CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046507	Mycobacterium avium subsp. avium strain DSM 44156 chromosome, complete genome	3 crisprs	DEDDh,cas3,csa3,WYL,cas4,RT,DinG	0	2	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046507_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046507_1

1819470-1819568

Orphan

Consensus_repeat	Method
CCGCTCGGGGTCGGGCCGCAACCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046507_1

>merge|NZ_CP046507|1|1819470-1819568|CRISPRCasFinder
CCGCTCGGGGTCGGGCCGCAACCGTTGGCCTGCGACCCGGGCCAATGGTGGGACCCGACGGCCAACGTGTGCCGGCCGCTGGGGGTCGGGCCGCAACCG

>NZ_CP046507|1|1|1819470-1819568|CRISPRCasFinder
CCGCTCGGGGTCGGGCCGCAACCG	TTGGCCTGCGACCCGGGCCAATGGTGGGACCCGACGGCCAACGTGTGCCGG
CCGCTGGGGGTCGGGCCGCAACCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046507.1\|WP_009976825.1\|1812586_1812907_-\|J-domain-containing-protein	unknown	unknown	gnl\|CDD\|365959
NZ_CP046507.1\|WP_009976812.1\|1819713_1820025_-\|DUF732-domain-containing-protein	unknown	unknown	gnl\|CDD\|368380
NZ_CP046507.1\|WP_023865923.1\|1811016_1812534_+\|acyltransferase	unknown	unknown	gnl\|CDD\|334202
NZ_CP046507.1\|WP_031351645.1\|1820175_1820577_-\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319943
NZ_CP046507.1\|WP_009976803.1\|1822971_1823625_+\|HD-domain-containing-protein	unknown	unknown	gnl\|CDD\|188314
NZ_CP046507.1\|WP_023880032.1\|1825613_1826498_+\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|131480
NZ_CP046507.1\|WP_003876693.1\|1821596_1822034_+\|cellulose-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|366161
NZ_CP046507.1\|WP_003876698.1\|1826518_1827106_-\|TetR/AcrR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP046507.1\|WP_009976818.1\|1816026_1817202_-\|serine-hydrolase	unknown	unknown	gnl\|CDD\|224594
NZ_CP046507.1\|WP_019732292.1\|1813751_1814132_+\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|133394
NZ_CP046507.1\|WP_009976821.1\|1814192_1814636_-\|Hsp20-family-protein	unknown	unknown	gnl\|CDD\|365807
NZ_CP046507.1\|WP_003877981.1\|1809920_1810478_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	unknown	unknown	gnl\|CDD\|223619
NZ_CP046507.1\|WP_009976824.1\|1813219_1813639_-\|Hsp20-family-protein	unknown	unknown	gnl\|CDD\|365807
NZ_CP046507.1\|WP_009976808.1\|1820530_1821373_-\|AraC-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|378964
NZ_CP046507.1\|WP_009976799.1\|1827219_1828038_+\|CoA-transferase	unknown	unknown	gnl\|CDD\|224717
NZ_CP046507.1\|WP_009976827.1\|1809111_1809873_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|235816
NZ_CP046507.1\|WP_009976801.1\|1823648_1825469_-\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|223953
NZ_CP046507.1\|WP_009976820.1\|1814800_1816030_+\|tRNA-4-thiouridine(8)-synthase-ThiI	unknown	unknown	gnl\|CDD\|234960
NZ_CP046507.1\|WP_033716479.1\|1822215_1822926_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|181044
NZ_CP046507.1\|WP_009976816.1\|1817198_1818674_-\|biotin-carboxylase	unknown	unknown	gnl\|CDD\|180605

Protein	Function_ID	Function_description	E-value
NZ_CP046507.1\|WP_009976825.1\|1812586_1812907_-\|J-domain-containing-protein	gnl\|CDD\|365959	pfam00226, DnaJ, DnaJ domain. DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature.	1.61446e-18
NZ_CP046507.1\|WP_009976812.1\|1819713_1820025_-\|DUF732-domain-containing-protein	gnl\|CDD\|368380	pfam05305, DUF732, Protein of unknown function (DUF732). This family consists of several uncharacterized Mycobacterium tuberculosis and leprae proteins of unknown function.	5.27315e-12
NZ_CP046507.1\|WP_023865923.1\|1811016_1812534_+\|acyltransferase	gnl\|CDD\|334202	pfam00668, Condensation, Condensation domain. This domain is found in many multi-domain enzymes which synthesize peptide antibiotics. This domain catalyzes a condensation reaction to form peptide bonds in non- ribosomal peptide biosynthesis. It is usually found to the carboxy side of a phosphopantetheine binding domain (pfam00550). It has been shown that mutations in the HHXXXDG motif abolish activity suggesting this is part of the active site.	1.19871e-19
NZ_CP046507.1\|WP_031351645.1\|1820175_1820577_-\|VOC-family-protein	gnl\|CDD\|319943	cd08355, TioX_like, Micromonospora sp. TioX and similar proteins. Micromonospora sp. TioX is encoded by a gene of the thiocoraline biosynthetic gene cluster. Thiocoraline is a thiodepsipeptide with potent antitumor activity. TioX may be involved in thiocoraline resistance or secretion. TioX belongs to vicinal oxygen chelate (VOC) superfamily that is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC domain is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The proteins of this family share three conserved metal binding amino acids with the type I extradiol dioxygenases, which shows no domain swapping.	1.14886e-32
NZ_CP046507.1\|WP_009976803.1\|1822971_1823625_+\|HD-domain-containing-protein	gnl\|CDD\|188314	TIGR03401, Uncharacterized_protein_YFL061W/YNL335W, HD domain protein, cyanamide hydratase family. Members of this protein family are known, so far, in the Ascomycota, a branch of the Fungi, and contain an HD domain (pfam01966), found typically in various metal-dependent phosphohydrolases. The only characterized member of this family, from the soil fungus Myrothecium verrucaria, is cyanamide hydratase (EC 4.2.1.69), a zinc-containing homohexamer that adds water to the fertilizer cyanamide (NCNH2), a nitrile compound, to produce urea (NH2-CO-NH2). Homologs are likely to be nitrile hydratases.	2.56242e-13
NZ_CP046507.1\|WP_023880032.1\|1825613_1826498_+\|alpha/beta-fold-hydrolase	gnl\|CDD\|131480	TIGR02427, b-ketoadipate_enol-lactone_hydrolase, 3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other].	3.43574e-32
NZ_CP046507.1\|WP_003876693.1\|1821596_1822034_+\|cellulose-binding-domain-containing-protein	gnl\|CDD\|366161	pfam00553, CBM_2, Cellulose binding domain. Two tryptophan residues are involved in cellulose binding. Cellulose binding domain found in bacteria.	1.7951e-36
NZ_CP046507.1\|WP_003876698.1\|1826518_1827106_-\|TetR/AcrR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	4.0985e-08
NZ_CP046507.1\|WP_009976818.1\|1816026_1817202_-\|serine-hydrolase	gnl\|CDD\|224594	COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms].	5.84916e-33
NZ_CP046507.1\|WP_019732292.1\|1813751_1814132_+\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|133394	cd04766, HTH_HspR, Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements. A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.	8.83307e-37
NZ_CP046507.1\|WP_009976821.1\|1814192_1814636_-\|Hsp20-family-protein	gnl\|CDD\|365807	pfam00011, HSP20, Hsp20/alpha crystallin family. Not only do small heat-shock-proteins occur in eukaryotes and prokaryotes but they have also now been shown to occur in cyanobacterial phages as well as their bacterial hosts.	1.00321e-29
NZ_CP046507.1\|WP_003877981.1\|1809920_1810478_-\|FKBP-type-peptidyl-prolyl-cis-trans-isomerase	gnl\|CDD\|223619	COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones].	8.29746e-24
NZ_CP046507.1\|WP_009976824.1\|1813219_1813639_-\|Hsp20-family-protein	gnl\|CDD\|365807	pfam00011, HSP20, Hsp20/alpha crystallin family. Not only do small heat-shock-proteins occur in eukaryotes and prokaryotes but they have also now been shown to occur in cyanobacterial phages as well as their bacterial hosts.	1.2009e-29
NZ_CP046507.1\|WP_009976808.1\|1820530_1821373_-\|AraC-family-transcriptional-regulator	gnl\|CDD\|378964	pfam12833, HTH_18, Helix-turn-helix domain.	2.30667e-14
NZ_CP046507.1\|WP_009976799.1\|1827219_1828038_+\|CoA-transferase	gnl\|CDD\|224717	COG1804, CaiB, Predicted acyl-CoA transferases/carnitine dehydratase [Energy production and conversion].	5.57316e-43
NZ_CP046507.1\|WP_009976827.1\|1809111_1809873_+\|SDR-family-oxidoreductase	gnl\|CDD\|235816	PRK06500, PRK06500, SDR family oxidoreductase.	8.915e-71
NZ_CP046507.1\|WP_009976801.1\|1823648_1825469_-\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|223953	COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism].	0
NZ_CP046507.1\|WP_009976820.1\|1814800_1816030_+\|tRNA-4-thiouridine(8)-synthase-ThiI	gnl\|CDD\|234960	PRK01565, PRK01565, thiamine biosynthesis protein ThiI; Provisional.	9.54649e-175
NZ_CP046507.1\|WP_033716479.1\|1822215_1822926_+\|SDR-family-oxidoreductase	gnl\|CDD\|181044	PRK07577, PRK07577, SDR family oxidoreductase.	3.62471e-139
NZ_CP046507.1\|WP_009976816.1\|1817198_1818674_-\|biotin-carboxylase	gnl\|CDD\|180605	PRK06524, PRK06524, biotin carboxylase-like protein; Validated.	0

