDVHDIEERLTGVQFDKDAFTAALEGVDIKRYFGNITTEDFLHLFF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040344_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040344_3

3389763-3389854

Orphan

Consensus_repeat	Method
TTTAAATCAATTTTTTTTGATTAA	CRISPRCasFinder

1 spacers

csa3

The CRISPR arrays of NZ_CP040344_3

>merge|NZ_CP040344|3|3389763-3389854|CRISPRCasFinder
TTTAAATCAATTTTTTTTGATTAATAAAACTTTTTATAAATGATTAAACTCGAATGATCATTCTGGCATTTAAATCAATTTTTTTTGATTTA

>NZ_CP040344|3|3|3389763-3389854|CRISPRCasFinder
TTTAAATCAATTTTTTTTGATTAA	TAAAACTTTTTATAAATGATTAAACTCGAATGATCATTCTGGCA
TTTAAATCAATTTTTTTTGATTTA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040344.1\|WP_157409582.1\|3384535_3387415_+\|DUF4116-domain-containing-protein	unknown	unknown	gnl\|CDD\|372614
NZ_CP040344.1\|WP_157409589.1\|3397671_3397953_+\|adhesin	unknown	unknown	gnl\|CDD\|272875
NZ_CP040344.1\|WP_088315035.1\|3377569_3378853_+\|aminopeptidase-P-family-protein	unknown	unknown	gnl\|CDD\|238520
NZ_CP040344.1\|WP_071731686.1\|3391366_3391570_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_157409580.1\|3378970_3380611_+\|multicopper-oxidase-domain-containing-protein	unknown	unknown	gnl\|CDD\|225043
NZ_CP040344.1\|WP_071757871.1\|3380662_3381208_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_157409586.1\|3391629_3392124_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224168
NZ_CP040344.1\|WP_157409588.1\|3395871_3397632_+\|arsenical-pump-driving-ATPase	unknown	unknown	gnl\|CDD\|275109
NZ_CP040344.1\|WP_000717836.1\|3395493_3395853_+\|arsenite-efflux-transporter-metallochaperone-ArsD	unknown	unknown	gnl\|CDD\|377741
NZ_CP040344.1\|WP_071757868.1\|3374178_3374409_-\|DUF896-domain-containing-protein	unknown	unknown	gnl\|CDD\|167247
NZ_CP040344.1\|WP_157409583.1\|3387689_3388976_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_157409584.1\|3389408_3389729_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042
NZ_CP040344.1\|WP_157409581.1\|3381540_3383685_+\|DNA-topoisomerase-III	unknown	unknown	gnl\|CDD\|236078
NZ_CP040344.1\|WP_157409587.1\|3392249_3392996_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|198387
NZ_CP040344.1\|WP_000072357.1\|3393942_3394992_+\|ACR3-family-arsenite-efflux-transporter	unknown	unknown	gnl\|CDD\|213563
NZ_CP040344.1\|WP_157410248.1\|3375628_3376312_-\|sulfite-exporter-TauE/SafE-family-protein	unknown	unknown	gnl\|CDD\|372587
NZ_CP040344.1\|WP_071757867.1\|3373651_3374131_+\|cytochrome-c-biogenesis-protein-CcdC	unknown	unknown	gnl\|CDD\|377808
NZ_CP040344.1\|WP_044822176.1\|3395024_3395429_+\|arsenate-reductase-(thioredoxin)	unknown	unknown	gnl\|CDD\|237415
NZ_CP040344.1\|WP_157409585.1\|3389901_3391287_+\|NAD(P)-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|379355
NZ_CP040344.1\|WP_000416313.1\|3393566_3393914_+\|winged-helix-turn-helix-transcriptional-regulator	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|238042

Protein	Function_ID	Function_description	E-value
NZ_CP040344.1\|WP_157409582.1\|3384535_3387415_+\|DUF4116-domain-containing-protein	gnl\|CDD\|372614	pfam13475, DUF4116, Domain of unknown function (DUF4116).	3.54372e-08
NZ_CP040344.1\|WP_157409589.1\|3397671_3397953_+\|adhesin	gnl\|CDD\|272875	TIGR00049, Uncharacterized_protein_in_nifU_5'region, Iron-sulfur cluster assembly accessory protein. Proteins in this subfamily appear to be associated with the process of FeS-cluster assembly. The HesB proteins are associated with the nif gene cluster and the Rhizobium gene IscN has been shown to be required for nitrogen fixation. Nitrogenase includes multiple FeS clusters and many genes for their assembly. The E. coli SufA protein is associated with SufS, a NifS homolog and SufD which are involved in the FeS cluster assembly of the FhnF protein. The Azotobacter protein IscA (homologs of which are also found in E.coli) is associated which IscS, another NifS homolog and IscU, a nifU homolog as well as other factors consistent with a role in FeS cluster chemistry. A homolog from Geobacter contains a selenocysteine in place of an otherwise invariant cysteine, further suggesting a role in redox chemistry. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other].	2.11992e-10
NZ_CP040344.1\|WP_088315035.1\|3377569_3378853_+\|aminopeptidase-P-family-protein	gnl\|CDD\|238520	cd01087, Prolidase, Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro dipeptidase, X-Pro dipeptidase, proline dipeptidase., imidodipeptidase, peptidase D, gamma-peptidase. Catalyses hydrolysis of Xaa-Pro dipeptides; also acts on aminoacyl-hydroxyproline analogs. No action on Pro-Pro.	3.3299e-98
NZ_CP040344.1\|WP_157409580.1\|3378970_3380611_+\|multicopper-oxidase-domain-containing-protein	gnl\|CDD\|225043	COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism].	6.54194e-97
NZ_CP040344.1\|WP_157409586.1\|3391629_3392124_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224168	COG1247, COG1247, Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane].	3.46423e-30
NZ_CP040344.1\|WP_157409588.1\|3395871_3397632_+\|arsenical-pump-driving-ATPase	gnl\|CDD\|275109	TIGR04291, Arsenical_pump-driving_ATPase, arsenical pump-driving ATPase. The broader family (TIGR00345) to which the current family belongs consists of transport-energizing ATPases, including to TRC40/GET3 family involved in post-translational insertion of protein C-terminal transmembrane anchors into membranes from the cyotosolic face. This family, however, is restricted to ATPases that energize pumps that export arsenite (or antimonite).	0
NZ_CP040344.1\|WP_000717836.1\|3395493_3395853_+\|arsenite-efflux-transporter-metallochaperone-ArsD	gnl\|CDD\|377741	pfam06953, ArsD, Arsenical resistance operon trans-acting repressor ArsD. This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins. ArsD is a trans-acting repressor of the arsRDABC operon that confers resistance to arsenicals and antimonials in Escherichia coli. It possesses two-pairs of vicinal cysteine residues, Cys(12)-Cys(13) and Cys(112)-Cys(113), that potentially form separate binding sites for the metalloids that trigger dissociation of ArsD from the operon. However, as a homodimer it has four vicinal cysteine pairs.	6.98675e-57
NZ_CP040344.1\|WP_071757867.1\|3373651_3374131_+\|cytochrome-c-biogenesis-protein-CcdC	gnl\|CDD\|377808	pfam07301, DUF1453, Protein of unknown function (DUF1453). This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown. Members of this family seem to be found exclusively in the Order Bacillales.	1.68335e-58
NZ_CP040344.1\|WP_000072357.1\|3393942_3394992_+\|ACR3-family-arsenite-efflux-transporter	gnl\|CDD\|213563	TIGR00832, Uncharacterized_transporter_slr0944, arsenical-resistance protein. The Arsenical Resistance-3 (ACR3) Family (TC 2.A.59) The first protein of the ACR3 family functionally characterized was the ACR3 protein of Saccharomyces cerevisiae. It is present in the yeast plasma membrane and pumps arsenite out of the cell in response to the pmf. Similar proteins are found in bacteria, often as part of a four gene operon with an regulatory protein ArsR, a protein of unknown function ArsH, and an arsenate reductase that converts arsenate to arsenite to facilitate transport. [Cellular processes, Detoxification, Transport and binding proteins, Anions].	5.25729e-156
NZ_CP040344.1\|WP_157409584.1\|3389408_3389729_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	1.4207e-16
NZ_CP040344.1\|WP_157409581.1\|3381540_3383685_+\|DNA-topoisomerase-III	gnl\|CDD\|236078	PRK07726, PRK07726, DNA topoisomerase 3.	0
NZ_CP040344.1\|WP_157409587.1\|3392249_3392996_-\|hypothetical-protein	gnl\|CDD\|198387	cd10440, GIY-YIG_COG3680, GIY-YIG domain of uncharacterized proteins from bacteria and their eukaryotic homologs. This family includes a group of functionally uncharacterized proteins from bacteria and their eukaryotic homologs which are present only in metazoa. These proteins might have nuclease activities and possibly be engaged in DNA repair or recombination, since they share sequence homology with the catalytic GIY-YIG domain of bacterial UvrC DNA repair proteins. Distinct from their prokaryotic relatives, the eukaryotic homologs contain an N-terminal extension that includes the region of approximately 3-4 ankyrin repeats, unique motifs mediating protein-protein interactions. Some of eukaryotic homologs do have an additional LEM domain located between ankyrin repeats region and GIY-YIG domain. The LEM domain, found in inner nuclear membrane proteins, may be involved in protein- or DNA-binding. The different domain composition of the eukaryotic homologs suggests that they might participate in interactions with multiple partners and implies important cellular function.	7.04914e-07
NZ_CP040344.1\|WP_157410248.1\|3375628_3376312_-\|sulfite-exporter-TauE/SafE-family-protein	gnl\|CDD\|372587	pfam13386, DsbD_2, Cytochrome C biogenesis protein transmembrane region.	2.48402e-15
NZ_CP040344.1\|WP_071757868.1\|3374178_3374409_-\|DUF896-domain-containing-protein	gnl\|CDD\|167247	PRK01631, PRK01631, hypothetical protein; Provisional.	3.22694e-35
NZ_CP040344.1\|WP_044822176.1\|3395024_3395429_+\|arsenate-reductase-(thioredoxin)	gnl\|CDD\|237415	PRK13530, PRK13530, arsenate reductase (thioredoxin).	5.99932e-102
NZ_CP040344.1\|WP_157409585.1\|3389901_3391287_+\|NAD(P)-binding-domain-containing-protein	gnl\|CDD\|379355	pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase.	6.98735e-21
NZ_CP040344.1\|WP_000416313.1\|3393566_3393914_+\|winged-helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238042	cd00090, HTH_ARSR, Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors. ARSR subfamily of helix-turn-helix bacterial transcription regulatory proteins (winged helix topology). Includes several proteins that appear to dissociate from DNA in the presence of metal ions.	5.1989e-23