>NZ_CP046507.1|WP_009976816.1|1817198_1818674_-|biotin-carboxylase
MTHAGEPQPRRVLNGLSDIRAFFHTNSVPLYFISPTPFNLLGIDRWIRNFFYLTYFDSFEGIHSRVFVPRRRDRIDFDSMGDVCNHLLRDPETLEFIAGRGPGGKACFVMMDEETQALARQAGLQVMHPPVELRNRLGSKTVMTRLADEAGIPSVPHVMGRAGSYQELLTLAQDAGLGDDLVVSIPYGAAGSGTFFVRGQRDWDEHAGDLTAQQEFKVMKRIRNVEVCLEGAVTRHGTVIGPAMTSLVGYPELTPHRGAWCGNDIWREVLPPGQTHAARQMVGKLGDILSREGYRGYFEVDLLHDLDSDELYLGEVNPRLSGASPMTNLTTEAYADMPLFLFHLLEYMDVDYELDIEGINARWERGYGEDEVWGQVILAETSPDVELFTATPRTGVWRIDDDGRVSFSRTANDWATLLDGSEAFYMRVAAPGDLRSEGAQLGVLVTRGHLQTDDYRLTERCQRWVKGMKAKFASTPLAPATPIVSRLVARA
>NZ_CP046507.1|WP_009976818.1|1816026_1817202_-|serine-hydrolase
MNAPAGISLDNWLSPPYARWSFQHLEDFVPTAVIARGTGPVAAIPAAPSELAEIRVAVTDGTASTVGAVMAGTATDGWAVAHRGAMIAEHYLEGMRRQTRHLLFSVSKSLVAAVVGALHGAGAIELDAPVTKYIPALANCGYAGATVRHLLDMRSGVAFSENYDDPAAQIHLLDQAVGWAPNHRPDAPATLRDFLLTLRQKSVHGGPFEYRSCETDVLGWICEVAADQPMPALMSELLWSRIGAQRDATIAVDPAGTGFFDGGISACLTDMIRFGSLFLREGVSLTGRRVLPEAWIADTLAGGPDSRRAFAASPDDNEMPGGMYRNQMWLPYPGDNVLLCLGMCGQMIYVNRAAEMVAAKVSTQPHSHEPHMLDTLSAFDAIAHRLAGRTD
>NZ_CP046507.1|WP_009976820.1|1814800_1816030_+|tRNA-4-thiouridine(8)-synthase-ThiI
MHMQCCVLLKYGEMVLKGGNRRWFEQWLLTNLDDALSAWPPEHRPAVRRRGGVLVLFTSPELQDELVALARNLIGISLVQPVWRVPRSARAAETAAVELLRDHRTQDGAPTFAVRCHRRDKRFGLSSEQLAARIGARVRADLGWRVGLSHPELELTVEVDRREIFLGTRTHPGQGGLPVGSSGRAVVLLSGGFDSPVAAYRAMRRGLACDFLHCTGAPFTDASSTYKAYALVRQLTRFQPRSRLYVAAVGRAQRTLAASGAGEAQIVAQRRLYLRLACGLAERIGAQAVVTGDSLGQVASQTLPNLAATEQAATLPVLRPMLGFDKQEILAEARRIGTAEIAMLPDQDCCQLFLPRRVATHAAVDQLLPVEARAGVDTLVGNLLDRMQRFDFGPEAADVESAATTSRVG
>NZ_CP046507.1|WP_009976821.1|1814192_1814636_-|Hsp20-family-protein
MVNMLRFDPFFRDIDHLTQQLWGAVPWGTAAQPALVPMDAWRDGEKFVVEFDLPGVLPESLDVNVEHDVLTVRAERPAIDEDRNGVVSERPRGVFSRQVYLGHGLDTDNIHADYVDGVLRLTIPVAEAAKPRKIEVAAGKHQRAINA
>NZ_CP046507.1|WP_019732292.1|1813751_1814132_+|helix-turn-helix-transcriptional-regulator
MRGDPTPRSARGVYGISVASELSGIPPQTLRHYERRGLLTPARSDGGTRRYSDDDLARLKRISQLVDQGVNLVGVARILDLESKNDQLKADYSALELLNAKLKTRQKSERAAAPRQCRGEARREAV
>NZ_CP046507.1|WP_009976824.1|1813219_1813639_-|Hsp20-family-protein
MVLMRTDPFRDLDRWTQQVLGTAARPAVMPMDAWRDGDQFVVEFDLPGVNADSLDLDVERNVLTVRAERPDLDQNREMVSAERPRGVFSRQLFLGDNLDTDKIEANYHDGVLRLTIPVAEKAKPRRIEINHNHRTAINA
>NZ_CP046507.1|WP_009976825.1|1812586_1812907_-|J-domain-containing-protein
MTNPYLVLGVSPTATQAEITRAYRRHLRAHHPDTSPPDSATESSERLSEILAAYALLRDPARRADYDREHRVHQRIRPAVTRVTRIEPADEQPPLRAGPVRWHRRY
>NZ_CP046507.1|WP_023865923.1|1811016_1812534_+|acyltransferase
MVTFGTVHNWDPGTGSVISWHATPAAREKARQAPISDVPASYQQLHHLRRFSEHAARGLDMARLNIGVWDISGVCDVAAMTEAINAHLRRHDTYHSWFEHRTDGRIVRHTFADPADIEFAALQRGEMTPTELRAHILATPNPLRWDCFTFGLVQHPDHFTFYMSADHLVIDGMSVGVIFLEIHLTYAALVSGGRPLPLPEPASYHDYCRRQHQHTEALTLQSPQVRAWIRFAQDNGGTLPSFPLPLGDPSVPCGSGVVVAPLMDESQTERFDATCTKAGARFSGGVFACAAFAEYELTGAETYCAITPYDHRSTPAEFVTPGWFASFIPVTVPVAGASFGDAVIAAQASFDSAIGLADVPFDRVLELSSFGGRISKPTGDVHMLSFADARGIPFSGQWDGLNAGIYGDGRSSDQVLMWVNRFDTETTLTVAFPQNPVARDSVERYIRAVRAMCLRVVEHGAAAVPNRRRVVAAVNASAARSTANAADRTDRRLQGAGFGANPVLR
>NZ_CP046507.1|WP_003877981.1|1809920_1810478_-|FKBP-type-peptidyl-prolyl-cis-trans-isomerase
MNSVRTFSAAAFAACFTAAAAMLAGAGTAGAADSCPTAAPPSGGTPDWTLTGTTGSVAVTGSTDTAAPVVNVTAPFSVTQTQVHTLRAGDGPAVPGTARVSVCYMGVNGRDGTVFDSSYQRGAPVDFPLGGVVPGFQKAIAGQKVGSTVAVAMTSADGYPDGQPSAGIRPGDTLVFAIKILGATT
>NZ_CP046507.1|WP_009976827.1|1809111_1809873_+|SDR-family-oxidoreductase
MGLLDRKTAVITGANSGIGLATAERFLAEGVERVFITGRRQRELEDAARQLGPRATAVRGDVGAPRDLDRLYCEVAAAGAGLDIVMANAGTTRVARLGEITDDDLDTLLGTNVKGVVYTVQKALPLLNDGASIILTGSTTADRGRAGLSIYAATKAAVRSLARAWANELAHRNIRVNVLVAGSTATPGSDRLAAQTDPYASVEEFRAGRIATIPLGRFADPVEIAHAAVFLASDLSSFCTGSTVTADGGFNQV
>NZ_CP046507.1|WP_009976812.1|1819713_1820025_-|DUF732-domain-containing-protein
MIGAALVGGAGIAAATPQDDAYLAQLRAAGLTWPPKTEEALIAEAHDVCYDLTWGWTPQQIADDLHARLDNKGVTLLDVGSLVNAAHNIYCPGNVCDAPSLCT
>NZ_CP046507.1|WP_031351645.1|1820175_1820577_-|VOC-family-protein
MTASNPTVWLTLQAHNAPKLIDYYVETFGFVLTARYGDGETVDHAQLNWPEGSGGIMLGSHKPGAEWCREPGTAGGYVVTADPDALYRRVRQHNAEIVRPLAETDYGAREFTVRDPEGNLWSFGDYGGANPPN
>NZ_CP046507.1|WP_009976808.1|1820530_1821373_-|AraC-family-transcriptional-regulator
MVGYRTLDVPEGVHRGMPSSMLTFIVSLDDGVEAADTATALPAARPTPLILGGLHLRASHVRQRRGQAGVQLAVHPLASRALFGLPSAELPVAEYDATAVLGRDIVDLHHRVAEAHRWPDVFALVAQYLIDARRRRDGATVRPEVLHAWHLLQRSRGLIPVTALADAVGVTTRHLATLFRREVGHSPKTVAMLMRFQHATGRIAESARRHGRVDLARVAADTGYSDQAHLSREFVRFAGVPPQRWLAEEFRNIQDGGHSLGSQWEHDCFESDRLVDTASP
>NZ_CP046507.1|WP_003876693.1|1821596_1822034_+|cellulose-binding-domain-containing-protein
MAGLDNHLKRCRTALHGAVSAVIVAVVAVLGLAIAPVADAAAPMATLTVEHTWQTGFIARFAITNSSTVPLSDWKLEFDMPAGQSVLHTWNSTLTQSGTHYVLTPANWNRVIAPGGSATGGFRGVLTGTYSPPTNCVLNGQYRCT
>NZ_CP046507.1|WP_033716479.1|1822215_1822926_+|SDR-family-oxidoreductase
MPSRRVLITGASRGIGRAVADRLAEGGHEPIGLARSAPKDFPGEFYEVDLADSYATAATLDKIVGHAAVHAVVNNVGFARFGRLGSIELDHLFDTYDLNVRAAVQVVQAALPGMLDAEWGRIVNVTSLTTLGTPERTPYAAAKAALEACTRIWAGELASAGITVNAVAPGPTETDMYRERSPVGSEREARFLQSIPLHRVARPREIAHAICFLLDEDAGYITGQILRVDGGGSIAA
>NZ_CP046507.1|WP_009976803.1|1822971_1823625_+|HD-domain-containing-protein
MTTTSSIETIADIAIPDTALVREITEFIRDAEDDLLFHHSRRVFLFGALQGRRRGLQPDLELLYAGAMFHDLGLTERYRDSALRFEVDGANAAREFLLHRGVSKADADKVWLGIALHTTPGVPEFLDPEIALVTAGVETDVVGVGCDDLAPEALAAVVAAHPRPDFKTRILQAFNDGMKHRPHSTFGTMNADVLEHFDPTFARDNFVDLILNNGWPE
>NZ_CP046507.1|WP_009976801.1|1823648_1825469_-|long-chain-fatty-acid--CoA-ligase
MTHAPASRPTTLCEAFQATAAKHPDAVALRTLGDATTITWRQYRDRVRAIAAGLAGLGVGNGDTVALMMSNRPEFHLCDTAVLHTGATPFSVYNTNPPELLAYQFDNADNHVVICEGTFLPQVLAAAQQGGTVEHVVCVDGAANGAIGLGQLEASPAADFDFERSWRAVGPDDVLTIVYTSGTTGPPKGVELTHTNFIENARITEEVGGITHADRAVSYLPDAHAANRWITHYQNLLYGLQITTVGDFKAVLPALTEVRPTLFLGVPRVWIKAKAGLEAAVDAEPAGKRALAKWAFGVGRARARAVSDGRPVGLAEKLRYAFADRLVLSKVRRRLGMDRLRIGVTGAAPIPREVHEFVLGLGIPVCEGYGMTECTAGATVNRPERIKIGTVGTPVPGTEVTVASDGEVLVRGKNVMRGYRKAPEKTAEAIDSDGWLHTGDIGEIDEDGYLRIVDRKKELIINAAGKNMSPTNIENTIAASCPLAGPVVVIGDARAYNTALITLDPDSVTEYAHAHGLSGSLRELVRNPAVRAEIEKGMAAANRRLSRVEQIKRYTVLADVWEPGSQYLTPTAKLKRKPIATGYAAQIDAMYTEQGKRSAGHSAASD
>NZ_CP046507.1|WP_023880032.1|1825613_1826498_+|alpha/beta-fold-hydrolase
MFREPRVAYDATTVATHDGAQLHVRSYGSAFGQPIVLIHGFGCRIEYWNPQINALAAKYRVIAYDQRGLGRSTLGSDGVRPDVLGRDLAAVLDAVLAPGERAVLVGHSFGGITIMAWAQRFAAHAVSAVLLANTIAERFSATTMLLPFADRYRHIRRPLITALAGSTMTLPSIRWSRWPLQRMALSRYADRQAVDFVYEILADCRTDVRAVWGAGLSGLDVTAGLEKLTVPTTVVTGTEDRLTPPAVAHRIAEALQVRGSLHRFARFPRAGHCTNIEVPYAFNAEIEQLADATR
>NZ_CP046507.1|WP_003876698.1|1826518_1827106_-|TetR/AcrR-family-transcriptional-regulator
MTNPRATNEDLTAKARIRNAALDLYAQYGEDRISLRDIASAAGVTLGLVQHHFKTKAGVRDAVDQLVVDYFAHALAQVPAEGSARHVAAARDEAVARMLRDNPPVVNYVRRAVLDPSEDRLHLLDALIELTRREITALRGSGMASTKRPESTQILGVLIRQMGELLLQPMVDAVWDRVAKPTDARKPRLRITVEN
>NZ_CP046507.1|WP_009976799.1|1827219_1828038_+|CoA-transferase
MQPLIGVTVVSLAVNLPGPLAAARLAELGAAVTKVEPATEDPLAAAAPDWYARLIEHQNVLTLDLKDTGDRAKLDELLAGADLLITSMRPSALHRSGLARPQQKFPRLSLIEIVGHHGERAETPGHDLNYQAAQGTLTPPHMPKVPIADVLGAERAVSSALAALLQAAKAGAGQRYRVVLEEAAARAGDAVRYGLMGEGAVLGGAYPGYGIYASADGYVALGAIEPHFFARTCQVFGADGSHESLGAAFAAKTTAELEDLARHMDIPLNEVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046507_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046507_2

3053727-3053810

Orphan

Consensus_repeat	Method
CGGCCGGCGCCCGAGTTGTCGGCCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046507_2

>merge|NZ_CP046507|2|3053727-3053810|CRISPRCasFinder
CGGCCGGCGCCCGAGTTGTCGGCCGGCGCCCGAGTTGTCGGCCGGCGCCCGAGTTGTGTCGGCCGGCGCCCGAGTTGTCGGCCG

>NZ_CP046507|2|2|3053727-3053810|CRISPRCasFinder
CGGCCGGCGCCCGAGTTGTCGGCCG	GCGCCCGAGTTGTCGGCCGGCGCCCGAGTTGTGT
CGGCCGGCGCCCGAGTTGTCGGCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046507.1\|WP_009975672.1\|3053874_3054366_-\|carbonic-anhydrase	unknown	unknown	gnl\|CDD\|239474
NZ_CP046507.1\|WP_023879807.1\|3045271_3047017_+\|NAD-binding-protein	unknown	unknown	gnl\|CDD\|367001
NZ_CP046507.1\|WP_009975681.1\|3047975_3048854_-\|LLM-class-flavin-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|366009
NZ_CP046507.1\|WP_024636893.1\|3055536_3056412_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224094
NZ_CP046507.1\|WP_009975670.1\|3054514_3055489_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223674
NZ_CP046507.1\|WP_009975685.1\|3044806_3045178_+\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|238404
NZ_CP046507.1\|WP_080555769.1\|3065250_3066663_-\|IS110-family-transposase	unknown	unknown	gnl\|CDD\|376773
NZ_CP046507.1\|WP_009975676.1\|3050321_3052172_-\|adenylyl-sulfate-kinase	unknown	unknown	gnl\|CDD\|180120
NZ_CP046507.1\|WP_011724138.1\|3059917_3061162_-\|alpha/beta-fold-hydrolase	unknown	unknown	gnl\|CDD\|366166
NZ_CP046507.1\|WP_003877279.1\|3049385_3049781_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319939
NZ_CP046507.1\|WP_009975682.1\|3047041_3047914_-\|tetratricopeptide-repeat-protein	unknown	unknown	unknown
NZ_CP046507.1\|WP_009975679.1\|3048920_3049334_+\|VOC-family-protein	unknown	unknown	gnl\|CDD\|319898
NZ_CP046507.1\|WP_009975665.1\|3058254_3059931_+\|ABC-transporter-family-substrate-binding-protein	unknown	unknown	gnl\|CDD\|173866
NZ_CP046507.1\|WP_044088653.1\|3044177_3044747_-\|NUDIX-hydrolase	unknown	unknown	gnl\|CDD\|239516
NZ_CP046507.1\|WP_023879803.1\|3056408_3058244_+\|ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|182342
NZ_CP046507.1\|WP_121035666.1\|3066903_3068322_+\|HNH-endonuclease	unknown	unknown	gnl\|CDD\|367155
NZ_CP046507.1\|WP_009975678.1\|3049777_3050263_-\|RrF2-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|273242
NZ_CP046507.1\|WP_003875596.1\|3052171_3053101_-\|sulfate-adenylyltransferase-subunit-CysD	unknown	unknown	gnl\|CDD\|235375
NZ_CP046507.1\|WP_009975661.1\|3063852_3065004_-\|exonuclease-SbcCD-subunit-D	unknown	unknown	gnl\|CDD\|223497
NZ_CP046507.1\|WP_009975663.1\|3061225_3063856_-\|AAA-family-ATPase	unknown	unknown	gnl\|CDD\|227061

Protein	Function_ID	Function_description	E-value
NZ_CP046507.1\|WP_009975665.1\|3058254_3059931_+\|ABC-transporter-family-substrate-binding-protein	gnl\|CDD\|173866	cd08501, PBP2_Lpqw, The substrate-binding domain of mycobacterial lipoprotein Lpqw contains type 2 periplasmic binding fold. LpqW is one of key players in synthesis and transport of the unique components of the mycobacterial cell wall which is a complex structure rich in two related lipoglycans, the phosphatidylinositol mannosides (PIMs) and lipoarabinomannans (LAMs). Lpqw is a highly conserved lipoprotein that transport intermediates from a pathway for mature PIMs production into a pathway for LAMs biosynthesis, thus controlling the relative abundance of these two essential components of cell wall. LpqW is thought to have been adapted by the cell-wall biosynthesis machinery of mycobacteria and other closely related pathogens, evolving to play an important role in PIMs/LAMs biosynthesis. Most of periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the LpqW protein. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis. Besides transport proteins, the PBP2 superfamily includes the ligand-binding domains from ionotropic glutamate receptors, LysR-type transcriptional regulators, and unorthodox sensor proteins involved in signal transduction.	5.07776e-162
NZ_CP046507.1\|WP_023879807.1\|3045271_3047017_+\|NAD-binding-protein	gnl\|CDD\|367001	pfam02254, TrkA_N, TrkA-N domain. This domain is found in a wide variety of proteins. These protein include potassium channels, phosphoesterases, and various other transporters. This domain binds to NAD.	5.22298e-19
NZ_CP046507.1\|WP_009975681.1\|3047975_3048854_-\|LLM-class-flavin-dependent-oxidoreductase	gnl\|CDD\|366009	pfam00296, Bac_luciferase, Luciferase-like monooxygenase.	3.19761e-32
NZ_CP046507.1\|WP_009975670.1\|3054514_3055489_+\|ABC-transporter-permease	gnl\|CDD\|223674	COG0601, DppB, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	9.98974e-98
NZ_CP046507.1\|WP_009975679.1\|3048920_3049334_+\|VOC-family-protein	gnl\|CDD\|319898	cd06587, VOC, vicinal oxygen chelate (VOC) family. The vicinal oxygen chelate (VOC) superfamily is composed of structurally related proteins with paired beta.alpha.beta.beta.beta motifs that provide a metal coordination environment with two or three open or readily accessible coordination sites to promote direct electrophilic participation of the metal ion in catalysis. VOC is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). Type I extradiol dioxygenases catalyze the incorporation of both atoms of molecular oxygen into aromatic substrates, which results in the cleavage of aromatic rings. They are key enzymes in the degradation of aromatic compounds. Type I extradiol dioxygenases include class I and class II enzymes. Class I and II enzymes show sequence similarity; the two-domain class II enzymes evolved from a class I enzyme through gene duplication. Glyoxylase I catalyzes the glutathione-dependent inactivation of toxic methylglyoxal, requiring zinc or nickel ions for activity. The antibiotic resistance proteins in this family use a variety of mechanisms to block the function of antibiotics. Bleomycin resistance protein (BLMA) sequesters bleomycin's activity by directly binding to it. Whereas, three types of fosfomycin resistance proteins employ different mechanisms to render fosfomycin inactive by modifying the fosfomycin molecule. Although the proteins in this superfamily are functionally distinct, their structures are similar. The difference among the three dimensional structures of the three types of proteins in this superfamily is interesting from an evolutionary perspective. Both glyoxalase I and BLMA show domain swapping between subunits. However, there is no domain swapping for type 1 extradiol dioxygenases.	1.10594e-13
NZ_CP046507.1\|WP_009975685.1\|3044806_3045178_+\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|238404	cd00781, ketosteroid_isomerase, ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon. Ketosteroid isomerases are important members of this class of enzymes which are the most proficient of all enzymes known and have served as a paradigm for enzymatic enolizations since its discovery in 1954. This CD includes members of this class that calalyze the isomerization of various beta,gamma-unsaturated isomers at nearly a diffusion-controlled rate. These enzymes are widely distributed in bacteria.	5.24107e-32
NZ_CP046507.1\|WP_080555769.1\|3065250_3066663_-\|IS110-family-transposase	gnl\|CDD\|376773	pfam02371, Transposase_20, Transposase IS116/IS110/IS902 family. Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. This region is often found with pfam01548. The exact function of this region is uncertain. This family contains a HHH motif suggesting a DNA-binding function.	8.54636e-20
NZ_CP046507.1\|WP_009975676.1\|3050321_3052172_-\|adenylyl-sulfate-kinase	gnl\|CDD\|180120	PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional.	0
NZ_CP046507.1\|WP_011724138.1\|3059917_3061162_-\|alpha/beta-fold-hydrolase	gnl\|CDD\|366166	pfam00561, Abhydrolase_1, alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.	1.18804e-13
NZ_CP046507.1\|WP_003877279.1\|3049385_3049781_+\|VOC-family-protein	gnl\|CDD\|319939	cd08351, ChaP_like, ChaP, an enzyme involved in the biosynthesis of the antitumor agent chartreusin (cha), and similar proteins. ChaP is an enzyme involved in the biosynthesis of the potent antitumor agent chartreusin (cha). Cha is an aromatic polyketide glycoside produced by Streptomyces chartreusis. ChaP may play a role as a meta-cleavage dioxygenase in the oxidative rearrangement of the anthracyclic polyketide. ChaP belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases.	1.75777e-66
NZ_CP046507.1\|WP_009975672.1\|3053874_3054366_-\|carbonic-anhydrase	gnl\|CDD\|239474	cd03379, beta_CA_cladeD, Carbonic anhydrases (CA) are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism in which the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide is followed by the regeneration of an active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. CAs are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionarily distinct families of CAs (the alpha-, beta-, and gamma-CAs) which show no significant sequence identity or structural similarity. Within the beta-CA family there are four evolutionarily distinct clades (A through D). The beta-CAs are multimeric enzymes (forming dimers,tetramers,hexamers and octamers) which are present in higher plants, algae, fungi, archaea and prokaryotes.	5.57609e-66
NZ_CP046507.1\|WP_121035666.1\|3066903_3068322_+\|HNH-endonuclease	gnl\|CDD\|367155	pfam02720, DUF222, Domain of unknown function (DUF222). This family is often found associated to the N-terminus of the HNH endonuclease domain pfam01844. The function of this domain is uncertain. This family has been called the 13E12 repeat family.	2.64762e-93
NZ_CP046507.1\|WP_044088653.1\|3044177_3044747_-\|NUDIX-hydrolase	gnl\|CDD\|239516	cd03424, ADPRase_NUDT5, ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate. Like other members of the Nudix hydrolase superfamily, it requires a divalent cation, such as Mg2+, for its activity. It also contains a highly conserved 23-residue Nudix motif (GX5EX7REUXEEXGU, where U = I, L or V) which functions as a metal binding site/catalytic site. In addition to the Nudix motif, there are additional conserved amino acid residues, distal from the signature sequence, that correlate with substrate specificity. In humans, there are four distinct ADPRase activities, three putative cytosolic enzymes (ADPRase-I, -II, and -Mn) and a single mitochondrial enzyme (ADPRase-m). Human ADPRase-II is also referred to as NUDT5. It lacks the N-terminal target sequence unique to mitochondrial ADPRase. The different cytosolic types are distinguished by their specificities for substrate and specific requirement for metal ions. NUDT5 forms a homodimer.	5.18078e-36
NZ_CP046507.1\|WP_023879803.1\|3056408_3058244_+\|ABC-transporter-ATP-binding-protein	gnl\|CDD\|182342	PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional.	1.49388e-169
NZ_CP046507.1\|WP_024636893.1\|3055536_3056412_+\|ABC-transporter-permease	gnl\|CDD\|224094	COG1173, DppC, ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism].	2.57881e-85
NZ_CP046507.1\|WP_009975678.1\|3049777_3050263_-\|RrF2-family-transcriptional-regulator	gnl\|CDD\|273242	TIGR00738, Putative_HTH-type_transcriptional_regulator, Rrf2 family protein. This model represents a superfamily of probable transcriptional regulators. One member, RRF2 of Desulfovibrio vulgaris is an apparent regulatory protein experimentally (MEDLINE:97293189). The N-terminal region appears related to the DNA-binding biotin repressor region of the BirA bifunctional according to results after three rounds of PSI-BLAST with a fairly high stringency. [Unknown function, General].	4.4521e-50
NZ_CP046507.1\|WP_003875596.1\|3052171_3053101_-\|sulfate-adenylyltransferase-subunit-CysD	gnl\|CDD\|235375	PRK05253, PRK05253, sulfate adenylyltransferase subunit CysD.	0
NZ_CP046507.1\|WP_009975661.1\|3063852_3065004_-\|exonuclease-SbcCD-subunit-D	gnl\|CDD\|223497	COG0420, SbcD, DNA repair exonuclease [DNA replication, recombination, and repair].	4.49131e-63
NZ_CP046507.1\|WP_009975663.1\|3061225_3063856_-\|AAA-family-ATPase	gnl\|CDD\|227061	COG4717, COG4717, Uncharacterized conserved protein [Function unknown].	1.93303e-09