>NZ_CP040344.1|WP_157409584.1|3389408_3389729_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MKEIKMYAQSTTQTFKTYEKKFKALADQKRLHILYELCQRGETCVCDLTGVLELPQSKLSYHLKLLLDANLITKETKGTWSYYNINKKEVDALLSEQLCCIFRPMS
>NZ_CP040344.1|WP_157409583.1|3387689_3388976_-|hypothetical-protein
MTKIKIDFFEELISAHNTGLIVGNGFSMNFDSCFSNIYGCLKEGSYTLSKNGVFSISPGAKPHTKAIIKENFNNVLRYVRTLNQKQLEGIFEGAVTFAGFITTNSTIWDFLNQNKHLNRLKVGPDMLEITENIYRIGITKGFQFVNIENWPILIWLFHLIEDLAEFKNYNQQNNRFITLLKIGGRKSISPPNSAGDVIVKTRFNGFSIYYRLLMLTIIFGNGKAVDLKKAEYAEKVNRNSLTCWLQEFKELFSLNYDLLLEQIVPRPVTYLHGHFRNNAAGFSYFQSYSMKYGDKQYYTNDIILGDYATTKVLDQFIHSLAMKDVAFEQPRVDPLKKLTLKMNESNINHIVFFGMHPENDYHILSGIYHNFLITKQDNPMITYCYFNEQEIEDFTNTFYKVTDSIYRNKNLIPLHFVDSKEVINQYFV
>NZ_CP040344.1|WP_157409582.1|3384535_3387415_+|DUF4116-domain-containing-protein
MEVDSIDKPSEFITKSDQEIMSAIQENGWESSKEEKTPERYLEAVKQNGRTLKLIPKNLHTITLCLEAVKQDASAIKYVSKKIMTDDICIEAVRNNGTIIAYSTYIPEEFRTKELYLEAIKQNGKALKYVPDKYKSEEFCKIAIMQSGLALEFVPKNILSKELFVLAVEQNGLSLEYVPSKNRSKELCNAAVDNNVLALEHVPNRYKTKKLCNAAVNSSWKAFLYVPESMYTLNNCLEIFERILRECDDLSEISYSVRSDVREIANHLPDEINNDIQIIRLERQLQVRKFKRKYFDKKMNRFITIERIFNREEDEVKEFDLFVDFYNHLDADLKNANLHDYDFKEVNLDDFNIEGAYINSDVLVEQCLYDDTFYTENIKDYDCNTELMISAENEVVEAISVRHGIDLVPDTTLNDTYRKIYYISDIHLNHKLLKAFPTNATKLEVSMYIRQLVKKMIDTATDISYGDYLLIAGDISFNFEISTLFYTELVEYMNATFGSRCQIVVVLGNHELWDFNRRGGANSNLLTLDEIIQQYRNLFSSLGICFLQNDLLLSNGTIISEKQLKSIDQDKLKHACLKSPFVILGGLGFSGLNSQFNATQGIYRKTIMSLDEDIKQTNQFQFIYNKVKSVLGNDKVIILTHTPKENWSNEDYNRNWIYVNGHTHRNDYCCDEGKTFYSDNQIGYYSTNVGLKHFKLSRVYDIFKYYPDGIYSISREQYLDFNRGIEIKVTFNGTGNIHMLKNNNVYCFILEKQKPEKIYLLNGGKINNLEHNDINYYFERMAYYSDAIRELFNDYNQALKSISDSIKKIGGTGTIHGCIVDIDFFNHIYVNPEDGTVTPYFASSTVDKYIYPNVKALLLAQRKDLYDDYMKLLYGESESVKLLKDEIKAGSFEIARFIPDTDMYRPSRIMKSLQYLTEVNVIRIWNDRIIEFQSKNKAKDLCANNNDTLLLSVTQNRRN
>NZ_CP040344.1|WP_157409581.1|3381540_3383685_+|DNA-topoisomerase-III
MKLIIAEKPDQGLALVSQFKYRRKDGYLEVEANELFPNGAYCTWAIGHLTQLCNPEHYHAEWKKWSLDTLPMIPERFQFEVTKSKYKQFNVVKQLLHNPQVTEIIHAGDAGREGELIVRNIINLCNVQKPMKRLWISSLTKQAIYQGFKNLLDESDTINTYYEAYTRSCADWVVGMNASRVFSILLKKKGMNDVFSAGRVQTPTLALIVKREKEIENFKSEPFWEVFATFNIEGKKYDGKWEKDNESRLKDPDMANKIAAFCQGKPAVVKEMKTERKEFQPPLLFNLSSLQATANKAFKFSPKKTLDITQALYQKGIVSYPRSDSNYVTQGEAATFPDILQKLSQFDEYKGLLPAPVESIMNNKRYVNEKKVTDHYAIIPTEQVTNPSRLSGDEKKIYDMVVRRLIAAHYEVAIFDYTTIVTLVDERAEFISKGKQQIQEGWRKVIFQDDKDDETILPIVAEGEEGKVVKVKVKEGKTQPPKRYTEGQLITLMKTAGKYLENEELEKVLKKTEGLGTEATRAGIITMLKDRKYIDVKKNQVYATDKGKVLITAIGDKILASPEMTAKWEQRLAEIGEGTASPATFMEQTKKLSAKIIEDAVEMSEKWDFTGLHVESIERKGSKFTTGKKVGSCKKCDGDVIDKSTFYGCSNYNTTQCDFTISKKILSKTISQKNMTKLLKGEKTDLIKGFKKGEKTFDAKLEWKDNKINFVFEN
>NZ_CP040344.1|WP_071757871.1|3380662_3381208_-|hypothetical-protein
MFAYTLTALMLCCISIIITSYISKRSGTLMEYMVFIMSFSMSIGLSIGFYLGILFKGELLYSTLLAILISGCIGFLVGLRFHLFTALEGMFSGLMAGMMGAMITEMLNAQQAHSILFISLLLTITITMSCMIQLLSETFSTFIQRRFLLLLSISVIIIFAVFVTFPDHTPPPSIGHDQHIH
>NZ_CP040344.1|WP_157409580.1|3378970_3380611_+|multicopper-oxidase-domain-containing-protein
MKRFVLTAVTVSVISLISACSATTNTTNDPKNMNDKKITQTETAIKPLKVEKGPEVTLIAKEEKQKLSNGVIVPVWTFNGSSPGPEIRVKKGEKVKVTLKNELSTPVSIHWHGYPVPNNMDGIPGVTQDAVEPGKSFTYEFEANVPGTYWYHSHQDSVNQLDRGLYGALIVEAINEKYDKDYTLMLDEWVTDKEEINNQLKEMTKGQIGNKSKDNENTKKNDNKNAMDHSSMDMGSDKKDSGNMAGMDHGNMKMEGHDMSMYDLFTINGKSGDLVEPLKVNKGDKVRLRLVNAGYLSHDIHVHGHDIKVIATDGQPINDPKVIRDQVISIAPGERYDVEFTANNPGKWYVEDHSENKGAKGMKAVIEYDGNKEMKDIADEKEKLSKLDMTTYGAKKLGGFTLNQQYTTTYNMDLNTQMNGNEMVYTINGKVFPDIDPIPVKKGDLVKVKLVNRSKMDDHPMHLHGHFFQVLSKDGKPIEGSPIVKDTLNLKPGEEYEVAFVADNPGDWMFHCHDLHHASEGMVTEVKYTDYKSDYIPNPNIPNKPE
>NZ_CP040344.1|WP_088315035.1|3377569_3378853_+|aminopeptidase-P-family-protein
MKSTFFAQNRERLVNTLPDESITILFAGQAPHMSADAHYKFVPNRNFYYVTGIEEPNVIFMLKKFGNSVEETLFIEKSDPVMEKWVGKTVSNEEAEKISGIKKVVYLDSFEKTMSNILFTENVKHLYLDLERREWNGTETKTLAFAKHVREQYPHVLIGNVYPNICELRVFKTEEEIEIMKEAIAITKEGIYNVLKHAKADMMEYELEAQFDFTLKSSGIKHHAFNTILASGKNATVLHYEDNDAQIQNGDLVLLDLGAQKDYYNADISYTFPANGTFSSRQKQIYNIVLKALKETTEIIKPGLKFAALNEHAKKVLAEGCKAVGLIQEDEELSKYYYHGVSHFLGLDTHDVGTYKDRVLEEGMVITIEPGLYIEEESIGIRIEDDILVTKDGYENLSKDIIREVEEIEAFMRENNVNVKEDEVVTK
>NZ_CP040344.1|WP_157410248.1|3375628_3376312_-|sulfite-exporter-TauE/SafE-family-protein
MSPLMDVANATKSIPLLFAFLLGIVGTLAPCQLTGNISAITLYGNQSLQKRYAWKHILLFILGKIIAFTTLGLLVWFLGKEIQQILTLYFPWLRKIIGPLLILMGLMLTGIIKGRNFFSIKFIRKQNEVGSFLLGFFFSLAFCPTMFVLFFGTLIPLSFSYNYGYLFPTFFSIGTALPIVILLFIISYLGLNGALLKKSRKIGKNIQLIAGILLILVGLYDISLYWI
>NZ_CP040344.1|WP_071757868.1|3374178_3374409_-|DUF896-domain-containing-protein
MKNILFRINELSKKEKTSGLTVDEKQEQQMLRQNYTKTFRGSLDSILLNTKIVDQNGHNVTPAALQDAQIRLKLSK
>NZ_CP040344.1|WP_071757867.1|3373651_3374131_+|cytochrome-c-biogenesis-protein-CcdC
MIALLSSIVAVCMAVGVMFLRFKAAKKPVTKKKIILPPIFMSTGAMMYFLPEFRLTSLEMIEAIGIGLIFSIFLIKTTKFEMRNEHIYMKPSKAFIFILVGLLAVRVALKSYLSQSIDLAELSGMFFLLAFAMIVSWRVAMYRSFTKLEKTINRAGISI
>NZ_CP040344.1|WP_157409585.1|3389901_3391287_+|NAD(P)-binding-domain-containing-protein
MKPIQLSFKVQDCCGTDNQTLQSNIDMQGLKHLPVAIIGGGPVGLAAAANLAKHGESFILLEAGENIGSNILTWGHVRLFSPWQYNIDKAALALLEQHGWESPDINALPTGREIVEQYLQPLANLPEIKPFIHLNTKVLSIGKKDTDKMKTTNREKMPFMIYTEKEGILQVYEARAILDASGTWGNPNPANSNGIWLKEEQSLNEHIFYGIPDILGNEQKRYANKHVAVVGSGHSAINALLELAKLKGSYPETKIVWIMRKQRVEETYGGEEKDALEARGTLGSRIHQLVDEGVVEVMTPYKIQYVVSTKNGMDIVGHQDETEIKITDIDEMIVNTGNRPNLSMISEIRTSIDTATESVGALAPLIDPNLHSCGTVRPHGEKELRHPEKGFYIVGSKSYGRAPTFLMATGYEQIRSIVAYLTGDYEAAEKVELDLPETGVCSVNLKPDKVDDSCCGTESCC
>NZ_CP040344.1|WP_071731686.1|3391366_3391570_+|hypothetical-protein
MIINHAGNLKKDYFLSYLRLIMNAHQCNVENAKDYVFQNMFRLEKNSLGKKTYQSFLEAYQELRQPN
>NZ_CP040344.1|WP_157409586.1|3391629_3392124_+|GNAT-family-N-acetyltransferase
MEIRRATEQDVQEIMAIYNEGIEDRIATLETEIKTDKYVMEWLFQRENRYSVIVMEENSHIVGWASINPYSYRYAYRGVGELSIYIKREYRGKGLGQKLLLALEKTGQQNEFYKFVLFTFSFNNLGQGLYRKMGYREVGVFEKQGIMDGERVDVMIMEKLLSGE
>NZ_CP040344.1|WP_157409587.1|3392249_3392996_-|hypothetical-protein
MKITIGNDIKITTVPDESGLSTEPVYYVYEWFIKETNQVFYIGKGKGQRFKQEKNNPYFLSVKNHYDCDTRFVKENLTEYESLILEESLFSQREKEGHVLTNVIAPNALGANERPDNYEFMKTPVIKVSRVDKYYFKKEDVHYDEIDMGKLLKSHIYKTTFYGIAPLYDDSINGFVNQEKTEDIVKPLIQKVNDFIEKKGGKTYKSPAKSAKSLIFYGQITYESYFTYKTKGYDVYHLVDVLKYIDRY
>NZ_CP040344.1|WP_000416313.1|3393566_3393914_+|winged-helix-turn-helix-transcriptional-regulator
MEKTVVEVTRASQLLKLLGDKTRLTIVSILKQRECCVCELLEVFDMSQPSISQHLRKLKDLGLVQEERRGQWIYYSLNQASDLYTLLEDILAHVPDQTEKIKQIVKSNPTLRCGC
>NZ_CP040344.1|WP_000072357.1|3393942_3394992_+|ACR3-family-arsenite-efflux-transporter
MSNTGKKRLSFLDRYLTLWIFLAMAVGIGVGYLSPGFVDGMNSLQVGTTSIPLAIGLILMMYPPLAKVRYEEMGRVFKDVKVLVLSLVQNWIIGPVLMFALAVIFLPDKPEYMVGLIMIGLARCIAMVIVWNDLAKGDTEYAAGLVAFNSVFQMLFFSVYAYVFVTVIPEWLGIEGAVVDITMAEVAKSVFIYLGIPFIAGMLTRLIFVKTKGREWYEKVFIPKISPITLIALLFTIIVMFSLKGEVIVSVPFDVVRIAIPLLIYFVIMFFVSFFMGKKIGASYGVSTTLAFTAGSNNFELAIAVAVGVFGIQSGAAFAAVIGPLVEVPVMIALVNVALWFQRKYFQTQ
>NZ_CP040344.1|WP_044822176.1|3395024_3395429_+|arsenate-reductase-(thioredoxin)
MENKKTIYFLCTGNSCRSQMAEAWGKKYLGDKWNVLSAGIEAHGVNPNAIKAMKEVDVDITDQTSDIIDRDILDKADLVVTLCGHANDVCPTTPPHVKRVHWGFDDPAGQEWSVFQRVRDEIGARIKKYAETGE
>NZ_CP040344.1|WP_000717836.1|3395493_3395853_+|arsenite-efflux-transporter-metallochaperone-ArsD
MKKIEIFDPAMCCSTGVCGPSVDPELIRISVAVNNLKNKGIDVTRYNLASEPDAFANNVVISQLLTDKGPDVLPVTLVDGKVVKEKSHLTNEELTQLTDITVEELSQKPVVRLKLNVKK
>NZ_CP040344.1|WP_157409588.1|3395871_3397632_+|arsenical-pump-driving-ATPase
MTNLYNPNTIAFTPFLFFTGKGGVGKTSTACATAITLADMGKQVLLISTDPASNLQDVFEIELTNKPKEIPSVPNLQVANLDPETAAHEYKERVVGPYRGKLPDAVIATMEEQLSGACTVEMAAFDEFSTLLTNKELTSKFDHIIFDTAPTGHTLRLLQLPTAWSGFLEESTHGASCLGPLAGLGDKKELYNQTVQALSNPNQTMLLLVTRPDSSPLQEAERAAHELKEIGVSNQFLLVNGILKDYVQNDDVSNALFKRQSGALENMAEELKNLPMYEVPLVPFNVTGIENMRKLVQPMENLSISNEEANAVSIPSLQTLITNLSESGKRVIFTMGKGGVGKTTVASAIAVGLAEQGHHVHLTTTDPAAHIDYVMHGEQGNITISRIDPKVEVENYRKEVIEQAKDTVDEEGLAYLEEDLRSPCTEEIAVFRALADIVERANDEIVVIDTAPTGHTLLLLDAAQTYHKEIARSSGEVPQSVKNLLPRLRNPEETSVVIVTLAEATPVHEASRLQEDLKRADINPKWWVINQSFYATHTSDSVLRGRAQSEVQWIQAVQKESQNNCVIIPWQSDDIVGYEKLKGLVK
>NZ_CP040344.1|WP_157409589.1|3397671_3397953_+|adhesin
MNITDKAKDFIETAMKENGVTTLRFTFDGAGCCGPSYGINLGEAQENDVTETVNGIQVAIDPKVAEIVSTLTLDYVEDQQGAGLVISGGSNCC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP040344_4