>NZ_CP046507.1|WP_003875596.1|3052171_3053101_-|sulfate-adenylyltransferase-subunit-CysD
MTADLQTAPAAGQYELSHLRSLEAEAIHIIREVAAEFERPVLLFSGGKDSIVMLHLALRAFRPGRLPFPVMHVDTGHNFDEVIATRDELVKQHGLRLVVASVQDDIDAGRVVEPKQGRNPIQTVTLLRAIRENKFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSNWTEFDIWSYIGAENIALPSIYYAHRRKVFRRDGMLLAVDRNMQPNPDEPVFEATVRFRTVGDVTCTGCVESQAATVDEVIAETAVSRLTERGATRADDRISEAGMEDRKRQGYF
>NZ_CP046507.1|WP_009975676.1|3050321_3052172_-|adenylyl-sulfate-kinase
MAAPTTLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWAAVEQTSKDRGHDYTDLALVTDGLRAEREQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMVTGASTAQLVIVLVDARHGLLEQSRRHAFLASLLGIQHIVLAVNKMDLIGWDREKFESIRDEFHAFAARLDVHDVATIPISALHGDNVVTKSDQTPWYEGPALLSHLEEVYIAGDRNLVDVRFPVQYVIRPHTHEHQDHRSYAGTVASGVMRPGDEVVVLPVGKRTRITAIEGPNGPVQEAFPPMAVSLTLADEIDISRGDLIARTHNQPRIAQDFDATVCWMADNTTLEPGRDYVIKHTTRTTHARVTGLDYRLDVNTLHRDKTATALKLNELGRISLRTQVPLLLDEYTRNPSTGSFILIDPHTNGTVAAGMVLRDASAQAASPNTVRHKSSAIAAARPRGKTVWFTGLSGSGKSSVAMLVEQKLLEKGAQAYVLDGDNLRHGLNADLGFSMADRAENLRRLAHVAALLADCGNVVLVPAISPLAEQRELARKVHADAGFDFIEVFCDTPIEECEKRDPKGLYAKARAGEITQFTGIDSPYQPPAKPDLRLTPDGTVEEQAQRVIDLLESRG
>NZ_CP046507.1|WP_009975678.1|3049777_3050263_-|RrF2-family-transcriptional-regulator
MRMSAKAEYAVRAMIQLATVPDGTLVKTDDLAQAQGIPPQFLVDILTNLRTDRLVRSHRGREGGYELARPGKDISIADVLRCIDGPLASVRDIGLGDLPYSGPTAALTDVWRALRASMRLVLEETTLADVATGSLPKHVAQLADDYRKQESQRHGTARTGD
>NZ_CP046507.1|WP_003877279.1|3049385_3049781_+|VOC-family-protein
MTISFNHTIVASRDKRESAEFLAELFDLPGPKPFGHFMVVELDHGASLDYADAPDGADIPRQHYAFLVSEQEFDTIYGKIRARGLEHWADPGARRPGEINHNDGGRGVYFLDPSGHAMEILTRPYGSGAAN
>NZ_CP046507.1|WP_009975679.1|3048920_3049334_+|VOC-family-protein
MGLTNTSIAHVRLTVTDIEQSRRFYESVFGWPVLLEVPDNADASTREQLSFLFGGVIYDLGGTLLGLRPVATDRFDEDRTGLDHIAFRLDSRDELDAAAAHLDELGVAHEPVKDIGPAYILQFRDPDNIALELTAPK
>NZ_CP046507.1|WP_009975681.1|3047975_3048854_-|LLM-class-flavin-dependent-oxidoreductase
MTMPVMEPDLDATVLETWARTIDEGPFSSLCWGERIAFDNPDSLTLLGALAAWTERVRLLTTVIVPQLHDPVLLAKGLATGDLLSGGRLSVGIGVGGRQEDYHAVGADPATQTMRGMAERVAVMKRVWAGEKLTESVLPVGPAPVQPGGPPLFVGSIGPKTIRSAAAWADGLAGTTLDLDVAKQRELFDVTRDAWARAGKPAPHLITSFWFAFGSPRTAREQVHRHLRRYMNWIPADYVDAMAPMTGWAGDEDELAEVLRKFAGIGADEVQLIPTSSDVGQLRRAADVAARL
>NZ_CP046507.1|WP_009975682.1|3047041_3047914_-|tetratricopeptide-repeat-protein
MTQQELPAPLAELTGLLTECTNKGDFVGAARQAGELVTLCRATLGERHPTALELKVSLATLRLRAGECAVAYEEFERLIPDLVEVLGPDHLSTLTARHLLASRQQAALSSLAEWSQLFADEQRVWGADHENTLVAREKIAEKRWEIGDFVGAMAEGEQVLAARRRVLGADHTDTLGTQLMLSIWRGRAGDVPAAVAELEPLIGELREKLGDDHAHVLMARHMFTLWAPERAGVTDAVAAWEALVEEESRVLGDEHPVTLAARQELAGWCARRDGQAGGAGAQGSLDWSAS
>NZ_CP046507.1|WP_023879807.1|3045271_3047017_+|NAD-binding-protein
MRDDSPRMSPRRHIIVSGDDVLATTIAEELNRAGATIVKLPSEELAGADLARASAIVCAGRDDAKNLEIALLARKTNPHVRVVARLGNDVLRGAVAADNGPGAILDVADLAAPSVVEACLSSSTHPVRAAGIDFLVSGAEAPRDATLREIYGDLAPVAVIHGNDGATPGEVVPCPGRDHRVRAGDWTAMIGSADELAARGIRTPRPPATRSRQTWLRRVLDAARAMRDDVNPMLFPAILLALTLLLVSTVIVHFSYTKPRLSWLDALYFTAETITTVGYGEFTFAHQSAWLRIFAVGLMFAGVTTTALLVAFLADLLLSRRFLQSAGLRRARHLRNHIIVVGQGSFGSRVVADLTAAGYDVAVIERDENNRFLSTAAELDVPVIFGDATLRQTLESARVDRARAVAVLTQDDMVNIEIGIVLREMLGPRVMPEVNRPDVPIVLRIYDRTLGDAVAKRFGFENVRSTVDLAAPWFIGTAMGLQVLGTFSVGQRSFMVGAMHVAAGSELDGLRMFEMSTQTRVIAITRRDTPVELHPRRDAWLRAGDTVYLVGPYRELLETLRKGQPPQQPANEERPADKATT
>NZ_CP046507.1|WP_009975685.1|3044806_3045178_+|nuclear-transport-factor-2-family-protein
MPSAEAITDTVNRYLALVATGTADDIVTLYAADATIEDPIGADIRRGHDAIRAFYAGFQDAKKDTELAELRVSGSEAAFLWHLTLDAGDTRTRISPISTMSFDEDAKITAMRAFWSPTDVQVL
>NZ_CP046507.1|WP_044088653.1|3044177_3044747_-|NUDIX-hydrolase
MTFIERLASREIYRNPWMVLREDDIRRPDGSAGIYSVVDKPSYALVMPYDGRRFGLVEQFRYPIGERRWEFPQGTAPELADADPVELARRELREETGLRATTFESLGRLDVAPGMSSQRGWVFLATGIVEGEADREHEEQDMRSAWFSRDDVEQMIRTGVIADAQSIAAYGLFLLRPESTGAPVTDQGQ
>NZ_CP046507.1|WP_009975672.1|3053874_3054366_-|carbonic-anhydrase
MAVTDDYLAHNAGYARSFEGPLPMPPSKHVAVVACMDARLDVYRILGLREGEAHVIRNAGGVITDDVVRSLAISQRLLGTREIILIHHTDCGMLTFTDDDFKRGIQEETGIKPPWAAEAFADLAEDVRQSLRRIEANPFVTKHVSARGFVFDVATGKLDEVKP
>NZ_CP046507.1|WP_009975670.1|3054514_3055489_+|ABC-transporter-permease
MTRFLARRLLNYLVLLALASFLTFCLTSVAFKPLDSLLQRSPRPPQAVIDAKAHSLGLDEPIPIRYAHWASHAVRGDFGKTVTGQPVGASLGRRVGVTLRLLVIGSLIGTVAGIAAGAWGAIRQYRLSDRVVTMLALLVLSTPTFVIASLLILAALRVNWALGVQVFDYTGETSPGVTGGAAALLDRLRHLVLPSLTLALAAAAGYSRYQRNAMLDVLGQDFIRTARAKGLTRRRALVKHGLRTALIPLATLFAYGVAGLVTGAVFVEKIFGWHGMGEWLVQGVATQDTNIVAAITLFSGAVVLLAGLLSDVFYAALDPRVRVS
>NZ_CP046507.1|WP_024636893.1|3055536_3056412_+|ABC-transporter-permease
MAGFASRRTLVLRRFGRNRLAVTSLTLLVLLFVGCYTLPAVLPYSYQDLDFDALLQPPNARHWLGTNALGQDLLAQILRGMQKSMLIGVCVAVISTGIAATVGSIAGYFGGWRDRVLMWLVDLLLVVPSFILIAIVTPRTKNSANILMLVLLLAGFGWMVSSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNVASILIIDAALNVASAILAETGLSFLGFGVQPPDVSLGTLIANGTQSATTFPWVFLFPAGVLVLILVCANLTGDGLRDALDPGSGPARGGRR
>NZ_CP046507.1|WP_023879803.1|3056408_3058244_+|ABC-transporter-ATP-binding-protein
MSPLLQVTDLAVTFPAGDAPVTAVRGISYRIEPGEVVAMVGESGSGKSVSAMAVMGLLPEHARVRGSVRLHDTELLGLGDDAMSRLRGRAVGMVFQDPMSALTPVYTVGDQIAEAITIHQPRVGRKAARDRAVELLELVGIAQPQRRARAFPHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILEVLKTARDITGAGVLIITHDLGVVAELADRALVMYAGRVVESAAVASLYRDRRMPYTVGLLGSVPRLDAAQGTRLVPIPGAPPSLAGLDPGCPFAPRCPLAIDECRSQEPELLPVGPDHRAACIRTDQVDGRSAADIYGVRTQPHPGEPANSPVLVRVRELSKTYRLTKGVLRRSAGEVRAVDRISFQLRQGRTLGIVGESGSGKSTTLHEILELVAPQSGSIEVLGTDVAALSPASRRSLRRDIQVVFQDPVASLDPRLPVFELLAEPLRANGFDKDHTNARVAELLETVGLRRADAARYPAEFSGGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIINLLLDLQAQFQLSYLFVSHDLSVVKHLAHDVAVMYAGSIVEQGDSSQVFGNPQHEYTRRLLDAVPQPNPGSRG
>NZ_CP046507.1|WP_009975665.1|3058254_3059931_+|ABC-transporter-family-substrate-binding-protein
MGRCGFRPAALVAAVVLAVAGCSPAINLVPETGQNARIGTTSDINPRDPATLQDGGNLRLALTDFPPNFNILHIDGNSADVSAMMKATLPRAFVIGPDGSTTVDTDYFTSVELTGTAPQVVTYTINPKAVWSDGTPITWEDIASQIHALSGADKTFEIAGSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPKSMTATPEAFNKGQLEGPGPSAGPFIVSSLDRTTQRIVLSRNPKWWGTRPRLDSITYLVLDDAARLPALQNNTIDATGVGTLDQLTIAEHTAGISIRRAPAPAWSHFTFNGAPGSILADRALRVAVSKGIDRQTIAKVVQYGLTSNPVALGNHIYVAGQQGYQDNSTTVPYDPAAAGRELDALGWKLHGRFREKDGRQLVIRDLFYDAQGSRQFAQIAQHSLAQIGVRLELVARAGSGFFTNYINVGAFDMAQFGWLGDAFPLSALTQIYKSDGESNFGKIGSPQIDAAIERTLQELDPDKARALANDLDKLIWAEGFSLPLTQSPGDVAVRSTLANFGAAGLGDLNYTAIGFTRS
>NZ_CP046507.1|WP_011724138.1|3059917_3061162_-|alpha/beta-fold-hydrolase
MTMNAKRRRMQQRLAKLPGVRAVRRPISPDTADEFDLYYVRAGRKSRHPVVIIPGGPGVASVQMYKGLRRRAAAAGLDVIMIEHRGVGMSRHDDAGADLPPEAMTVNQVVDDVAAVLDDARVDSAVVYGASYGTYIASGVGVRHPARVHGMVLDSPLLSRHDIVIVRRAIRRLLLRGDSPETASLAPKMRKLVDAGLMTATATQVVATIYGYGGARLLERQLDLLLDGRKLLWWTLSRFTTLRNLPFRYEEDLVSRIALRELDYAAEPDGLPLDPAVAEREVRTQTATFEDEPYDLPAEMPSFDWPTAVVSGGRDLITPPAVAERVASLLPHAVLLSLPDMAHSALDFHEAVALASADAVLRGDLAGLAARACTLNALPPRPEVRLLWALIAAAAMIEGALPIPAPLRRRLSCG
>NZ_CP046507.1|WP_009975663.1|3061225_3063856_-|AAA-family-ATPase
MKLHRLTLTNYRGIAHREIEFPDHGVVVVCGANEIGKSSMIEALDLLLEAKDRSTKKEVKQVKPTHSDVGAEVSAEISCGPYRFVYRKRFHKKCETELTVITPYREQLTGDEAHERVRAMLAETVDSDLWHAQRVLQAASTAAVDLSGCDALSRALDVAAGDSGGLCGTEPLLIERIDAEYARYFTPTGRPTGEWAAAIARLADAEAAVAECAAAVAEVDERVSRHAALTEQVADLSQRRIAAGPRVTAARQAADRIAELTAQRREAQLVAEAAAATKAAAAQAHSGRLQLLADIDSRAAAVTQTQAQVQQAAADHAAARADAQACDTALQHATEALAELERRVQEAQRTVERLAGREEADRLAARLDKIDAIQRDRERISAELSTIAVTEELLRRIEDAAAAVDRIGDQLASTSAAVEFTAVADIHLVIGDRQVSLPAGQSWSITAVGPTAVEVPGVLTARVIPGATTLDVQAKHAAAQQELAAALMAGAVADLAAARSADQRRRELQGTRDQLGATLAGLCGDEPHDELRSRLARLRAEHPEQPAEPTGGAADLAAARTELETLAQARACASAECDTHRQAATAAAARLAETATAATVLQNRLDTLRAELDAATGRLAAERASVGDEELAASADAALRAEQAAERRVAELADALAAASPDSVAAELADATQESESLRERYEEAAGALREVTIELSVFGSEGRQGKLDAAETEREHAASEHSQVGRRARAAQLLRSVMTRHRDTTRQRYVEPYRAELQRLGRPVFGPTFEVDIDSDLCIRSRTLNGITVPYESLSGGAKEQLGILARLAGAALVAKEDAVPVVVDDALGFTDPDRLAKMGQLFDSVGSHGQVIVLTCSPDRYDGVKGAHRIDLSA
>NZ_CP046507.1|WP_009975661.1|3063852_3065004_-|exonuclease-SbcCD-subunit-D
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVVVSGDVFEHNQLPPKVVGQSLEAMRAIGIPVYLLPGNHDPLDASSVYTGALFTAERPHNVTVLDRAGVHQVRPGLQLVAAPWRSKVPTTDLVGEVLDGLPETDDTRILVGHGGVDVLDPDRDKPSLIRLAKLEDALTRGAVHYVALGDKHSLTQVGSSGRVWYSGSPEVTNFDDVEADPGHVLIVDIDEADPRRPVSVTARRIGCWRFVTLHRQVDSSRDIADLDMNLDLMTNKDRTVVRLALTGSLTVTDRAALDACLDKYARLFAHLRTWDSHTELAVIPADGEFSDLGIGGFAAAAVEELVATARQQDSDTAADAQGALALLLRLADRGAA
>NZ_CP046507.1|WP_080555769.1|3065250_3066663_-|IS110-family-transposase
MCVELILGIDVACRAAHQASLARPDGTYVWTGRKFFTRPADLEKLWKVIGLSEQDTVRVVMEPTRNAWVPLASWFRHHGARISMVPTTQSADLRAYYSKHTKNDHLDSKLLARLPLLHPEGLRDHSGDGPGEPLRRLVKIRSSIVKRRTAVFQRLDAQLELLGPAWYDALGSNYGKAALALLARYADPHSLIRLGHARLTRFLIRHSRGAWREPHATLLLTAAQESLQLWGSGANARIDFAELAADIATEAEQAQMLTEQIDDLDERAANLYAEADPRGIIASAPGVGPVTCAVIAGRIGDPHRFHSLAAIRAYSGLVPKVNQSGQAEQRHGLTKAGDPLLREALFAAADQARKSDPQLAAKYKRLMSTERHHDSAICHIATILLTRIATCWRAGAHYVLRDTDGRPITFEEGRRIVRAHHTVDKKTRINAASKRYSQRQKGRTGREQQESLRAPIHRPVHPSIKPTEVA
>NZ_CP046507.1|WP_121035666.1|3066903_3068322_+|HNH-endonuclease
MSSGSIIDRDAISAAFDALDAALDGVAALGFDGLTPRECLALLGRCEKARRRLPVAEHQLINLVARQASPAELGGRLSHAIAEATLISRAEAARRVHTAADLSPRVGLTGEPLPPLLAATAARQREGSLGPEQVAVIRKFCHQLPGWIDQATRERAETDLAREGTRYRPEHLAALAGTLADCLNPDGLYRDEDRARRRSLTLGNQHADGMSELRGLLTPELRATLEAVLAKLAAPGMCNPLDENPCVDGTPTEQAIDDDARSAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTLADLQAAAGRGLTGGGTLLPMSDVIRLSRHAHHYLAIFDHGKALALYHTKRLASPAQRIVLYAKDRGCTAPGCTVPGYYAEVHHCTDYATCHTTNINDLTFACGPHHRLLQPGAWTTHKNTRGETQWLPPPHLDRNQPRTNTFHHPEKLLQGEDDEDEADGEQEADQGDDHAA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046507_3