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP040344_4

5253301-5255316

Orphan

Consensus_repeat	Method
GGNGCTACNGGNGCTACT	CRT

40 spacers

The CRISPR arrays of NZ_CP040344_4

>merge|NZ_CP040344|4|5253301-5255316|CRT
GGTAACACGGGGGCTACTGGCGCTACCGGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACCGGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTAACACAGGTGCTACCGGTGCTACCGGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGCGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGCGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTGTTCAAGGCAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGGGCTACTGGCGCTACCGGCGCTACTGGACCTCAAGGTGCTCAAGGTAATACGGGGGCTACGGGGGCTACGGGGGCTACTGGCGCTACTGGGCCTCAAGGGGTTCAAGGTAACACAGGTGCTACCGGCGCTACTGGACCTCAAGGCGTTCAAGGTAACACGGGGGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGTGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGCGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACTGGTGCTACTGGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACCGGCGCTACTGGACCTCAGGGTATTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACAGGTGCTACCGGTGCCACTGGGCCTCAGGGGGTTCAAGGTAACACAGGCGCTACTGGTGCTACTGGACCTCAAGGTATCCAAGGACCAACAGGCGCTACT

>NZ_CP040344|4|1|5253301-5255316|CRT
GGTAACACGGGGGCTACT	GGCGCTACCGGTGCTACTGGGCCTCAA
GGTAACACAGGCGCTACT	GGGGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGTGCTACTGGGCCTCAA
GGTAACACAGGCGCTACC	GGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGACCTCAA
GGTAACACAGGTGCTACC	GGTGCTACCGGTGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACCGGACCTCAA
GGTAACACAGGCGCTACT	GGCGCTACTGGGCCTCAAGGTAACACAGGCGCTACTGGGGCTACCGGACCTCAA
GGTAACACAGGCGCTACT	GGCGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGCGCTACTGGGCCTCAA
GGTAACACAGGCGCTACT	GGGGCTACCGGACCTCAAGGTAACACAGGCGCTACTGGACCTCAAGGTGTTCAAGGCAACACA
GGTGCTACCGGCGCTACT	GGACCTCAAGGCGTTCAAGGTAACACG
GGGGCTACTGGCGCTACC	GGCGCTACTGGACCTCAAGGTGCTCAAGGTAATACGGGGGCTACGGGGGCTACG
GGGGCTACTGGCGCTACT	GGGCCTCAAGGGGTTCAAGGTAACACA
GGTGCTACCGGCGCTACT	GGACCTCAAGGCGTTCAAGGTAACACG
GGGGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGCGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACAGGCGCTACT
GGTGCTACTGGTGCTACT	GGTGCTACTGGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGTGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGTGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGCGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGCGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCGGGTGCTACC
GGCGCTACTGGACCTCAG	GGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAA
GGTAACACAGGTGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACTGGTGCTACT	GGACCTCAAGGTGCTCAAGGACCGGCG
GGTGCTACCGGCGCTACT	GGACCTCAGGGTATTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGGGTTCAAGGTAACACA
GGTGCTACCGGTGCCACT	GGGCCTCAGGGGGTTCAAGGTAACACA
GGCGCTACTGGTGCTACT	GGACCTCAAGGTATCCAA
GGACCAACAGGCGCTACT

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP040344.1\|WP_000460296.1\|5247129_5248401_-\|methionine-gamma-lyase-family-protein	unknown	unknown	gnl\|CDD\|311036
NZ_CP040344.1\|WP_071757744.1\|5249760_5250384_+\|trimeric-intracellular-cation-channel-family-protein	unknown	unknown	gnl\|CDD\|225415
NZ_CP040344.1\|WP_048527506.1\|5243031_5243691_+\|helix-turn-helix-domain-containing-protein	unknown	unknown	gnl\|CDD\|224885
NZ_CP040344.1\|WP_128805375.1\|5248393_5249668_-\|GTPase-HflX	unknown	unknown	gnl\|CDD\|274455
NZ_CP040344.1\|WP_071757748.1\|5257683_5258637_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	unknown	unknown	gnl\|CDD\|234626
NZ_CP040344.1\|WP_116746294.1\|5267520_5267859_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_000228314.1\|5266659_5267202_-\|DUF420-domain-containing-protein	unknown	unknown	gnl\|CDD\|225204
NZ_CP040344.1\|WP_157409052.1\|5243910_5245067_-\|IS3-family-transposase	unknown	unknown	gnl\|CDD\|222853
NZ_CP040344.1\|WP_071757749.1\|5258819_5259065_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_000656783.1\|5246564_5246954_-\|transcriptional-repressor-GlnR	unknown	unknown	gnl\|CDD\|133380
NZ_CP040344.1\|WP_071757752.1\|5262277_5263189_-\|1-phosphofructokinase	unknown	unknown	gnl\|CDD\|238570
NZ_CP040344.1\|WP_000135338.1\|5245181_5246516_-\|type-I-glutamate--ammonia-ligase	unknown	unknown	gnl\|CDD\|273198
NZ_CP040344.1\|WP_071757750.1\|5259127_5260060_-\|SH3-domain-containing-protein	unknown	unknown	gnl\|CDD\|226112
NZ_CP040344.1\|WP_157410206.1\|5251723_5252689_+\|tyrosine-type-recombinase/integrase	unknown	unknown	gnl\|CDD\|227308
NZ_CP040344.1\|WP_000813896.1\|5257437_5257662_-\|RNA-chaperone-Hfq	unknown	unknown	gnl\|CDD\|179001
NZ_CP040344.1\|WP_071757754.1\|5264095_5265259_-\|iron-containing-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|341466
NZ_CP040344.1\|WP_048527507.1\|5242578_5242827_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_071757751.1\|5260407_5262264_-\|PTS-transporter-subunit-EIIA	unknown	unknown	gnl\|CDD\|236740
NZ_CP040344.1\|WP_048527508.1\|5241426_5241621_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP040344.1\|WP_071757753.1\|5263185_5263938_-\|DeoR/GlpR-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224268

Protein	Function_ID	Function_description	E-value
NZ_CP040344.1\|WP_000460296.1\|5247129_5248401_-\|methionine-gamma-lyase-family-protein	gnl\|CDD\|311036	pfam06838, Met_gamma_lyase, Methionine gamma-lyase. This is a putative pyridoxal 5'-phosphate-dependent methionine gamma-lyase enzyme involved in methionine catabolism.	0
NZ_CP040344.1\|WP_071757744.1\|5249760_5250384_+\|trimeric-intracellular-cation-channel-family-protein	gnl\|CDD\|225415	COG2860, COG2860, Predicted membrane protein [Function unknown].	7.01527e-60
NZ_CP040344.1\|WP_048527506.1\|5243031_5243691_+\|helix-turn-helix-domain-containing-protein	gnl\|CDD\|224885	COG1974, LexA, SOS-response transcriptional repressors (RecA-mediated autopeptidases) [Transcription / Signal transduction mechanisms].	4.98535e-29
NZ_CP040344.1\|WP_157409052.1\|5243910_5245067_-\|IS3-family-transposase	gnl\|CDD\|222853	PHA02517, PHA02517, putative transposase OrfB; Reviewed.	1.99437e-50
NZ_CP040344.1\|WP_128805375.1\|5248393_5249668_-\|GTPase-HflX	gnl\|CDD\|274455	TIGR03156, GTP_HflX, GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like). [Unknown function, General].	0
NZ_CP040344.1\|WP_157410206.1\|5251723_5252689_+\|tyrosine-type-recombinase/integrase	gnl\|CDD\|227308	COG4974, XerD, Site-specific recombinase XerD [DNA replication, recombination, and repair].	4.46936e-13
NZ_CP040344.1\|WP_000228314.1\|5266659_5267202_-\|DUF420-domain-containing-protein	gnl\|CDD\|225204	COG2322, COG2322, Predicted membrane protein [Function unknown].	3.82961e-56
NZ_CP040344.1\|WP_071757750.1\|5259127_5260060_-\|SH3-domain-containing-protein	gnl\|CDD\|226112	COG3584, COG3584, Uncharacterized protein conserved in bacteria [Function unknown].	7.01788e-36
NZ_CP040344.1\|WP_000656783.1\|5246564_5246954_-\|transcriptional-repressor-GlnR	gnl\|CDD\|133380	cd01105, HTH_GlnR-like, Helix-Turn-Helix DNA binding domain of GlnR-like transcription regulators. Helix-turn-helix (HTH) transcription regulator GlnR and related proteins, N-terminal domain. The GlnR and TnrA (also known as ScgR) proteins have been shown to regulate expression of glutamine synthetase as well as several genes involved in nitrogen metabolism. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of two distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	1.14369e-23
NZ_CP040344.1\|WP_071757752.1\|5262277_5263189_-\|1-phosphofructokinase	gnl\|CDD\|238570	cd01164, FruK_PfkB_like, 1-phosphofructokinase (FruK), minor 6-phosphofructokinase (pfkB) and related sugar kinases. FruK plays an important role in the predominant pathway for fructose utilisation.This group also contains tagatose-6-phophate kinase, an enzyme of the tagatose 6-phosphate pathway, which responsible for breakdown of the galactose moiety during lactose metabolism by bacteria such as L. lactis.	3.0233e-143
NZ_CP040344.1\|WP_000135338.1\|5245181_5246516_-\|type-I-glutamate--ammonia-ligase	gnl\|CDD\|273198	TIGR00653, Glutamine_synthetase, glutamine synthetase, type I. Alternate name: glutamate--ammonia ligase. This model represents the dodecameric form, which can be subdivided into 1-alpha and 1-beta forms. The phylogeny of the 1-alpha and 1-beta forms appears polyphyletic. E. coli, Synechocystis PCC6803, Aquifex aeolicus, and the crenarcheon Sulfolobus acidocaldarius have form 1-beta, while Bacillus subtilis, Thermotoga maritima, and various euryarchaea has form 1-alpha. The 1-beta dodecamer from the crenarcheon Sulfolobus acidocaldarius differs from that in E. coli in that it is not regulated by adenylylation. [Amino acid biosynthesis, Glutamate family].	0
NZ_CP040344.1\|WP_071757748.1\|5257683_5258637_-\|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA	gnl\|CDD\|234626	PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed.	1.14758e-167
NZ_CP040344.1\|WP_000813896.1\|5257437_5257662_-\|RNA-chaperone-Hfq	gnl\|CDD\|179001	PRK00395, hfq, RNA-binding protein Hfq; Provisional.	3.4363e-41
NZ_CP040344.1\|WP_071757754.1\|5264095_5265259_-\|iron-containing-alcohol-dehydrogenase	gnl\|CDD\|341466	cd08187, BDH, Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. The butanol dehydrogenase (BDH) is involved in the final step of the butanol formation pathway in anaerobic micro-organism. Butanol dehydrogenase catalyzes the conversion of butyraldehyde to butanol with the cofactor NAD(P)H being oxidized in the process. Activity in the reverse direction is 50-fold lower than that in the forward direction. The NADH-BDH has higher activity with longer chained aldehydes and is inhibited by metabolites containing an adenine moiety. This protein family belongs to the so-called iron-containing alcohol dehydrogenase superfamily. Since members of this superfamily use different divalent ions, preferentially iron or zinc, it has been suggested to be renamed to family III metal-dependent polyol dehydrogenases. This family also includes E. coli YqhD enzyme, an NADP-dependent dehydrogenase whose activity measurements with several alcohols demonstrate preference for alcohols longer than C3. The active site of YqhD contains a Zn metal, and a modified NADPH cofactor bearing OH groups on the saturated C5 and C6 atoms, possibly due to oxygen stress on the enzyme, which would functionally work under anaerobic conditions.	0
NZ_CP040344.1\|WP_071757751.1\|5260407_5262264_-\|PTS-transporter-subunit-EIIA	gnl\|CDD\|236740	PRK10712, PRK10712, PTS system fructose-specific transporter subunits IIBC; Provisional.	2.43303e-143
NZ_CP040344.1\|WP_071757753.1\|5263185_5263938_-\|DeoR/GlpR-transcriptional-regulator	gnl\|CDD\|224268	COG1349, GlpR, Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism].	3.91023e-81