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046507_3

4726448-4726524

Orphan

Consensus_repeat	Method
GCGCGCCCATGGCGCTCGTCGCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046507_3

>merge|NZ_CP046507|3|4726448-4726524|CRISPRCasFinder
GCGCGCCCATGGCGCTCGTCGCGCCCCTCAGGGGCCGACGGTTCGGCTTGCTCCTCGCGCCCATGGCGCTCGTCGCG

>NZ_CP046507|3|3|4726448-4726524|CRISPRCasFinder
GCGCGCCCATGGCGCTCGTCGCG	CCCCTCAGGGGCCGACGGTTCGGCTTGCTCC
TCGCGCCCATGGCGCTCGTCGCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046507.1\|WP_003874130.1\|4729700_4730741_-\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP046507.1\|WP_003874164.1\|4732918_4733734_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP046507.1\|WP_009979734.1\|4723081_4723783_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046507.1\|WP_009979731.1\|4720840_4721596_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|237030
NZ_CP046507.1\|WP_156649255.1\|4730737_4732042_-\|MCE-family-protein	unknown	unknown	gnl\|CDD\|378749
NZ_CP046507.1\|WP_033721277.1\|4737473_4738586_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	unknown	unknown	gnl\|CDD\|176241
NZ_CP046507.1\|WP_009979735.1\|4723752_4725303_-\|MCE-family-protein	unknown	unknown	gnl\|CDD\|224380
NZ_CP046507.1\|WP_156649254.1\|4728138_4729704_-\|MCE-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP046507.1\|WP_011726386.1\|4726528_4728142_-\|virulence-factor-Mce-family-protein	unknown	unknown	gnl\|CDD\|273384
NZ_CP046507.1\|WP_009979733.1\|4722113_4723085_-\|RDD-family-protein	unknown	unknown	gnl\|CDD\|377640
NZ_CP046507.1\|WP_009979727.1\|4717505_4718972_+\|YhgE/Pip-domain-containing-protein	unknown	unknown	gnl\|CDD\|224428
NZ_CP046507.1\|WP_009979725.1\|4716721_4717447_+\|pirin-family-protein	unknown	unknown	gnl\|CDD\|380375
NZ_CP046507.1\|WP_003874167.1\|4736489_4736930_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176861
NZ_CP046507.1\|WP_003874123.1\|4721562_4722117_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046507.1\|WP_003874163.1\|4732047_4732917_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|223838
NZ_CP046507.1\|WP_033715201.1\|4720110_4720812_-\|DUF1275-domain-containing-protein	unknown	unknown	gnl\|CDD\|377734
NZ_CP046507.1\|WP_023879447.1\|4736973_4737459_-\|acyl-CoA-thioesterase	unknown	unknown	gnl\|CDD\|223894
NZ_CP046507.1\|WP_009978620.1\|4734033_4735620_-\|long-chain-fatty-acid--CoA-ligase	unknown	unknown	gnl\|CDD\|169098
NZ_CP046507.1\|WP_085978618.1\|4719008_4720118_+\|phosphodiester-glycosidase-family-protein	unknown	unknown	gnl\|CDD\|378342
NZ_CP046507.1\|WP_011726377.1\|4715805_4716696_+\|MarR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224332

Protein	Function_ID	Function_description	E-value
NZ_CP046507.1\|WP_003874130.1\|4729700_4730741_-\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	4.72889e-88
NZ_CP046507.1\|WP_003874164.1\|4732918_4733734_-\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	1.098e-87
NZ_CP046507.1\|WP_009979733.1\|4722113_4723085_-\|RDD-family-protein	gnl\|CDD\|377640	pfam06271, RDD, RDD family. This family of proteins contain three highly conserved amino acids: one arginine and two aspartates, hence the name of RDD family. This region contains two predicted transmembrane regions. The arginine occurs at the N-terminus of the first helix and the first aspartate occurs in the middle of this helix. The molecular function of this region is unknown. However this region may be involved in transport of an as yet unknown set of ligands (Bateman A pers. obs.).	1.68132e-13
NZ_CP046507.1\|WP_009979731.1\|4720840_4721596_-\|hypothetical-protein	gnl\|CDD\|237030	PRK12270, kgd, multifunctional oxoglutarate decarboxylase/oxoglutarate dehydrogenase thiamine pyrophosphate-binding subunit/dihydrolipoyllysine-residue succinyltransferase subunit.	0.00629665
NZ_CP046507.1\|WP_156649255.1\|4730737_4732042_-\|MCE-family-protein	gnl\|CDD\|378749	pfam11887, Mce4_CUP1, Cholesterol uptake porter CUP1 of Mce4, putative. Mce4_CUP1 is a family of putative Mce4 transporters of cholesterol. The domain is found associated with pfam02470. The full TCDB classification for this family in conjunction with PF02470 is TC:3.A.1.27.4.	1.56128e-106
NZ_CP046507.1\|WP_033721277.1\|4737473_4738586_+\|alcohol-dehydrogenase-catalytic-domain-containing-protein	gnl\|CDD\|176241	cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase). NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. This group contains members identified as zinc dependent alcohol dehydrogenases (ADH), and class III ADG (aka formaldehyde dehydrogenase, FDH). Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. Class III ADH are also know as glutathione-dependent formaldehyde dehydrogenase (FDH), which convert aldehydes to the corresponding carboxylic acid and alcohol. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction.	1.29441e-149
NZ_CP046507.1\|WP_009979735.1\|4723752_4725303_-\|MCE-family-protein	gnl\|CDD\|224380	COG1463, Ttg2C, ABC-type transport system involved in resistance to organic solvents, periplasmic component [Secondary metabolites biosynthesis, transport, and catabolism].	2.15457e-77
NZ_CP046507.1\|WP_156649254.1\|4728138_4729704_-\|MCE-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	1.09552e-81
NZ_CP046507.1\|WP_011726386.1\|4726528_4728142_-\|virulence-factor-Mce-family-protein	gnl\|CDD\|273384	TIGR00996, Mtu_fam_mce, virulence factor Mce family protein. Members of this paralogous family are found as six tandem homologous proteins in the same orientation per cassette, in four separate cassettes in Mycobacterium tuberculosis. The six members of each cassette represent six subfamilies. One subfamily includes the protein mce (mycobacterial cell entry), a virulence protein required for invasion of non-phagocytic cells. [Cellular processes, Pathogenesis].	8.2028e-90
NZ_CP046507.1\|WP_009979725.1\|4716721_4717447_+\|pirin-family-protein	gnl\|CDD\|380375	cd02910, cupin_Yhhw_N, Escherichia coli YhhW and YhaK and related proteins, pirin-like bicupin, N-terminal cupin domain. This family includes the N-terminal cupin domains of YhhW and YhaK, Escherichia coli pirin-like proteins with unknown function. YhhW is structurally similar not only to human pirin but also to quercitin 2,3-dioxygenase (quercitinase). Although the function of YhhW is not completely understood, YhhW and its human ortholog have quercitinase activity and are likely to play an important role in transcription and apoptosis. This N-terminal cupin domain of YhhW has a metal coordination site and is thought to have catalytic activity while the C-terminal cupin-like domain has diverged considerably and has closer alignment with C-terminal pirin. YhaK is found in low abundance in the cytosol of E. coli and is strongly up-regulated by nitroso-glutathione (GSNO). There are major structural differences at the N-terminus of YhaK compared with YhhW; YhaK lacks the canonical cupin metal-binding residues of pirins and may be involved in chloride binding and/or sensing of oxidative stress in enterobacteria. YhaK showed no quercetinase and peroxidase activity; however, reduced YhaK was very sensitive to reactive oxygen species (ROS). Proteins in this family belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	2.4526e-72
NZ_CP046507.1\|WP_003874167.1\|4736489_4736930_-\|SRPBCC-family-protein	gnl\|CDD\|176861	cd07819, SRPBCC_2, Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins. Uncharacterized group of the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily. SRPBCC domains have a deep hydrophobic ligand-binding pocket and they bind diverse ligands. SRPBCC domains include the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of mammalian STARD1-STARD15, the C-terminal catalytic domains of the alpha oxygenase subunit of Rieske-type non-heme iron aromatic ring-hydroxylating oxygenases (RHOs_alpha_C), Class I and II phosphatidylinositol transfer proteins (PITPs), Bet v 1 (the major pollen allergen of white birch, Betula verrucosa), CoxG, CalC, and related proteins. Other members of the superfamily include PYR/PYL/RCAR plant proteins, the aromatase/cyclase (ARO/CYC) domains of proteins such as Streptomyces glaucescens tetracenomycin, and the SRPBCC domains of Streptococcus mutans Smu.440 and related proteins.	4.15327e-44
NZ_CP046507.1\|WP_009979727.1\|4717505_4718972_+\|YhgE/Pip-domain-containing-protein	gnl\|CDD\|224428	COG1511, COG1511, Predicted membrane protein [Function unknown].	6.8684e-50
NZ_CP046507.1\|WP_003874163.1\|4732047_4732917_-\|ABC-transporter-permease	gnl\|CDD\|223838	COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism].	9.52641e-81
NZ_CP046507.1\|WP_033715201.1\|4720110_4720812_-\|DUF1275-domain-containing-protein	gnl\|CDD\|377734	pfam06912, DUF1275, Protein of unknown function (DUF1275). This family consists of several hypothetical bacterial proteins of around 200 residues in length. The function of this family is unknown although most members have 6 TM regions, and may be putative permeases.	2.68329e-28
NZ_CP046507.1\|WP_023879447.1\|4736973_4737459_-\|acyl-CoA-thioesterase	gnl\|CDD\|223894	COG0824, FcbC, Predicted thioesterase [General function prediction only].	2.43707e-35
NZ_CP046507.1\|WP_009978620.1\|4734033_4735620_-\|long-chain-fatty-acid--CoA-ligase	gnl\|CDD\|169098	PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated.	0
NZ_CP046507.1\|WP_085978618.1\|4719008_4720118_+\|phosphodiester-glycosidase-family-protein	gnl\|CDD\|378342	pfam09992, NAGPA, Phosphodiester glycosidase. This is a family conserved from bacteria to humans. The structure of a member from Bacteroides has been crystallized and modelled onto the luminal region of the human member of the family, the transmembrane glycoprotein N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase. There is some conservation of potentially functional residues, implying that in the bacterial members this family acts in some way as a phosphodiester glycosidase. The human protein is also present, so the eukaryotic members are likely to be catalyzing the second step in the formation of the mannose 6-phosphate targeting signal on lysosomal enzyme oligosaccharides.	0.000457806
NZ_CP046507.1\|WP_011726377.1\|4715805_4716696_+\|MarR-family-transcriptional-regulator	gnl\|CDD\|224332	COG1414, IclR, Transcriptional regulator [Transcription].	8.76371e-17

>NZ_CP046507.1|WP_009979735.1|4723752_4725303_-|MCE-family-protein
MLTPFVRRQLVAFGILTVISLLVLGIYYLQIPSLVGIGRYTLKAELPASGGLYPTANVTYRGITIGKVTDVEPTEHGAEATMSIDSHYKIPIDAVANVHSVSAVGEQYLDLVSSGNPGKYLSSGQTITKGTVPAEIGPALDTANRGLAVLPKEKIGQLLDETAQSVGGLGPNLQRLVDATQAIVGDFKNQITDVNDIIEHSGPVIDSQVKSGDAIERWARNLNRLGAQSAQEDSHLKSLLRQAGPTADQVNDVFNDVRESLPQTLANLEVVIDLLKRYHTGVEQVLVFLPQGASIAQTVAAPFPNMAALDLALSINQPPPCLTGFIPASEWRSPADTSLQPLPTGTYCKIPMDTPANSVRGSRNIPCTDIPGKRAATPRECRDPKPYVPAGTNPWYGDPNQILTCPAPAARCDQPVKPGMVIPAPSVDNGLNPAPSDRVAGTPPPVSDPLSRPGSGTVQCNGQQPNPCVYKPSGPPTAVYSPQSGELVGPDGVKYSVENSTRTGDDGWKEMLAPAG
>NZ_CP046507.1|WP_009979734.1|4723081_4723783_-|hypothetical-protein
MEGDAGASRLNPIDTDDDSLSPQDKDEDSTAPASTDEQTGSQGAPGVAGESAPDDADDAVPVAAVPRGPSRLGRGWLAAIAAVLVLCAAGIGAGGYLALRYHHESQVIARNNAAALKAAVDCVEATQAPDTNAMTASEQKIIDCGTDAYRSQALLYTSMLVQAYQSANIHVQVSDVRAAVERNNPDGSIDILVALRVKVASDQSQNESGYRLRVKMALAEGQYKISKLDQVTK
>NZ_CP046507.1|WP_009979733.1|4722113_4723085_-|RDD-family-protein
MTVLVEQAATMGTPEPVREALAPWHSRVGAFAIDVAPGAAVIATMALVSFTVPARGVWWWVGVCVLGVVTLLALVNRLLLPVITGWSLGRALAGIAVTRRTGAAPGPWRLLLRDLAHLLDTASIVGWLWPLWDSRRRTFADMLAGTEVRRLAPEQVPPHITRWAAAAVLGAAAVCLGGAAMSYGVVYSADRASDQTRAQIATQGPKIVAQMLTYDPKSLHDDFARAQSLATDKYRRQLQTQQDVVQKGNPVINEYWVTNSSIESASRDRATMLLFMQGRRGAAPEVRYISATVRVSFAKVGENTWRVDDLTVLTKPKPPGGAK
>NZ_CP046507.1|WP_003874123.1|4721562_4722117_-|hypothetical-protein
MSPRRKFAPGERPLLVARPVRPPRGWLLPLAGTAAALLMVTAVTLCALMLVSHESRERAASKDREVLSYVSGFMTQFTSIDPFHANDYVNRILAQATGDFAKQYEKNANEILLQVARAEPATGTVLDAGLERWNDDGSANVMVATAITTKSPDEKQVLENTNRWAATATQEGNQWKISSLQQVI
>NZ_CP046507.1|WP_009979731.1|4720840_4721596_-|hypothetical-protein
MEDQQPAAGDLTAEENPAADQNEATVAAAGDDRENGDAATESEAAKTSDAAPADGAEDSHSAETVETAGAAPAAGRRTKRLAGKAWAVAAMVAALLFVGSAGFAGAMVQPYLADRAVAATKLKVARTAANAITTLWTYTPENMDTLADRASAYLSGDFEAQYRKFVDAIVAPNKQAKITNHTDVTGAAVESLDDTNAVVIVYTNTTSTSPLTKNVPSLKYLSYRLFMKRAKSRWLVTRMTTITSLDLTPKV
>NZ_CP046507.1|WP_033715201.1|4720110_4720812_-|DUF1275-domain-containing-protein
MAVTSPVSKRWTVAALLLLTFATGLADAISILVLGHVFVANMTGNVIFLGFWLAPRTSIDLTAVVVALPTFACTTILSGRLARHFGERVRAWISTVLATEIVLLVGLSVLAGSGILSYQQDSKLLMIGILAVTFGLQHSSARQFGIQEFSTTVLTSTIVSLGLDSRLAGGSGERQRLRIGVVATMCAGAFLGATMSRYVVAPVFVVAAAVIAASLLIFRFGPPAAKPAAAEAN
>NZ_CP046507.1|WP_085978618.1|4719008_4720118_+|phosphodiester-glycosidase-family-protein
MHFMAERAIVLTRRASFRRLAACCTALSACLTLAVTSGQPLARAADGRDLLANAISSTRGSYLVYNFGPGHPAPMLNAGGSWYEMNNGGHLMIIKNAAGRLSPHLLVDTHQGDQARCENNPGARTAEGLWQASELYAPLQAWQRMGQPTIAINANFFDVRPQKGGSWRQTGCSSPLGAFVDNTNGRGRANQAVTGTVAYPGKQGLSGGGESWSALTTMILPSGGAPYVVWPKTKSDYDAATPVVADLLNKNEKFVAVSGIGLLAPGNTGQLHDGGPSAARTAIGYARQKDEMYIFEGGSYTPDNMQDLFRGLGSDNAVLLDGGGSSAIVLRRDTGGMWAGAGSPRGSCDTRQVLCDSHERALPSWLAFN
>NZ_CP046507.1|WP_009979727.1|4717505_4718972_+|YhgE/Pip-domain-containing-protein
MARSHPQHAAPNPNRNIKAVRTVRFWAAPLVITLALMSALCALYLGGILNPTTNLRHFPIAVVNEDAGPGGAQIVDRLATGLDRNKFDIRVLSRDEAKHQLDTGRVYGSLLIPPSFSSKLRDFATSAVSPARPDKPSITVSTNPRAGTLGASIAGQTLNSAMGTANGIAAQRVMAEVTAQTGGAPLPGATQAGLSSPIEIQSVVYNPLPNGTGNGLSAFYYALLLLLAGFTGSIVVSTLVDALLGYVPAEFGPVYRFAEQVRISRFQTLLLKWAMMVLLGLLTSAVYLAIANGLGMPIDLSWELWAYGVFAIAAVGITSSSLLSVLGTAGMLVSMLVFVIFGLPSAGATVPLEATPPLFRWLAEFEPMHQVFLGTRSLLYFGGRGDAGLSQALTMTSAGLVIGLLLGGIVTHLYDRKGFHRIPGAVEFAIAQDHQAQHQARRGKSTQPPDSPVEPETPAEPESPTNLKAQARKRNSDVPGTSPTRYLY
>NZ_CP046507.1|WP_009979725.1|4716721_4717447_+|pirin-family-protein
MSAGFEIRRAATRAVTTTPWLTSRHSFSFGDHYDPDNTHFGLLLVNNDDIVSPGTGFDTHPHRDMEIVTWVLAGALAHQDSTGNRGVVYPGLAQRMSAGRGILHSERNDSPSLPVHFVQMWVIPDEAGIDPSYQQHEIDDTALGGGLVTIASGIRGHDAAISLHNRNAALHGARLPAAAAVDLPAAPCLHVFLARGRADIEDVGELHPGDAVRFTDTDGRRVTGLEPSELLIWEMHARLGG
>NZ_CP046507.1|WP_011726377.1|4715805_4716696_+|MarR-family-transcriptional-regulator
MAKSIGETPRRSGVKSPPTARVMDVLAAVADSPGGLTSAELAKGCAISSSTCALVLAELERRAWVTRRDDRRYVLGSGLFGLVHGLREQFPLLDRGRDALRLLHERLGAGCSMSKIGARHLTTVDSVGHGTDGEHAVGQRFPIDPPFGLVAMAWRDDDAVQAWLRRVTPRLTRTEIAQHQRVLADIRARGYGAWRFDDTHRSLHNRLAEALASLEPTAQVARRLTTLMTMVTLRSVTDVLETELPTTEFVVLPIFGHDGQPEYQIEIHLGHSAGLTLPELDDALEQARRLLTAPVR
>NZ_CP046507.1|WP_011726386.1|4726528_4728142_-|virulence-factor-Mce-family-protein
MSTIFDIRNIRLPKLSRTSVILGALVIVLALVVGYVGWRLYEKLTNNTVVAYFPAANALYPGDKVQIMGLRVGAIDKIEPSGDKMKVTFHYQNKYRVPANASAVILNPTLVASRAIQLEPPYKGGPVLADNAVIPEERTQVPVEWDQLRNSITNIISKLGPTAEQPKGPFGEVIESFADGLAGKGKQFNTTLTNLSRALTALNEGRGDFFAVVRSLALFVNALHQDDQQFVALNQNLADFTTRLAHSDGDLANAIEQFDSLLTTVRPWLDKNRGVLTYDVKNLETATNALLQPDPLNGLETALHVLPTAAANINQIYHPSHGSVVAIPSITNFANPMQFICSAIQAGSRLGYQESAELCAQYLAPILDAIKFNYPPFGLNLFSTAETLPKEVAYSEPRLQPPNGYKDTTVPGIWVPDTPTSHRNTQPGWIVAPGMQGQQVGPITAGLMTPDSLEELMGGPNIAPVQSNLQTPPGPPNAYDENPILPPMGLNAPVPIPPPPPGPGVAPGPVAPTPAPVSAPAPNAGGPAAPADFGGGQ
>NZ_CP046507.1|WP_156649254.1|4728138_4729704_-|MCE-family-protein
MRTLEPPNRVRIGLMGIVVTVLVIGVGQSFTSVPMLFAKPSYYGQFTDSGGINTGDKVRIAGMDVGKVEGLKIDGDHIVVKFSIGTNTIGTESRLAIKTDTILGKKILDVEARGSQQLRPGSTLPLGQSTTPYQIYDAFFDVTKAAQGWDIETVKQSLHVLSQTIDQTYPHLSPALDGVAKFSDTIGKRDEQVKHLLAQANQVASVLGDRSDQIDRLLVNTKTLLAAFNERGQAINALLDNIAAFSEQVKGLINDNPNLNHVLEQLRTVSDILVQRKDDLANGLTEVGKFLPSLNEAIASGPFFKVVLHNLALYQISQPWVDAAFKKRGIDPEDFWRSAGLPAYRFPDPNGTRFPNGAPPPAPPVLEGTPDHPGPAVPPGSPCSYTPAADGLPRPDNPLPCAGAVTGPFGGPGFPAPVDVMTSPPNPAGLPPTPGIPIAGRPGDAPPDVPGTRVPLPTQAPPGARTENLAPAGPVPPPSTFAPGLPPGPPAPPGPGNQLPAPFINPGGTGGSGAAGGGSQN
>NZ_CP046507.1|WP_003874130.1|4729700_4730741_-|virulence-factor-Mce-family-protein
MKITGTLVRLSIFSVVLLIFTVMIIVVFGQMRFDRTNGYSAEFSNISGLRAGQFVRASGVEVGKVSSVQLVDGGKRARVEFNVDRSVPLYQSTTAQIRYLDLIGNRYLELKRGQGEGADKVLPPGGFIPLSRTQPALDLDALIGGFKPLFRALDPQKVNTIATALVTVFQGQGGTINDILDQTAQLTSQLGERDQAIGEVIKNLNTVLDTTVRHRQQFDQTINNLEVLITGLKDHGDQLAGGTAHISNAAGTVADLLAEDRSLLHKTLNYLDAVQQPLIDQQDQLQDYLKKVPTALNMIGRAIGSYGDFVNFYACDITLKINGLQAGGPVRTVRLFQQPTGRCTPQ
>NZ_CP046507.1|WP_156649255.1|4730737_4732042_-|MCE-family-protein
MARPVQTNAPRTPPYKLAGLAILVVGALALALIYGQFRGNFTPKTSLTMLASRAGLVMDPGSKVTYNGVEIGRVGTISETVRDGKPAAKFTLEVYPRYLKLIPSNVNADIKATTVFGGKYVSLTTPAHPSPQKITPHTIIDARSVTTEINTLFQTITSIAEKVDPVKLNLTLSAAAQSLSGLGEKFGQSVVNANALLDDVNPRMPQARKDIQGLAALGDTYADASPDLFDFLNNAVITSRTINAQQKDLDQALLSAAGFGNTGAELFTKGGPYLARGAQDLIPTAQLLDTYSPEIYCLMRNEHDALPATGAAEGGFNGYSLNMNTEALSGLGLIANPVSAVPVIASMVGGIVGVVGGAPNPYIYPENLPRVNARGGPGGAPGCWQKITHDLWPAPELIMDTGNSIAPYNHLDTGSPYALEYVWGRQVGDNTINP
>NZ_CP046507.1|WP_003874163.1|4732047_4732917_-|ABC-transporter-permease
MSTAAVFRSRFPRAAENLNRYGLAAARGLDDVGQMAWFGGVALAHIPHALSHYRKETLRLIAQIGMGTGAMAVIGGTVAIVGFVTLSGSSLVAIQGFASLGNIGVEAFTGFFAALINVRIAAPVVTGIAMAATVGAGATAELGAMRISEEIDALEVMGIKSISFLATTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLYGQSNGTYEHYFRTFLRPDDVFWSFLEAIIITAVVMITHCFYGYNAGGGPVGVGEAVGRSMRFSLVSVQVVVLAAALALYGVNPNFALTV
>NZ_CP046507.1|WP_003874164.1|4732918_4733734_-|ABC-transporter-permease
MTSTSTSRRGPYLVGYLRDQLETPLTLVGGFFRMCVLTGKALFRWPFQWREFVLQCWFIMRVAFLPTIMVSIPLTVLLIFTLNVLLAQFGAADLSGAGAAIGAVTQLGPLTTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVIAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTITGLPEVVIATVKAAVFGLIAGLVGCFRGLTVRGGSKGLGTAVNETVVLCVVALYAVNVVLTTIGVRFGTGH
>NZ_CP046507.1|WP_009978620.1|4734033_4735620_-|long-chain-fatty-acid--CoA-ligase
MTAQLAHHPTQANEQPYLSRRQNWVNQLERHALMQPNATALRFLGKGLTWGELHGRVRALADALSRRGVGFGDRVMVLMLNRPEFMESVLAINMLGAIAVPLNFRLTAAEIAFLVQDCQARVVITEAVLAPVATGVRDIESLLDTVVVAGGSSDDAVLGYDDLIDETGAAHQPVDIPNDAAALIMYTSGTTGRPKGAVLTHTNLTGQTMTGLYTNGADINNDVGFIGVPFFHIAGIGNMLTGLLLGIPTVIYPLGAFEPGQLLDVLAAEKVTGIFLVPAQWQAVCAEQRARPRDLKLRVISWGAAPAPDALLREMSAMFPGTQILAAFGQTEMSPVTCMLLGEDAIRKRGSVGKVIPTVAARVVDENMNDVPVGEVGEIVYRAPTLMSGYWNNPEATAEAFAGGWFHSGDLVRMDEDGYVWVVDRKKDMIISGGENIYCAEVENVLASHPDIVEVAVIGRAHEKWGEVPIAVAAVANDNLALEDLDEFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRIRYGGG
>NZ_CP046507.1|WP_003874167.1|4736489_4736930_-|SRPBCC-family-protein
MPVLSKTVEVNTDAAAIMAIVADFERYPEWSDGVTGCWVLARYDDGRPSQLRLDAAYQGFEGVYIQAVYYPGPNQIQTVMQQGELFKKQEQLFSVVEMGASSLLTVDIDVEPSMPVPAPMVKSMLNNVLDHLADNLKQRAEQLAAN
>NZ_CP046507.1|WP_023879447.1|4736973_4737459_-|acyl-CoA-thioesterase
MASAPVVPPAPEGLTSNDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDTAINGWINTSTGLDPLTTPALGIVAESGCRYLSELHFPEGLQVGLAVTRLGRSSVTYRLGVFRSAAPGSAEPITALGHWVHVYVDRDTRKPVPIPDPIRTLLAGAAVGDAAPK
>NZ_CP046507.1|WP_033721277.1|4737473_4738586_+|alcohol-dehydrogenase-catalytic-domain-containing-protein
MSGIRGAVLQRIGAPRPYARSRPISITDVELAPPGRDEVLVRIEAAGICHSDLSVVDGNRVRPVPMLLGHEAAGIVERVGPGVADLAVGARVVLVFLPRCGRCAACATEGLTPCEPGSAANGAGTLLGGDIRLSRAGRPVYHHLGVSGFATHAVVNRASAVEVPPDVPAEVAALLGCAVLTGGGAVLNVGRPAPGQTVAVVGLGGVGMAALLTALTYDGVPVVAVDQLPEKLAAARRLGAHQAYTPQQAVEARVKAAVVIEAVGHPAALQTAIDLTAPGGRTITVGLPPPDARITVSPLGFVAEGRSLIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIRLEDINEAMDHLADGTAVRQLIRFDA