>NZ_CP040344.1|WP_157410206.1|5251723_5252689_+|tyrosine-type-recombinase/integrase
METTEFHDTIQAFSIFLLNKGRKPSTIKRYVYDIEDFGHWLEKNKKLPSSNIWATLCTKDYEDYFSDLKKNRHYSEKTMHRVFIVLNRMHHFLNIPNPLKNMEISIQPDRTLRNEDFITSDEEKRLKHIVTSLEGLSEKQRPVRPLLMDRNIAILNLLIDYGLSLQELTALTMNHVHFKTNTLSIPATAGVERTVTLTKEDKKQLYTYYKSIPEPVRPKYHSNDPLFIAFDFNRGTYRWVYENDAPKGLTEIAIQKMIRLEVSRANLRKGISGQHFRNTYILNLIKKETPESEIIKLAGFKSKVSLKRYYQYAENRKNALS
>NZ_CP040344.1|WP_071757744.1|5249760_5250384_+|trimeric-intracellular-cation-channel-family-protein
MAWEIFSIIGTIAFALSGAIVAMEEDYDIFGVYILGMATAFGGGALRNLLIGYPIVAFWQQDMLFQIALLSMTIIFLFPNKLIRHWKKWENITDAIGLSAFAVQGALYAQKLNLPISATIVAAVLTGIGGGIIRDLLARRKPLVLRADVYAFWTILAGFLIGAQIIVSDWALYTLFILIVCFRMVSIHYKWHLPHRRIDTNERSMNK
>NZ_CP040344.1|WP_128805375.1|5248393_5249668_-|GTPase-HflX
MEEKEKVILVGCQLPQEDDEKFMHSMKELASLAKTARAELLVSTTQKRPKFHPATYIGKGKLEELAMLTEELEPDVIVFNNELTPSQIRNLSSVLDARVIDRTQLILDIFAQRAKSREGKLQVELAQLQYTMPRLMGQGLSLSRLGGGIGTRGPGETKLETDRRHIRSRIDEIKKQLAVVVEHRKRYRERRKDNKVFQVSLIGYTNAGKSTLFNRLTEADTFEENLLFATLDPTTRKMPLPSGYTVLLTDTVGFIQDLPTSLIAAFRSTLEEAGEADVILHVVDSADPNYVGHEKTVKQLLSELEINHIPIITLYNKKDELHQNFIPFPKNDFLMTSAFEENDLLHIKDAIETKMKEEMNRYQVEIPPSEGKLLTLLKTETLLTKMEFLEDKFVYDCAGYIFAHSSLNVQLKRFLVEEGENKNV
>NZ_CP040344.1|WP_000460296.1|5247129_5248401_-|methionine-gamma-lyase-family-protein
MFDRLKNGEKIAPIVKEVESQITEVHKRADEVIESNQFRVLESFRKHKISDSHFIPTTGYGYDDIGRDTLEKVYADVFGAEAGLVRPQIISGTHAISTALFGILRPGDELLYITGKPYDTLEEIVGVRGKGVGSFKEYNIGYNAVPLTEEGLVDFGAVAAAIHSNTKMIGIQRSKGYATRPSFTISQIKEMIAFVKEIKPDVVVFVDNCYGEFIEEQEPCHVGADLMAGSLIKNPGGGIVKTGGYIVGKEQYVEACAYRLTSPGIGAEAGASLYSLQEMYQGFFLAPHVAGQALKGAIFTAAFLEKLGMNTSPAWNAPRTDLIQSVQFDDKDRMIAFCQAIQYASPINSHFTPYANYMPGYEDDVIMAAGTFIQGASIELSADGPIRPPYVAYVQGGLTYSHVKIAICSAIDALIEKELLTIS
>NZ_CP040344.1|WP_000656783.1|5246564_5246954_-|transcriptional-repressor-GlnR
MKEDRRSAPLFPIGIVMDLTQLSARQIRYYEEHNLVSPTRTKGNRRLFSFNDVDKLLEIKDLLDQGLNMAGIKQVLLMKENQTEAVKVKEETKEISKTELRKILRDELQHTGRFNRTSLRQGDISRFFH
>NZ_CP040344.1|WP_000135338.1|5245181_5246516_-|type-I-glutamate--ammonia-ligase
MARYTREDIFRLAKEENVKYIRLQFTDLLGVIKNVEIPVSQLTKALDNKMMFDGSSIEGFVRIEESDMYLYPDLDTWVIFPWTAEKGKVARLICDIYNADGTPFDGDPRNNLKRVLKEMEALGFSDFNLGPEPEFFLFKVDEKGNPTLELNDNGGYFDLAPMDLGENCRRDIVLELEEMGFEIEASHHEVAPGQHEIDFKYANAIRSCDDIQTFKLVVKTIARKHGLHATFMPKPLYGVNGSGMHCNLSLFKNGENVFFDQNGDLQLSDDARHFIAGILKHAPAFTAVANPTVNSYKRLVPGYEAPCYVAWSAQNRSPLVRIPASRGISTRVEVRSVDPAANPYLVMATLLAAGLDGIKNKLTPPAAVDRNIYVMTKEEREEAGIVDLPATLAQALVTLQSNEVVCGALGEHLLEHFIEAKEIEWDIFRTQVHQWERDQYMSLY
>NZ_CP040344.1|WP_157409052.1|5243910_5245067_-|IS3-family-transposase
MKTRVHYPEETKWKVIEMKKDGYPNRTIMEKLGIKNVSQIKTWMKWYRTDQTYRFQQPVGKQYSYGKGPKELSELEQLRLENKHPKNKITCMGKVSGNRKGLKPETVVTLWENVKTKITVKELCNVLELPRSTFYRWLQRTEDLKDGIEEKVKDVCLRHKFRYGYRRVTATLRKMGLCVNHKKVLRIMRQNHILSKVRRKKKKYINGAEPMVAPHRLERQFDASRPNEKWFTDVTYLLFGERTLYLSTIMDAFNREIISCVISESQTLTLAMKTLKQAMRGRKVKDVLLHSDQGSIYTAKEFQAYAKENGMITSMSRRGNCHDNAVMESFFGHLKSEAFYSQKITKVSNTTVRKIVLEYIHYYNCVRIQEKLNHLSPKEFREQVV
>NZ_CP040344.1|WP_048527506.1|5243031_5243691_+|helix-turn-helix-domain-containing-protein
MEKAKIVTHLIKEAGYSKRAFAEKIGLPPTTLQSMLSRGIGKASVDNVIKVCKGLGITTDDLEGLTTKEDHTVKEEVSIYETIQNDQSNIIHIPIIGSVAAGTPIFAEENIEGYLPMLSTFLNKRKKYFYLTVKGTSMNLEFPDGSYVLVEETPYVENGQIAVVKVNGYDATVKKISKSGSIITLIPLSNDPIHEPQTYDLSAEDVKIIGRVVQAVKNY
>NZ_CP040344.1|WP_048527507.1|5242578_5242827_-|hypothetical-protein
MYPNLRAEMVRKGIVITQISSHLNLRYATVCDKINGKFRFYYDEALEIKETFFPNHNLEYLFEFEEDKPNCSVKRNHTFLGI
>NZ_CP040344.1|WP_048527508.1|5241426_5241621_-|hypothetical-protein
MQRKILVITSNLVGLPTVSEFKTKDAAREQIKKLIQKGISPNIIRIAQEISMNIEIQVDVEFEE
>NZ_CP040344.1|WP_000813896.1|5257437_5257662_-|RNA-chaperone-Hfq
MKQSINIQDQFLNQLRKENTFVTLYLLNGFQLRGLIKGFDNFTVLLETEGKQQLIYKHAISTFVPQKNVSIELE
>NZ_CP040344.1|WP_071757748.1|5257683_5258637_-|tRNA-(adenosine(37)-N6)-dimethylallyltransferase-MiaA
MGEVQREKVAVIIGPTAVGKTKLSIDLAKALNGEIISGDSMQIYRTMDIGTAKVTKEEMDGIPHYMVDIKNPEESFSVAEFQERVRKHIREITERGKLPIIVGGTGLYIQSVLFDYQFTDDAGDTTYREQMEKVAVEHGVEYVHKKLQEVDPESAERIHANNVRRVIRALEIFHTTGEKMSDQLEKQENELLYDVSLIGLTMDREMLYDRINLRVDIMMEQGLLEEVEGLYNRGIRDCQSIQAIGYKEIYDYFEGLVSLEEAVSQLKTNSRRYAKRQLTWFRNKMGVTWFDVTDGEKTSEILRYIEGKLQLKSNNSK
>NZ_CP040344.1|WP_071757749.1|5258819_5259065_+|hypothetical-protein
MEQSAINFSSLTKDLILATATKEQNCSQEELYFALNCLLRSFHSTLQETTLHPENQNTEYIQNQFCSAYKIITGKTIYPFQ
>NZ_CP040344.1|WP_071757750.1|5259127_5260060_-|SH3-domain-containing-protein
MKKLLGIATAAVFGLGIFAGSAKAETIVTTHVLNVRENPTVESKLVGKMLSGNKLDVVNTENGWTKIKLNGQEAFVSAEFTKSTYYVTAGVLNVRAGANTDSEILGKLNKDDVIETTNQVQNEWLQFDYNGKTGYVHVPFLTGTAPVIEKKEVVTQEEAPVRVNTPVKNNKVVKNKESVKNVESNKPVVKQQSTTKQVAKSTQTSAPAGGREITVEATAYTAHPSENGTYGGRVLTAMGHDLTANPNMKVIAVDPKVIPLGSKVWVEGYGEAIAGDTGGAIKGNRIDVLVGSDGSANSWGRKSVKVKVIE
>NZ_CP040344.1|WP_071757751.1|5260407_5262264_-|PTS-transporter-subunit-EIIA
MKITELLKRDTVIMNLTASNKEAVIEELVETLAGANRLNSKVEFKEAILKRESQSTTGIGEGIAIPHAKTKAVKQPAICFGRSVSGINYESLDGQPAHLFFMIAASEGANNTHLETLSRLSTLLMDEAFRKQLLDAKDEEELLRLFDEKENEKEDEVEVAKPEGNEPYVLAVTACPTGIAHTYMAADSLKAKAAELGIAIKVETNGSTGIKNGLSKEDIERATAIIVAADKQVEMNRFAGKHVIQVPVADGIRKTEMLLNRAVKQDAPIFKGVKEDGKAENTEKEKGLGIYKHLMNGVSNMLPFVVGGGILIALAFWVGGIKAEGPLAELLMSIGGGGTGAFLFLVPILAGFIASSIADRPGFMPGVVGGFLAAHANAGFLGGLIAGFLAGYVVLGLKKLFSGLPVQLEGIKPVLLYPVFGLLITGVVMQEVVNPPVVALNEMLTGWLNGLNGTNAILLGLILGGMMAIDMGGPINKAAFTFGIAAIEAQNFGVHSAVMAGGMVPPLAIAFATTLFKSKFTEAERKSGLTNYIMGASFITEGAIPFAAADPIRVIVSCVVGSSIAGALSMLFQITLPAPHGGLFVIALVNKPVLYIFSILIGTVVSALMMGIWKKKVK
>NZ_CP040344.1|WP_071757752.1|5262277_5263189_-|1-phosphofructokinase
MIYTVTLNPSIDYVVQVNSFDLGAVNRAEKDMKFPGGKGINVSRVLHRLGVENIALGFTGGFTGQFIKDVLQTEGVTTNFVQVDEDSRINVKIKGQEETELNGQGPSVTNEQFEQLMKQIESMKQGDCVVLAGSVPSSIPATFYESIAAIGAEKGIRVVVDASGSALQHVIKNKPFLIKPNHHELGELFGVEISTVEDVLPYGIKLIEQGVEHVIVSMAGDGALLFTAEGIYEATVPKGVVINSVGAGDSLVAGFVGKYEQTKDIEKAFQYGVATGSATAFSADLCEKKKVEELLSQVIVAKR
>NZ_CP040344.1|WP_071757753.1|5263185_5263938_-|DeoR/GlpR-transcriptional-regulator
MLTPERHQMILQLVKEQKVVKLQQLVESTESSESTIRRDLAQLEKQRLLKRVHGGAAVLTGKGQEPTMVEKSSKNIQIKQQIAKYAASIVEQGDCIYLDAGSTTFEMIPFLINKDVTVVTNGLMHIEALVENNIRAYLLGGMMKSRTKALIGAMAQESMQKYRFDKCFLGANGVHEQLGFTTPDPEEALLKQMALTLANEGYFLIDESKFSEVAFAKIANVEEANIITNHLEIDLEKYKRQTNVIEADKQ
>NZ_CP040344.1|WP_071757754.1|5264095_5265259_-|iron-containing-alcohol-dehydrogenase
MQNFVFRNPTKLIFGKGQLEQLKAEIPQFGKKVLLVYGGGSIKRNGIYDNVLSILKDINAEVFELTGVEPNPRVSTVKKGIQICKENGVEFILAVGGGSVIDCTKAIAAGSKYDGDVWDIVTKKVFASEALPFGTVLTLAATGSEMNAGSVITNWETNEKYGWGSPVTFPQFSILDPVHTASVPRDQTIYGMVDIMSHVLEQYFHNGTNTELQDRYCESVLKTVIETAPKLLSDLESYEHRETILYCGTMALNGILAMGVKGDWATHNIEHAVSAVHDIPHGGGLAILFPNWMKHVVDENVSRFKQFAIRVFDVETDGKTDREIALEGIEALRQFWTSIEAPVTLADYAIGENEIDVMADKAMAYGEFGNFKKLNKDDVLSIYKASL
>NZ_CP040344.1|WP_000228314.1|5266659_5267202_-|DUF420-domain-containing-protein
MVDQSTNQKSYAPIVITLSVIVNAIILFLFFGPVGYEGELHFDVTILPMLNAIFNSFTFVFLLAALYSIIKKNVKMHRGFILAAFTTTLLFCVSYLSYHYLAPATHFGGEGFIKYVYFIILITHIILAAIIVPLALFALVFGFTNQLTRHRKIVRWTMPIWLYVSLSGVIVYLMISPYYQ
>NZ_CP040344.1|WP_116746294.1|5267520_5267859_-|hypothetical-protein
MVKKEGGMTMEEYVLELYNLLYTTEWQDIVSFLGIMFCMKIVIVYMEEQGMFYSFSSSFDVQREPLLNYANVNYEHFPFVIFFMIRFITAIVKKKESDDEECHSTCNIANVF

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP040344.1	3006966-3006992	2	0.926
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP040344.1	5255398-5255424	1	0.963
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP040344.1	5255443-5255469	2	0.926
NZ_CP040344_4	4.40\|5255281\|18\|NZ_CP040344\|CRT	5255281-5255298	18	NZ_CP040344.1	5255488-5255505	0	1.0
NZ_CP040344_4	4.40\|5255281\|18\|NZ_CP040344\|CRT	5255281-5255298	18	NZ_CP040344.1	5255443-5255460	1	0.944

1. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to position: 3006966-3006992, mismatch: 2, identity: 0.926

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggcgctactggtgctactggacctcaa	Protospacer
********.***********.******

2. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

3. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

4. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

5. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

6. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

7. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

8. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

9. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

10. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

11. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

12. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

13. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

14. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to position: 5255398-5255424, mismatch: 1, identity: 0.963

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcagggtgctcaaggaccggcg	Protospacer
********.******************

15. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to position: 5255443-5255469, mismatch: 2, identity: 0.926

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtattcaaggaccggcg	Protospacer
************..*************