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046507_3	3.1\|4726471\|31\|NZ_CP046507\|CRISPRCasFinder	4726471-4726501	31	NZ_CP032685	Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence	1428865-1428895	8	0.742
NZ_CP046507_3	3.1\|4726471\|31\|NZ_CP046507\|CRISPRCasFinder	4726471-4726501	31	NZ_CP032690	Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence	1428843-1428873	8	0.742
NZ_CP046507_2	2.1\|3053752\|34\|NZ_CP046507\|CRISPRCasFinder	3053752-3053785	34	NZ_CP014802	Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence	180241-180274	9	0.735

1. spacer 3.1|4726471|31|NZ_CP046507|CRISPRCasFinder matches to NZ_CP032685 (Rhizobium sp. CCGE531 plasmid pRCCGE531d, complete sequence) position: , mismatch: 8, identity: 0.742

cccctcaggggccgacggttcggcttgctcc	CRISPR spacer
atcaggcggggccgacggttccgcctgctcc	Protospacer
 .*    ************** **.******

2. spacer 3.1|4726471|31|NZ_CP046507|CRISPRCasFinder matches to NZ_CP032690 (Rhizobium sp. CCGE532 plasmid pRCCGE532d, complete sequence) position: , mismatch: 8, identity: 0.742

cccctcaggggccgacggttcggcttgctcc	CRISPR spacer
atcaggcggggccgacggttccgcctgctcc	Protospacer
 .*    ************** **.******

3. spacer 2.1|3053752|34|NZ_CP046507|CRISPRCasFinder matches to NZ_CP014802 (Salipiger profundus strain JLT2016 plasmid pTPRO6, complete sequence) position: , mismatch: 9, identity: 0.735

gcgcccgagttgtcggccggcgcccgagttgtgt---	CRISPR spacer
gcgcccgcgttgtcgcccggcgcc---accatgtcga	Protospacer
******* ******* ********   ....***

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

767127 : 773699

Bacillus_phage(33.33%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009978328.1\|767127_768060_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	4.6e-05	35.9
WP_009978326.1\|767994_769038_-	DNA polymerase IV	F1C5A5	Cronobacter_phage	1.8e-18	27.6
WP_009978325.1\|769037_769652_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_003874932.1\|769745_770300_+	NAD(P)H-dependent oxidoreductase	A0A2P0ZL77	Lactobacillus_phage	5.4e-06	33.6
WP_003874933.1\|770829_771069_+	redoxin NrdH	V5UN81	Mycobacterium_phage	2.0e-21	64.5
WP_003874934.1\|771111_771564_+	class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI	A0A142F1R4	Bacillus_phage	1.7e-13	37.7
WP_024636978.1\|771533_773699_+	class 1b ribonucleoside-diphosphate reductase subunit alpha	V9VI16	Lactococcus_phage	7.4e-208	51.6

DBSCAN-SWA_2

2188660 : 2228404

Mycobacterium_phage(50.0%)

transposase,protease,capsid,integrase

attL 2197637:2197655|attR 2243938:2243956

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_009978095.1\|2188660_2189884_-\|protease	RIP metalloprotease	NA	NA	NA	NA
WP_009978096.1\|2189903_2192360_-	1-deoxy-D-xylulose-5-phosphate reductoisomerase	NA	NA	NA	NA
WP_033711947.1\|2192361_2192865_-	protein disulfide oxidoreductase	NA	NA	NA	NA
WP_009978098.1\|2192916_2194011_-	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	NA	NA	NA	NA
WP_009978100.1\|2194045_2194981_-	phosphatidate cytidylyltransferase	NA	NA	NA	NA
WP_003875106.1\|2195013_2195571_-	ribosome recycling factor	NA	NA	NA	NA
WP_003875105.1\|2195692_2196490_-	UMP kinase	NA	NA	NA	NA
WP_003875104.1\|2196821_2197061_+	CsbD family protein	NA	NA	NA	NA
WP_009978105.1\|2197229_2197925_+	response regulator transcription factor	NA	NA	NA	NA
2197637:2197655	attL	NA	NA	NA	NA
WP_033715341.1\|2197948_2198887_-	acyltransferase family protein	NA	NA	NA	NA
WP_009978109.1\|2198982_2199555_-	MPT63 family protein	NA	NA	NA	NA
WP_156649246.1\|2199785_2200991_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_003875100.1\|2201340_2201517_+	hypothetical protein	NA	NA	NA	NA
WP_023879650.1\|2201576_2202416_+	SDR family oxidoreductase	A0A2N9QUX2	Trichoplusia_ni_ascovirus	1.7e-59	45.3
WP_003875098.1\|2202506_2202920_-	ChaB family protein	NA	NA	NA	NA
WP_003875096.1\|2203038_2203461_+	MarR family transcriptional regulator	NA	NA	NA	NA
WP_009978116.1\|2203461_2204880_-	amidase	NA	NA	NA	NA
WP_009978118.1\|2204942_2205770_-	elongation factor Ts	NA	NA	NA	NA
WP_003875093.1\|2205783_2206614_-	30S ribosomal protein S2	NA	NA	NA	NA
WP_009978119.1\|2206888_2207392_+	M23 family metallopeptidase	NA	NA	NA	NA
WP_003875091.1\|2207492_2208398_-	tyrosine recombinase XerC	A0A0K2CP59	Brevibacillus_phage	4.1e-19	27.0
WP_050427683.1\|2209525_2210725_+	ImmA/IrrE family metallo-endopeptidase	NA	NA	NA	NA
WP_009978129.1\|2210730_2211192_+	DUF4411 family protein	NA	NA	NA	NA
WP_009978131.1\|2212381_2212699_+	hypothetical protein	NA	NA	NA	NA
WP_128971807.1\|2212831_2213068_+	hypothetical protein	NA	NA	NA	NA
WP_128971806.1\|2213093_2213564_+	hypothetical protein	NA	NA	NA	NA
WP_009978136.1\|2213679_2213865_+	hypothetical protein	NA	NA	NA	NA
WP_009978137.1\|2213993_2214557_-	hypothetical protein	NA	NA	NA	NA
WP_009978139.1\|2215229_2215442_-	hypothetical protein	NA	NA	NA	NA
WP_009978140.1\|2215441_2216281_-\|capsid	phage major capsid protein	NA	NA	NA	NA
WP_009978141.1\|2216502_2216748_-	hypothetical protein	NA	NA	NA	NA
WP_009978142.1\|2216986_2217325_-	hypothetical protein	NA	NA	NA	NA
WP_009978143.1\|2217321_2217591_-	hypothetical protein	NA	NA	NA	NA
WP_009978144.1\|2217587_2217872_-	hypothetical protein	NA	NA	NA	NA
WP_100069958.1\|