16. spacer 4.40|5255281|18|NZ_CP040344|CRT matches to position: 5255488-5255505, mismatch: 0, identity: 1.0

ggacctcaaggtatccaa	CRISPR spacer
ggacctcaaggtatccaa	Protospacer
******************

17. spacer 4.40|5255281|18|NZ_CP040344|CRT matches to position: 5255443-5255460, mismatch: 1, identity: 0.944

ggacctcaaggtatccaa	CRISPR spacer
ggacctcaaggtattcaa	Protospacer
**************.***

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	MK373793	Escherichia phage vB_EcoS_MM01, complete genome	10530-10556	2	0.926
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	AP014381	Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, * SEQUENCING IN PROGRESS *	1389-1415	3	0.889
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	1997-2023	4	0.852
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	MN830258	Lactobacillus phage JNU_P9, complete genome	19970-19996	4	0.852
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	MN830258	Lactobacillus phage JNU_P9, complete genome	19970-19996	4	0.852
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	NC_018511	Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence	884-910	4	0.852
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	NZ_CP009345	Bacillus thuringiensis HD1002 plasmid 6, complete sequence	1989-2015	4	0.852
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	NC_001446	Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence	3725-3751	4	0.852
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	4	0.852
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	CP011076	Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence	2042-2068	5	0.815
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	5	0.815
NZ_CP040344_4	4.10\|5253922\|27\|NZ_CP040344\|CRT	5253922-5253948	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	5	0.815
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	5	0.815
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.17\|5254255\|27\|NZ_CP040344\|CRT	5254255-5254281	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.20\|5254390\|27\|NZ_CP040344\|CRT	5254390-5254416	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.23\|5254525\|27\|NZ_CP040344\|CRT	5254525-5254551	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.26\|5254660\|27\|NZ_CP040344\|CRT	5254660-5254686	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.32\|5254921\|27\|NZ_CP040344\|CRT	5254921-5254947	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	MH937499	Streptococcus phage CHPC1062, complete genome	17286-17312	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2959-2985	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	3008-3034	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	509-535	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	292-318	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	MT354570	Pseudomonas phage phiB1_1, complete genome	30774-30800	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP024037	Bacillus aryabhattai strain K13 plasmid unnamed2	47505-47531	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_017139	Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence	34566-34592	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	MF417879	Uncultured Caudovirales phage clone 3S_11, partial genome	18878-18904	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP012101	Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence	253813-253839	5	0.815
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_021536	Synechococcus phage S-IOM18 genomic sequence	59585-59611	5	0.815
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	MN693555	Marine virus AFVG_25M96, complete genome	16854-16880	5	0.815
NZ_CP040344_4	4.37\|5255146\|27\|NZ_CP040344\|CRT	5255146-5255172	27	NC_031065	Salmonella phage vB_SnwM_CGG4-1, complete genome	98494-98520	5	0.815
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	5	0.815
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	5	0.815
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	5	0.815
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	NZ_CP024200	Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence	818556-818582	5	0.815
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP041047	Citrobacter sp. CF971 plasmid pBM527-1, complete sequence	292946-292972	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP011133	Citrobacter amalonaticus Y19 plasmid unnamed, complete sequence	91598-91624	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP050835	Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence	292100-292126	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP035215	Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence	284925-284951	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NZ_CP033971	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence	251833-251859	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	MT701598	Streptomyces phage Sitrop, complete genome	15911-15937	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	MT066160	Vibrio phage Saratov-12, complete genome	4499-4525	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	NC_015158	Vibrio phage ICP2, complete genome	25219-25245	6	0.778
NZ_CP040344_4	4.1\|5253319\|27\|NZ_CP040344\|CRT	5253319-5253345	27	MT767883	Vibrio phage Saratov-15, complete genome	10809-10835	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	AP018399	Xanthomonas phage XacN1 DNA, complete genome	302137-302163	6	0.778
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2684-2710	6	0.778
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2738-2764	6	0.778
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP012105	Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence	2792-2818	6	0.778
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	169110-169136	6	0.778
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	AP018399	Xanthomonas phage XacN1 DNA, complete genome	302137-302163	6	0.778
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.12\|5254012\|27\|NZ_CP040344\|CRT	5254012-5254038	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.18\|5254300\|27\|NZ_CP040344\|CRT	5254300-5254326	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.21\|5254435\|27\|NZ_CP040344\|CRT	5254435-5254461	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.24\|5254570\|27\|NZ_CP040344\|CRT	5254570-5254596	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.27\|5254705\|27\|NZ_CP040344\|CRT	5254705-5254731	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.33\|5254966\|27\|NZ_CP040344\|CRT	5254966-5254992	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.34\|5255011\|27\|NZ_CP040344\|CRT	5255011-5255037	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.35\|5255056\|27\|NZ_CP040344\|CRT	5255056-5255082	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2968-2994	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP053975	Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence	2977-3003	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2990-3016	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_018512	Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence	2999-3025	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	491-517	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_004334	Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence	500-526	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	274-300	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP009344	Bacillus thuringiensis HD1002 plasmid 7, complete sequence	283-309	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP020898	Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence	241612-241638	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013550	Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence	331204-331230	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	AF246223	Mycoplasma virus P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_015158	Vibrio phage ICP2, complete genome	24775-24801	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_002515	Mycoplasma phage P1, complete genome	8392-8418	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_012811	Methylorubrum extorquens AM1 megaplasmid, complete sequence	961755-961781	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_004041	Rhizobium etli CFN 42 plasmid p42d, complete sequence	239025-239051	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP021027	Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence	313108-313134	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013633	Rhizobium sp. N324 plasmid pRspN324c, complete sequence	313824-313850	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013555	Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence	324630-324656	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP020950	Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence	346411-346437	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013587	Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence	268112-268138	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013598	Rhizobium sp. N741 plasmid pRspN741c, complete sequence	305387-305413	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013561	Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence	305290-305316	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013578	Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013530	Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013535	Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence	301462-301488	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013540	Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence	313358-313384	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013544	Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence	238040-238066	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013566	Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence	324343-324369	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013502	Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013583	Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence	293859-293885	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013508	Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence	306587-306613	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013519	Rhizobium sp. N113 plasmid pRspN113b, complete sequence	308074-308100	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013572	Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence	326164-326190	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP021125	Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence	302178-302204	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013492	Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence	310637-310663	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013514	Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence	305293-305319	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013497	Rhizobium sp. N621 plasmid pRspN621b, complete sequence	311837-311863	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013592	Rhizobium sp. N871 plasmid pRspN871b, complete sequence	305309-305335	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376439-376465	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376448-376474	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP054613	Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence	376457-376483	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	CP007643	Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence	366760-366786	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_010996	Rhizobium etli CIAT 652 plasmid pB, complete sequence	300744-300770	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP013604	Rhizobium sp. N731 plasmid pRspN731c, complete sequence	305295-305321	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NZ_CP017243	Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence	309871-309897	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36217-36243	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36298-36324	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36379-36405	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	KX879602	Liberibacter phage HHCA1-2, complete genome	36568-36594	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2546-2572	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2555-2581	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2564-2590	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2609-2635	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2762-2788	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	JF773396	Liberibacter phage FP2, complete genome	2807-2833	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	35928-35954	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	35937-35963	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	35946-35972	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	35991-36017	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36036-36062	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36225-36251	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36306-36332	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36387-36413	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36576-36602	6	0.778
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	NC_019550	Liberibacter phage SC2, complete genome	36621-36647	6	0.778
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168894-168920	6	0.778
NZ_CP040344_4	4.38\|5255191\|27\|NZ_CP040344\|CRT	5255191-5255217	27	CP024687	Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence	168948-168974	6	0.778
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243809-243835	7	0.741
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80560-80586	7	0.741
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54270-54296	7	0.741
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134759-134785	7	0.741
NZ_CP040344_4	4.8\|5253805\|27\|NZ_CP040344\|CRT	5253805-5253831	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239864-239890	7	0.741
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP033968	Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence	243809-243835	7	0.741
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP037902	Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence	80560-80586	7	0.741
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP046332	Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2	54270-54296	7	0.741
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NC_006466	Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence	134759-134785	7	0.741
NZ_CP040344_4	4.11\|5253967\|27\|NZ_CP040344\|CRT	5253967-5253993	27	NZ_CP043439	Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence	239864-239890	7	0.741
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.13\|5254057\|27\|NZ_CP040344\|CRT	5254057-5254083	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.16\|5254210\|27\|NZ_CP040344\|CRT	5254210-5254236	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.19\|5254345\|27\|NZ_CP040344\|CRT	5254345-5254371	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.22\|5254480\|27\|NZ_CP040344\|CRT	5254480-5254506	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.25\|5254615\|27\|NZ_CP040344\|CRT	5254615-5254641	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.31\|5254876\|27\|NZ_CP040344\|CRT	5254876-5254902	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	MG708274	Streptococcus phage vB_SthS_VA214, complete genome	20001-20027	7	0.741
NZ_CP040344_4	4.36\|5255101\|27\|NZ_CP040344\|CRT	5255101-5255127	27	KY705251	Streptococcus phage P0091, complete genome	17102-17128	7	0.741

1. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

2. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

3. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

4. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

5. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

6. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to MK373793 (Escherichia phage vB_EcoS_MM01, complete genome) position: , mismatch: 2, identity: 0.926

ggacctcagggtattcaaggtaacaca-	CRISPR spacer
ggacctcagggtattcaaggt-ccacaa	Protospacer
*********************  ****

7. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

8. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

9. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

10. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

11. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

12. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to AP014381 (Uncultured Mediterranean phage uvMED isolate uvMED-GF-U-MedDCM-OCT-S43-C84, *** SEQUENCING IN PROGRESS ***) position: , mismatch: 3, identity: 0.889

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggaactcagggtattcaaggtatcact	Protospacer
*** ****************** ***

13. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 4, identity: 0.852

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggcgctaccggtgctactggacctacc	Protospacer
********************.***

14. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to MN830258 (Lactobacillus phage JNU_P9, complete genome) position: , mismatch: 4, identity: 0.852

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggcgttcagggtacccct	Protospacer
*****************.**** * *

15. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to MN830258 (Lactobacillus phage JNU_P9, complete genome) position: , mismatch: 4, identity: 0.852

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggcgttcagggtacccct	Protospacer
*****************.**** * *

16. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

17. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

18. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

19. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

20. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

21. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

22. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

23. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

24. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

25. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

26. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

27. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

28. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

29. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

30. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

31. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

32. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

33. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

34. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

35. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

36. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

37. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

38. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

39. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to NC_018511 (Bacillus thuringiensis HD-789 plasmid pBTHD789-5, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

40. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to NZ_CP009345 (Bacillus thuringiensis HD1002 plasmid 6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

41. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to NC_001446 (Bacillus thuringiensis sv israelensis HI4 plasmid pTX14-3, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcagggtattcaaggtccacca	Protospacer
*********************    **

42. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 4, identity: 0.852

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
********************** .  *

43. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to CP011076 (Brevibacillus laterosporus strain B9 plasmid unnamed2, complete sequence) position: , mismatch: 5, identity: 0.815

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggtgctaccggtgctactggacctacc	Protospacer
**.*****************.***

44. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
*********** ********** .  *

45. spacer 4.10|5253922|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

gggcctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
**.******************* .  *

46. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
*********** ********** .  *

47. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

48. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

49. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

50. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

51. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

52. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

53. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

54. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

55. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

56. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

57. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

58. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

59. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

60. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

61. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

62. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

63. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

64. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

65. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

66. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

67. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

68. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

69. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

70. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

71. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

72. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

73. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

74. spacer 4.17|5254255|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

75. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

76. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

77. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

78. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

79. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

80. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

81. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

82. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

83. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

84. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

85. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

86. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

87. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

88. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

89. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

90. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

91. spacer 4.20|5254390|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

92. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

93. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

94. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

95. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

96. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

97. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

98. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

99. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

100. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

101. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

102. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

103. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

104. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

105. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

106. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

107. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

108. spacer 4.23|5254525|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

109. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

110. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

111. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

112. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

113. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

114. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

115. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

116. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

117. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

118. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

119. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

120. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

121. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

122. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

123. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

124. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

125. spacer 4.26|5254660|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

126. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

127. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

128. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

129. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

130. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

131. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

132. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

133. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

134. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

135. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

136. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

137. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

138. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

139. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

140. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

141. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

142. spacer 4.32|5254921|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

143. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

144. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

145. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

146. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

147. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

148. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

149. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

150. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

151. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

152. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

153. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

154. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

155. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to MH937499 (Streptococcus phage CHPC1062, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggaccacaa	Protospacer
*************.*********.  .

156. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

157. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

158. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

159. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctgtt	Protospacer
***********  ********** *.

160. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to MT354570 (Pseudomonas phage phiB1_1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgtacaaggaccgcaa	Protospacer
*************. *********  .

161. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP024037 (Bacillus aryabhattai strain K13 plasmid unnamed2) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

162. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_017139 (Bacillus megaterium WSH-002 plasmid WSH-002_p1, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcag	Protospacer
***********  **********   *

163. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to MF417879 (Uncultured Caudovirales phage clone 3S_11, partial genome) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttacctcaaggtgctcaaggatagggg	Protospacer
  *******************. ** *

164. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP012101 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-2, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggaactcaaggacctcct	Protospacer
*********** .**********  *

165. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_021536 (Synechococcus phage S-IOM18 genomic sequence) position: , mismatch: 5, identity: 0.815

---ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ttcgg---tcaaggtgctcaaggaacggct	Protospacer
   **   **************** ****

166. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to MN693555 (Marine virus AFVG_25M96, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacctcaaggtattcaaggtattcaa	Protospacer
********.************* .  *

167. spacer 4.37|5255146|27|NZ_CP040344|CRT matches to NC_031065 (Salmonella phage vB_SnwM_CGG4-1, complete genome) position: , mismatch: 5, identity: 0.815

ggacctcagggtattcaaggtaacaca	CRISPR spacer
ggacttcagggtattcaaggtcccgcc	Protospacer
****.****************  *.*

168. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

169. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

170. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
***********.********** .  *

171. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to NZ_CP024200 (Thalassospira marina strain CSC3H3 plasmid pCSC3H3, complete sequence) position: , mismatch: 5, identity: 0.815

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
tgacctcaaggggttcaaggatacgcg	Protospacer
 *******************  **.*.

172. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NZ_CP041047 (Citrobacter sp. CF971 plasmid pBM527-1, complete sequence) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
cttgataccggtgatactgggcctcag	Protospacer
  .* ******** ************.

173. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NZ_CP011133 (Citrobacter amalonaticus Y19 plasmid unnamed, complete sequence) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
cttgataccggtgatactgggcctcag	Protospacer
  .* ******** ************.

174. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NZ_CP050835 (Klebsiella pneumoniae strain Bckp021 plasmid pBckp021-1, complete sequence) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
cttgataccggtgatactgggcctcag	Protospacer
  .* ******** ************.

175. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NZ_CP035215 (Klebsiella michiganensis strain M82255 plasmid pKOCBH-A, complete sequence) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
cttgataccggtgatactgggcctcag	Protospacer
  .* ******** ************.

176. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NZ_CP033971 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed2, complete sequence) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggcgcaaccggtgcgactgggccgacc	Protospacer
***** ******** ********

177. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to MT701598 (Streptomyces phage Sitrop, complete genome) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggcgctaccggtgcgactggtcccact	Protospacer
************** ***** **.

178. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to MT066160 (Vibrio phage Saratov-12, complete genome) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggccctaccggtgctactggaccagtt	Protospacer
*** ****************.**

179. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggccctaccggtgctactggtccagtt	Protospacer
*** **************** **

180. spacer 4.1|5253319|27|NZ_CP040344|CRT matches to MT767883 (Vibrio phage Saratov-15, complete genome) position: , mismatch: 6, identity: 0.778

ggcgctaccggtgctactgggcctcaa	CRISPR spacer
ggccctaccggtgctactggaccagtt	Protospacer
*** ****************.**

181. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

182. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
*********** ********** .  .

183. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

184. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

185. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
agacctcaaggcgttcaatggaacggt	Protospacer
.***************** * ***.

186. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

187. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggggttcaaggtattcaa	Protospacer
*********** ********** .  .

188. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP012105 (Bacillus thuringiensis strain HS18-1 plasmid pHS18-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

189. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
ggacctcaaggagttcaaggtattcaa	Protospacer
*********** ********** .  .

190. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to AP018399 (Xanthomonas phage XacN1 DNA, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
agacctcaaggcgttcaatggaacggt	Protospacer
.***************** * ***.

191. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

192. spacer 4.12|5254012|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

193. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

194. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

195. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

196. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

197. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

198. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

199. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

200. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

201. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

202. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

203. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

204. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

205. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

206. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

207. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

208. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

209. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

210. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

211. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

212. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

213. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

214. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

215. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

216. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

217. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

218. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

219. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

220. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

221. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

222. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

223. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

224. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

225. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

226. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

227. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

228. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

229. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

230. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

231. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

232. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

233. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

234. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

235. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

236. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

237. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

238. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

239. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

240. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

241. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

242. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

243. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

244. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

245. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

246. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

247. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

248. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

249. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

250. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

251. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

252. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

253. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

254. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

255. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

256. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

257. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

258. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

259. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

260. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

261. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

262. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

263. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

264. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

265. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

266. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

267. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

268. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

269. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

270. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

271. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

272. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

273. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

274. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

275. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

276. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

277. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

278. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

279. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

280. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

281. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

282. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

283. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

284. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

285. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

286. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

287. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

288. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

289. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

290. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

291. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

292. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

293. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

294. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

295. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

296. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

297. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

298. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

299. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

300. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

301. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

302. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

303. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

304. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

305. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

306. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

307. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

308. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

309. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

310. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

311. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

312. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

313. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

314. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

315. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

316. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

317. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

318. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

319. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

320. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

321. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

322. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

323. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

324. spacer 4.18|5254300|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

325. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

326. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

327. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

328. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

329. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

330. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

331. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

332. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

333. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

334. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

335. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

336. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

337. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

338. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

339. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

340. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

341. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

342. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

343. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

344. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

345. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

346. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

347. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

348. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

349. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

350. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

351. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

352. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

353. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

354. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

355. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

356. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

357. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

358. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

359. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

360. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

361. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

362. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

363. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

364. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

365. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

366. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

367. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

368. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

369. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

370. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

371. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

372. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

373. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

374. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

375. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

376. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

377. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

378. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

379. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

380. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

381. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

382. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

383. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

384. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

385. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

386. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

387. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

388. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

389. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

390. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

391. spacer 4.21|5254435|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

392. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

393. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

394. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

395. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

396. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

397. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

398. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

399. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

400. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

401. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

402. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

403. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

404. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

405. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

406. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

407. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

408. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

409. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

410. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

411. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

412. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

413. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

414. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

415. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

416. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

417. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

418. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

419. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

420. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

421. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

422. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

423. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

424. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

425. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

426. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

427. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

428. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

429. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

430. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

431. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

432. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

433. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

434. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

435. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

436. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

437. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

438. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

439. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

440. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

441. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

442. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

443. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

444. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

445. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

446. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

447. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

448. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

449. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

450. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

451. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

452. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

453. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

454. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

455. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

456. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

457. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

458. spacer 4.24|5254570|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

459. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

460. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

461. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

462. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

463. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

464. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

465. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

466. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

467. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

468. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

469. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

470. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

471. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

472. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

473. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

474. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

475. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

476. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

477. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

478. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

479. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

480. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

481. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

482. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

483. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

484. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

485. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

486. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

487. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

488. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

489. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

490. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

491. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

492. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

493. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

494. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

495. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

496. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

497. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

498. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

499. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

500. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

501. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

502. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

503. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

504. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

505. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

506. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

507. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

508. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

509. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

510. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

511. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

512. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

513. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

514. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

515. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

516. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

517. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

518. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

519. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

520. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

521. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

522. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

523. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

524. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

525. spacer 4.27|5254705|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

526. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

527. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

528. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

529. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

530. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

531. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

532. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

533. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

534. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

535. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

536. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

537. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

538. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

539. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

540. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

541. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

542. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

543. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

544. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

545. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

546. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

547. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

548. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

549. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

550. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

551. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

552. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

553. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

554. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

555. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

556. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

557. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

558. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

559. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

560. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

561. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

562. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

563. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

564. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

565. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

566. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

567. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

568. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

569. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

570. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

571. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

572. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

573. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

574. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

575. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

576. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

577. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

578. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

579. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

580. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

581. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

582. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

583. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

584. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

585. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

586. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

587. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

588. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

589. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

590. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

591. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

592. spacer 4.33|5254966|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

593. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

594. spacer 4.34|5255011|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

595. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

596. spacer 4.35|5255056|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

597. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

598. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP053975 (Bacillus thuringiensis strain FDAARGOS_796 plasmid unnamed6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

599. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

600. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_018512 (Bacillus thuringiensis HD-789 plasmid pBTHD789-6, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

601. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

602. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_004334 (Bacillus thuringiensis 4Q2 plasmid pTX14-2, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

603. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

604. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP009344 (Bacillus thuringiensis HD1002 plasmid 7, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

605. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP020898 (Rhizobium phaseoli Brasil 5 strain Bra5 plasmid pRetBra5b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

606. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013550 (Rhizobium phaseoli strain R611 plasmid pRetR611c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

607. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to AF246223 (Mycoplasma virus P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

608. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_015158 (Vibrio phage ICP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgagcaaggacccatc	Protospacer
*************  ******** ..

609. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_002515 (Mycoplasma phage P1, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
gggcctcaaggtgttcaaggaccaaaa	Protospacer
**.**********.*********.. .

610. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_012811 (Methylorubrum extorquens AM1 megaplasmid, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
cgacctcaaggtgctgaaggacaaggc	Protospacer
 ************** ****** .*

611. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_004041 (Rhizobium etli CFN 42 plasmid p42d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

612. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP021027 (Rhizobium sp. TAL182 plasmid pRetTAL182c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

613. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013633 (Rhizobium sp. N324 plasmid pRspN324c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

614. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013555 (Rhizobium phaseoli strain N931 plasmid pRphaN931c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

615. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP020950 (Rhizobium sp. CIAT894 plasmid pRheCIAT894c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

616. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013587 (Rhizobium phaseoli strain N161 plasmid pRphaN161b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

617. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013598 (Rhizobium sp. N741 plasmid pRspN741c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

618. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013561 (Rhizobium phaseoli strain N841 plasmid pRphaN841d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

619. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013578 (Rhizobium phaseoli strain N671 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

620. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013530 (Rhizobium phaseoli strain R723 plasmid pRphaR723c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

621. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013535 (Rhizobium phaseoli strain R650 plasmid pRphaR650c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

622. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013540 (Rhizobium phaseoli strain R630 plasmid pRphaR630c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

623. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013544 (Rhizobium phaseoli strain R620 plasmid pRphaR620b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

624. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013566 (Rhizobium phaseoli strain N831 plasmid pRphaN831c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

625. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013502 (Rhizobium esperanzae strain N561 plasmid pRspN561b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

626. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013583 (Rhizobium phaseoli strain N261 plasmid pRphaN261c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

627. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013508 (Rhizobium sp. N1341 plasmid pRspN1341c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

628. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013519 (Rhizobium sp. N113 plasmid pRspN113b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

629. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013572 (Rhizobium phaseoli strain N771 plasmid pRphaN671d, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

630. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP021125 (Rhizobium sp. Kim5 plasmid pRetKim5a, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

631. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013492 (Rhizobium sp. N6212 plasmid pRspN6212b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

632. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013514 (Rhizobium sp. N1314 plasmid pRspN1314c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

633. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013497 (Rhizobium sp. N621 plasmid pRspN621b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

634. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013592 (Rhizobium sp. N871 plasmid pRspN871b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

635. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

636. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

637. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP054613 (Paenibacillus cellulosilyticus strain KACC 14175 plasmid unnamed4, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

638. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to CP007643 (Rhizobium etli bv. phaseoli str. IE4803 plasmid pRetIE4803b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

639. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_010996 (Rhizobium etli CIAT 652 plasmid pB, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

640. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP013604 (Rhizobium sp. N731 plasmid pRspN731c, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

641. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NZ_CP017243 (Rhizobium etli 8C-3 plasmid pRsp8C3b, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggtcttcaaggtgctcaaggaccacaa	Protospacer
** *.******************.  .

642. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

643. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

644. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

645. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to KX879602 (Liberibacter phage HHCA1-2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

646. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

647. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

648. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

649. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

650. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

651. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to JF773396 (Liberibacter phage FP2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

652. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

653. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

654. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

655. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

656. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

657. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

658. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

659. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctaaa	Protospacer
***********  ********** . .

660. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

661. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to NC_019550 (Liberibacter phage SC2, complete genome) position: , mismatch: 6, identity: 0.778

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggacctcaaggacctcaa	Protospacer
***********  **********   .

662. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggagttcaaggtattcag	Protospacer
***********.********** .  .

663. spacer 4.38|5255191|27|NZ_CP040344|CRT matches to CP024687 (Bacillus wiedmannii bv. thuringiensis strain FCC41 plasmid pFCC41-3-257K, complete sequence) position: , mismatch: 6, identity: 0.778

ggacctcaaggggttcaaggtaacaca	CRISPR spacer
ggacctcaaggggttcaaggacttcaa	Protospacer
********************   .  *

664. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

665. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

666. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

667. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

668. spacer 4.8|5253805|27|NZ_CP040344|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

669. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP033968 (Cupriavidus pauculus strain FDAARGOS_614 plasmid unnamed1, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

670. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP037902 (Cupriavidus metallidurans strain BS1 plasmid p1, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

671. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP046332 (Cupriavidus metallidurans strain FDAARGOS_675 plasmid unnamed2) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

672. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NC_006466 (Cupriavidus metallidurans CH34 plasmid pMOL30, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

673. spacer 4.11|5253967|27|NZ_CP040344|CRT matches to NZ_CP043439 (Cupriavidus campinensis strain MJ1 plasmid unnamed2, complete sequence) position: , mismatch: 7, identity: 0.741

ggacctcaaggcgttcaaggtaacacg	CRISPR spacer
cctcttcaaggcgttcaaggtaaccgc	Protospacer
   *.*******************

674. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

675. spacer 4.13|5254057|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

676. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

677. spacer 4.16|5254210|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

678. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

679. spacer 4.19|5254345|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

680. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

681. spacer 4.22|5254480|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

682. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

683. spacer 4.25|5254615|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

684. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

685. spacer 4.31|5254876|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

686. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to MG708274 (Streptococcus phage vB_SthS_VA214, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

687. spacer 4.36|5255101|27|NZ_CP040344|CRT matches to KY705251 (Streptococcus phage P0091, complete genome) position: , mismatch: 7, identity: 0.741

ggacctcaaggtgctcaaggaccggcg	CRISPR spacer
ggacctcaaggtgttcaaggattacaa	Protospacer
*************.*******...  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

641717 : 704383

Klosneuvirus(22.22%)

transposase,coat,tRNA,protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_128805339.1\|641717_643481_-\|coat	spore coat assembly protein ExsA	NA	NA	NA	NA
WP_071757219.1\|643706_644813_-	quinolinate synthase NadA	NA	NA	NA	NA
WP_048531406.1\|644843_645677_-	carboxylating nicotinate-nucleotide diphosphorylase	NA	NA	NA	NA
WP_157409082.1\|645696_647226_-	L-aspartate oxidase	NA	NA	NA	NA
WP_071757216.1\|647378_648521_+	aminotransferase class V-fold PLP-dependent enzyme	A0A1X7QGF3	Faustovirus	2.0e-31	29.2
WP_078417860.1\|648520_649063_+	transcription repressor NadR	NA	NA	NA	NA
WP_157409083.1\|649142_649790_+	MOSC domain-containing protein	NA	NA	NA	NA
WP_157409084.1\|649853_650705_-	prephenate dehydratase	NA	NA	NA	NA
WP_048531416.1\|650801_652715_-	FtsX-like permease family protein	NA	NA	NA	NA
WP_048531418.1\|652764_654687_-	ABC transporter permease	NA	NA	NA	NA
WP_000114530.1\|654661_655438_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-29	38.4
WP_071757212.1\|655531_656614_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_048531422.1\|656603_657311_-	response regulator transcription factor	NA	NA	NA	NA
WP_001003587.1\|658734_659283_-	sporulation protein	NA	NA	NA	NA
WP_000944957.1\|659346_659637_-	50S ribosomal protein L27	NA	NA	NA	NA
WP_001973720.1\|659640_659985_-\|protease	ribosomal-processing cysteine protease Prp	NA	NA	NA	NA
WP_000270907.1\|659996_660305_-	50S ribosomal protein L21	NA	NA	NA	NA
WP_071757210.1\|660474_661863_-	Rne/Rng family ribonuclease	NA	NA	NA	NA
WP_048531427.1\|661930_662791_-	stage IV sporulation protein SpoIVFB	NA	NA	NA	NA
WP_048531430.1\|662783_663530_-	stage IV sporulation protein SpoIVFA	NA	NA	NA	NA
WP_000503310.1\|663663_664461_-	septum site-determining protein MinD	NA	NA	NA	NA
WP_071757209.1\|664463_665150_-	septum site-determining protein MinC	NA	NA	NA	NA
WP_071757208.1\|665185_665731_-	rod shape-determining protein MreD	NA	NA	NA	NA
WP_071757207.1\|665745_666597_-	rod shape-determining protein MreC	NA	NA	NA	NA
WP_000466737.1\|666638_667658_-	rod shape-determining protein MreB	NA	NA	NA	NA
WP_048531438.1\|667815_668493_-	DNA repair protein RadC	NA	NA	NA	NA
WP_157409085.1\|668540_669116_-	septum formation inhibitor Maf	NA	NA	NA	NA
WP_157409086.1\|669490_670453_-	stage II sporulation protein B	NA	NA	NA	NA
WP_157409087.1\|670618_671920_-	bifunctional tetrahydrofolate synthase/dihydrofolate synthase	NA	NA	NA	NA
WP_000072219.1\|672014_674660_-\|tRNA	valine--tRNA ligase	A0A1V0SK04	Klosneuvirus	4.7e-164	42.7
WP_157409088.1\|675100_676126_-\|coat	spore coat protein YsxE	NA	NA	NA	NA
WP_048531450.1\|676192_677170_-	stage VI sporulation protein D	NA	NA	NA	NA
WP_048531453.1\|677279_678569_-	glutamate-1-semialdehyde 2,1-aminomutase	A0A1V0SKB7	Klosneuvirus	1.7e-05	34.1
WP_157409089.1\|678568_679558_-	porphobilinogen synthase	NA	NA	NA	NA
WP_071757202.1\|679627_680380_-	uroporphyrinogen-III synthase	NA	NA	NA	NA
WP_048531459.1\|680382_681312_-	hydroxymethylbilane synthase	NA	NA	NA	NA
WP_016086099.1\|681327_682161_-	cytochrome c biogenesis protein CcsA	NA	NA	NA	NA
WP_157409090.1\|682178_683513_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_048531465.1\|683929_684382_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_157409091.1\|684384_684801_+	Ohr family peroxiredoxin	NA	NA	NA	NA
WP_048531469.1\|684837_685434_-	ribosome biogenesis GTP-binding protein YsxC	NA	NA	NA	NA
WP_048531471.1\|685430_687761_-	endopeptidase La	A0A0R6PGP8	Moraxella_phage	5.0e-178	43.8
WP_048531883.1\|687945_689616_-\|protease	ATP-dependent protease LonB	E3T4F6	Cafeteria_roenbergensis_virus	7.4e-14	33.0
WP_048531476.1\|689722_690982_-\|protease	ATP-dependent Clp protease ATP-binding subunit ClpX	G3M9Z9	Bacillus_virus	1.7e-148	65.8
WP_048531478.1\|691246_692524_-	trigger factor	NA	NA	NA	NA
WP_048531481.1\|692833_693832_-	hypothetical protein	NA	NA	NA	NA
WP_001983650.1\|694030_694279_-	hypothetical protein	NA	NA	NA	NA
WP_157409092.1\|694756_695371_+	hypothetical protein	NA	NA	NA	NA
WP_000124460.1\|695465_695666_-	hypothetical protein	NA	NA	NA	NA
WP_000645511.1\|696349_696853_-	metallophosphoesterase	NA	NA	NA	NA
WP_071757191.1\|696866_697475_-	XTP/dITP diphosphatase	D2KCJ6	Cassava_brown_streak_virus	2.7e-14	33.7
WP_001261767.1\|697486_698224_-	ribonuclease PH	NA	NA	NA	NA
WP_071757190.1\|698352_699402_-	spore germination protein GerM	NA	NA	NA	NA
WP_000774001.1\|699533_700343_-	glutamate racemase	NA	NA	NA	NA
WP_157409093.1\|700556_701879_-	MFS transporter	NA	NA	NA	NA
WP_048531491.1\|702255_702939_+	type 1 glutamine amidotransferase domain-containing protein	NA	NA	NA	NA
WP_157409011.1\|703023_704383_+\|transposase	IS3 family transposase	A0A1B1P773	Bacillus_phage	3.4e-110	73.7

DBSCAN-SWA_2

737747 : 745434

Staphylococcus_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048531544.1\|737747_738671_-	ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	1.8e-46	44.4
WP_157409099.1\|738796_739732_-	sensor histidine kinase	W8CYF6	Bacillus_phage	1.7e-20	24.5
WP_071757013.1\|739733_740429_-	response regulator transcription factor	B5LWA6	Feldmannia_species_virus	1.4e-06	28.8
WP_001293578.1\|740598_740772_+	hypothetical protein	NA	NA	NA	NA
WP_001014310.1\|740772_740967_+	YwbE family protein	NA	NA	NA	NA
WP_128805330.1\|741005_742205_-	class I SAM-dependent rRNA methyltransferase	W6LLI2	Streptococcus_phage	2.1e-71	41.3
WP_000587815.1\|742503_742827_+	heme oxygenase	NA	NA	NA	NA
WP_048531552.1\|742894_743659_-	class B sortase	NA	NA	NA	NA
WP_048531554.1\|743690_744461_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.7e-13	26.6
WP_048531556.1\|744450_745434_-	iron ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	1.4e-17	26.5

DBSCAN-SWA_3

1392212 : 1399101

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157409206.1\|1392212_1393205_-	UDP-glucose 4-epimerase GalE	A0A2K9L1R4	Tupanvirus	1.8e-52	37.7
WP_157409207.1\|1393295_1394114_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_157409208.1\|1394212_1395127_-	LytR family transcriptional regulator	NA	NA	NA	NA
WP_088313596.1\|1395227_1395620_-	glycerol-3-phosphate cytidylyltransferase	A0A1V0SGE7	Hokovirus	2.8e-17	40.7
WP_088313597.1\|1395754_1396786_-	dTDP-glucose 4,6-dehydratase	I7HTA3	Enterobacteria_phage	3.4e-78	46.4
WP_157409209.1\|1396787_1397642_-	dTDP-4-dehydrorhamnose reductase	A0A1D7XFA3	Escherichia_phage	4.4e-39	38.5
WP_157409210.1\|1397646_1398207_-	dTDP-4-dehydrorhamnose 3,5-epimerase	A0A218MN57	uncultured_virus	1.8e-41	48.4
WP_023523537.1\|1398222_1399101_-	glucose-1-phosphate thymidylyltransferase RfbA	I7I009	Enterobacteria_phage	1.6e-108	67.4

DBSCAN-SWA_4

1890226 : 1898172

uncultured_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000917306.1\|1890226_1890511_+	co-chaperone GroES	A0A221S3C8	uncultured_virus	1.2e-20	53.8
WP_001975554.1\|1890549_1892184_+	chaperonin GroEL	A0A219YK78	uncultured_virus	4.5e-157	58.0
WP_164468695.1\|1892587_1894129_+	glutamine-hydrolyzing GMP synthase	A0A1V0SH76	Hokovirus	1.2e-21	31.7
WP_157409274.1\|1894511_1895837_+	NCS2 family permease	A0A0R6PHV4	Moraxella_phage	4.9e-45	31.2
WP_048528489.1\|1895981_1896683_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.6e-39	36.4
WP_071758899.1\|1896666_1898172_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	7.8e-31	30.7

DBSCAN-SWA_5

1942325 : 1950697

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000625682.1\|1942325_1943633_+	adenylosuccinate lyase	A0A2H4UUU6	Bodo_saltans_virus	4.9e-21	25.3
WP_048529441.1\|1943721_1944441_+	phosphoribosylaminoimidazolesuccinocarboxamide synthase	G8EYA2	Synechococcus_phage	3.0e-49	44.8
WP_000278826.1\|1944433_1944688_+	phosphoribosylformylglycinamidine synthase subunit PurS	NA	NA	NA	NA
WP_048375606.1\|1944684_1945368_+	phosphoribosylformylglycinamidine synthase subunit PurQ	NA	NA	NA	NA
WP_048529437.1\|1945351_1947571_+	phosphoribosylformylglycinamidine synthase II	A6N228	Microbacterium_phage	1.1e-163	41.3
WP_048529435.1\|1947555_1948971_+	amidophosphoribosyltransferase	A0A0M3SGR2	Mollivirus	2.1e-54	35.2
WP_048529433.1\|1949072_1950113_+	phosphoribosylformylglycinamidine cyclo-ligase	A0A0E3F760	Synechococcus_phage	2.1e-67	45.6
WP_048529431.1\|1950109_1950697_+	phosphoribosylglycinamide formyltransferase	M4QRX9	Synechococcus_phage	3.5e-27	36.4

DBSCAN-SWA_6

3458052 : 3466746

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157409604.1\|3458052_3459324_+	SH3 domain-containing protein	A0A1V0DZX6	Clostridioides_phage	2.6e-11	31.5
WP_157409605.1\|3459423_3460188_-	alpha/beta fold hydrolase	NA	NA	NA	NA
WP_157409606.1\|3460428_3462189_+	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	2.1e-269	96.9
WP_116746322.1\|3462268_3462955_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.1e-116	93.0
WP_157409607.1\|3462951_3464013_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-169	88.4
WP_157409608.1\|3464049_3464637_-	DUF3139 domain-containing protein	NA	NA	NA	NA
WP_000818985.1\|3464831_3465551_+	3-ketoacyl-ACP reductase	W8CYX9	Bacillus_phage	5.9e-61	100.0
WP_048527363.1\|3465873_3466746_+	aminoglycoside 6-adenylyltransferase	A0A1X9I6F2	Streptococcus_phage	1.4e-64	44.0

DBSCAN-SWA_7

3627603 : 3682131

Bacillus_phage(65.0%)

integrase,protease,portal,terminase

attL 3652453:3652470|attR 3680909:3680926

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_157409654.1\|3627603_3629832_-\|protease	protease	NA	NA	NA	NA
WP_071758094.1\|3629828_3631043_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_157409655.1\|3631042_3632005_-	AAA domain-containing protein	NA	NA	NA	NA
WP_000877034.1\|3632392_3632734_-	hypothetical protein	NA	NA	NA	NA
WP_071758096.1\|3632826_3633327_-	hypothetical protein	NA	NA	NA	NA
WP_157409656.1\|3633805_3637489_+	nitrate reductase subunit alpha	NA	NA	NA	NA
WP_000692672.1\|3637478_3638954_+	nitrate reductase subunit beta	A0A077SL61	Escherichia_phage	1.2e-20	47.3
WP_071758099.1\|3638973_3639504_+	nitrate reductase molybdenum cofactor assembly chaperone	NA	NA	NA	NA
WP_157409657.1\|3639521_3640211_+	respiratory nitrate reductase subunit gamma	NA	NA	NA	NA
WP_071758101.1\|3640289_3640982_-	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_071758102.1\|3641260_3642274_+	GTP 3',8-cyclase MoaA	NA	NA	NA	NA
WP_071758103.1\|3642291_3643305_+	molybdopterin-synthase adenylyltransferase MoeB	NA	NA	NA	NA
WP_157409658.1\|3643345_3644635_+	molybdopterin molybdenumtransferase MoeA	NA	NA	NA	NA
WP_071758105.1\|3644679_3645150_+	molybdenum cofactor biosynthesis protein MoaE	NA	NA	NA	NA
WP_071758106.1\|3645146_3645380_+	molybdopterin converting factor subunit 1	NA	NA	NA	NA
WP_000841864.1\|3645460_3646630_+	nitrate transporter NarK	NA	NA	NA	NA
WP_000469521.1\|3647246_3648164_+	transporter	NA	NA	NA	NA
WP_071758107.1\|3648384_3648858_-	precorrin-2 dehydrogenase	NA	NA	NA	NA
WP_071758108.1\|3648850_3649561_-	sirohydrochlorin chelatase	NA	NA	NA	NA
WP_071758109.1\|3649557_3650982_-	uroporphyrin-III C-methyltransferase	NA	NA	NA	NA
WP_048528785.1\|3651040_3651358_-	nitrite reductase small subunit NirD	NA	NA	NA	NA
WP_157409659.1\|3651373_3653779_-	NADPH-nitrite reductase large subunit	NA	NA	NA	NA
3652453:3652470	attL	NA	NA	NA	NA
WP_088315719.1\|3653987_3654695_-	iron-sulfur cluster repair di-iron protein	NA	NA	NA	NA
WP_000395678.1\|3654951_3655104_+	exosporium protein ExsG	NA	NA	NA	NA
WP_000830253.1\|3655320_3655530_+	hypothetical protein	NA	NA	NA	NA
WP_048528788.1\|3655625_3656465_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_071758112.1\|3657015_3658617_+	hypothetical protein	NA	NA	NA	NA
WP_128974733.1\|3658763_3659348_-	preprotein translocase	NA	NA	NA	NA
WP_048528790.1\|3659790_3660063_+	stage V sporulation protein SpoVS	A0A1J0GVV0	Streptomyces_phage	3.7e-08	44.6
WP_157409660.1\|3660310_3661450_-\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6A8	Bacillus_phage	1.0e-62	40.6
WP_000487833.1\|3661470_3661989_-	ImmA/IrrE family metallo-endopeptidase	A0A2H4JA43	uncultured_Caudovirales_phage	2.2e-25	39.3
WP_000004574.1\|3662439_3662796_-	helix-turn-helix transcriptional regulator	A0A059T669	Listeria_phage	1.8e-10	38.4
WP_000413421.1\|3662980_3663184_+	helix-turn-helix transcriptional regulator	A8ATX6	Listeria_phage	1.3e-10	49.2
WP_000022024.1\|3663580_3664096_+	helix-turn-helix transcriptional regulator	A0A290FZK9	Caldibacillus_phage	1.1e-11	24.7
WP_000151155.1\|3664126_3664348_+	hypothetical protein	NA	NA	NA	NA
WP_000834161.1\|3664529_3664814_+	hypothetical protein	D2XR42	Bacillus_phage	1.2e-25	55.3
WP_001125986.1\|3665957_3666320_+	hypothetical protein	D2XR47	Bacillus_phage	8.4e-48	75.0
WP_000511363.1\|3666391_3666583_+	DUF3954 domain-containing protein	D2XR48	Bacillus_phage	7.5e-16	68.3
WP_157409661.1\|3666650_3667061_-	DUF3992 domain-containing protein	NA	NA	NA	NA
WP_000332680.1\|3667153_3667486_-	hypothetical protein	NA	NA	NA	NA
WP_157409662.1\|3667697_3668252_+	hypothetical protein	U5PUK4	Bacillus_phage	5.6e-35	46.1
WP_167519253.1\|3668272_3668440_+	hypothetical protein	A0A068EMC2	Bacillus_phage	6.6e-24	89.1
WP_157409663.1\|3669922_3670171_+	helix-turn-helix domain-containing protein	A0A0S2MV80	Bacillus_phage	3.7e-31	82.9
WP_167519254.1\|3670192_3670363_+	hypothetical protein	G9J254	Bacillus_phage	2.6e-07	56.0
WP_167519255.1\|3671628_3671799_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	2.5e-10	78.6
WP_017673837.1\|3671827_3672310_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	1.1e-71	83.1
WP_017673838.1\|3672309_3672852_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	6.1e-87	90.0
WP_000559141.1\|3673192_3673765_+	cupin domain-containing protein	Q2I8C5	Bacillus_phage	1.0e-55	72.6
WP_157409664.1\|3673959_3675009_+	endonuclease	NA	NA	NA	NA
WP_157409665.1\|3675322_3676255_+	hypothetical protein	NA	NA	NA	NA
WP_048530288.1\|3676519_3676804_+	hypothetical protein	NA	NA	NA	NA
WP_157409666.1\|3677210_3677354_-	DUF3956 family protein	NA	NA	NA	NA
WP_157409667.1\|3677542_3678085_+\|integrase	tyrosine-type recombinase/integrase	A0A1B0T6D2	Bacillus_phage	1.4e-43	49.2
WP_000390790.1\|3678156_3678336_+	hypothetical protein	NA	NA	NA	NA
WP_157409668.1\|3679176_3680583_+\|terminase	terminase B	A0A0A8WEW2	Clostridium_phage	1.5e-169	63.9
WP_157409669.1\|3680652_3682131_+\|portal	phage portal protein	NA	NA	NA	NA
3680909:3680926	attR	NA	NA	NA	NA

DBSCAN-SWA_8

4066394 : 4120651

Bacillus_phage(61.29%)

tail,bacteriocin,transposase,tRNA,terminase,head,protease,capsid,integrase,portal

attL 4061534:4061549|attR 4105937:4105952

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
4061534:4061549	attL	NA	NA	NA	NA
WP_157409789.1\|4066394_4067948_+\|tRNA	lysine--tRNA ligase	NA	NA	NA	NA
WP_001128411.1\|4068007_4068436_-	cell wall hydrolase	NA	NA	NA	NA
WP_157409790.1\|4068581_4069496_+	acetamidase	NA	NA	NA	NA
WP_048529866.1\|4069622_4070330_+	response regulator transcription factor	NA	NA	NA	NA
WP_157409791.1\|4070326_4071310_+	sensor histidine kinase	NA	NA	NA	NA
WP_157409792.1\|4071612_4072239_-	hypothetical protein	NA	NA	NA	NA
WP_157409793.1\|4072783_4074412_+	ABC-F type ribosomal protection protein	A0A1B0RXA0	Streptococcus_phage	2.4e-54	29.2
WP_157409170.1\|4075203_4076399_-\|transposase	IS3 family transposase	A0A0N9SIX5	Staphylococcus_phage	6.9e-22	45.7
WP_157409794.1\|4076712_4077483_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.2e-32	39.9
WP_088316091.1\|4077457_4079389_+	ABC transporter permease	NA	NA	NA	NA
WP_157409795.1\|4079455_4080127_+	hypothetical protein	NA	NA	NA	NA
WP_088316087.1\|4080200_4080542_-	DUF3914 domain-containing protein	NA	NA	NA	NA
WP_157409796.1\|4080806_4082048_+	lipase	NA	NA	NA	NA
WP_048529850.1\|4082135_4083176_+	homoserine dehydrogenase	NA	NA	NA	NA
WP_048529848.1\|4083341_4084790_+	PLP-dependent aminotransferase family protein	NA	NA	NA	NA
WP_048529998.1\|4084794_4085709_+	D-alanine--D-alanine ligase	NA	NA	NA	NA
WP_048529846.1\|4086012_4086702_+	thiaminase II	NA	NA	NA	NA
WP_157409797.1\|4086949_4087267_+\|bacteriocin	heterocycloanthracin/sonorensin family bacteriocin	NA	NA	NA	NA
WP_048529842.1\|4088571_4089429_-	hypothetical protein	NA	NA	NA	NA
WP_167519248.1\|4091010_4091247_+	hypothetical protein	A0A0S2MVH2	Bacillus_phage	1.3e-12	94.3
WP_098852629.1\|4091453_4091624_+	hypothetical protein	A0A1B0T6D0	Bacillus_phage	3.8e-11	80.4
WP_157409798.1\|4091651_4092134_+	ArpU family transcriptional regulator	H0USV3	Bacillus_phage	6.1e-70	81.9
WP_098264262.1\|4092133_4092676_+\|integrase	site-specific integrase	W8CYP1	Bacillus_phage	2.3e-86	88.9
WP_157409799.1\|4092890_4093841_+	nucleoside hydrolase	NA	NA	NA	NA
WP_157409800.1\|4094649_4095819_+	serine hydrolase	A0A1D8EXR7	Mycobacterium_phage	2.1e-23	28.9
WP_157409801.1\|4096146_4097103_-	hypothetical protein	A0A0A7AR49	Bacillus_phage	1.4e-46	55.4
WP_157409802.1\|4097667_4097889_+	hypothetical protein	B5LPQ8	Bacillus_virus	2.1e-25	84.1
WP_157409803.1\|4097895_4098114_+	hypothetical protein	NA	NA	NA	NA
WP_157409804.1\|4098120_4098384_+	hydrolase	NA	NA	NA	NA
WP_157409805.1\|4098370_4098706_+	HNH endonuclease	D2XR61	Bacillus_phage	5.5e-54	92.8
WP_000301149.1\|4098827_4099139_+\|terminase	terminase	D2XR14	Bacillus_phage	3.6e-47	97.1
WP_098826703.1\|4099135_4100803_+\|terminase	terminase large subunit	D2XR15	Bacillus_phage	2.1e-311	93.7
WP_098093436.1\|4100811_4101957_+\|portal	phage portal protein	A0A2H4JAJ1	uncultured_Caudovirales_phage	4.1e-181	82.2
WP_157409806.1\|4101956_4102700_+\|protease	Clp protease ClpP	D2XR17	Bacillus_phage	6.6e-116	87.4
WP_157409807.1\|4102703_4103858_+\|capsid	phage major capsid protein	A0A2H4JHU0	uncultured_Caudovirales_phage	2.3e-200	91.1
WP_157409808.1\|4103863_4104157_+	hypothetical protein	A0A2H4JG04	uncultured_Caudovirales_phage	2.5e-42	87.6
WP_098093430.1\|4104158_4104512_+\|head	phage head closure protein	A0A2H4JGG7	uncultured_Caudovirales_phage	5.6e-57	94.0
WP_157409809.1\|4104513_4104858_+	HK97 gp10 family phage protein	D2XR21	Bacillus_phage	6.5e-50	89.3
WP_157409810.1\|4104854_4105184_+	hypothetical protein	D2XR22	Bacillus_phage	8.7e-52	91.7
WP_157409811.1\|4105184_4105778_+\|tail	phage tail protein	A0A2H4JDV4	uncultured_Caudovirales_phage	7.4e-102	92.3
WP_098093424.1\|4105782_4106139_+	hypothetical protein	A0A2H4JAG8	uncultured_Caudovirales_phage	5.7e-41	70.8
4105937:4105952	attR	NA	NA	NA	NA
WP_157409812.1\|4107835_4108093_+	hypothetical protein	A0A1B1P763	Bacillus_phage	3.7e-34	85.9
WP_157409813.1\|4108222_4109002_+	HNH endonuclease	A0A1B1P765	Bacillus_phage	2.2e-138	85.3
WP_157409814.1\|4111456_4112932_+\|tail	phage tail family protein	D2XR27	Bacillus_phage	1.1e-287	95.7
WP_157409815.1\|4112928_4118115_+	peptidase S74	D2XR28	Bacillus_phage	0.0e+00	65.8
WP_157409816.1\|4118208_4118448_+	peptidase	A0A1B1P7E0	Bacillus_phage	8.0e-31	86.1
WP_001031201.1\|4118456_4118663_+	hypothetical protein	D2XR32	Bacillus_phage	9.6e-33	98.5
WP_157409817.1\|4118662_4119457_+	N-acetylmuramoyl-L-alanine amidase	D2XR33	Bacillus_phage	1.1e-108	68.9
WP_157410267.1\|4119613_4120345_-	hypothetical protein	D2XR34	Bacillus_phage	1.1e-35	92.6
WP_157409818.1\|4120468_4120651_-	hypothetical protein	A0A1B2APY5	Phage_Wrath	4.2e-08	84.8

DBSCAN-SWA_9

5233129 : 5245067

Bacillus_phage(36.36%)

transposase,bacteriocin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048527687.1\|5233129_5233750_+	transcriptional repressor LexA	A0A1B2APZ1	Phage_Wrath	4.8e-19	62.2
WP_157410203.1\|5233834_5234641_-	DUF4097 family beta strand repeat protein	NA	NA	NA	NA
WP_048527514.1\|5234641_5235184_-	DUF1700 domain-containing protein	NA	NA	NA	NA
WP_001102620.1\|5235176_5235500_-	PadR family transcriptional regulator	NA	NA	NA	NA
WP_033690712.1\|5235871_5236102_-\|bacteriocin	bacteriocin biosynthesis protein	A0A1B1P7Q9	Bacillus_phage	8.2e-25	76.3
WP_083588213.1\|5236273_5237269_-	N-acetylmuramoyl-L-alanine amidase	A0A218KCJ1	Bacillus_phage	1.3e-77	46.9
WP_048527512.1\|5237334_5238156_-	M23 family metallopeptidase	A0A2H4J669	uncultured_Caudovirales_phage	1.6e-09	34.7
WP_071757742.1\|5238411_5239380_-	lysozyme family protein	A0A223LKM8	Bacillus_phage	1.0e-31	43.4
WP_048527510.1\|5239617_5240004_-	phage protein	A0A288WG73	Bacillus_phage	2.9e-46	70.6
WP_157410204.1\|5240404_5241274_-	DnaD domain protein	A0A2H4J394	uncultured_Caudovirales_phage	3.1e-96	58.4
WP_048527508.1\|5241426_5241621_-	hypothetical protein	A0A2H4J4V8	uncultured_Caudovirales_phage	4.1e-17	71.0
WP_048527507.1\|5242578_5242827_-	hypothetical protein	A6M975	Geobacillus_virus	3.9e-12	56.7
WP_048527506.1\|5243031_5243691_+	helix-turn-helix domain-containing protein	A0A2H4J3T7	uncultured_Caudovirales_phage	2.1e-36	41.5
WP_157409052.1\|5243910_5245067_-\|transposase	IS3 family transposase	A0A2I6AZV9	Macacine_betaherpesvirus	9.9e-34	44.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP040345

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

2. NZ_CP040346

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP040344

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection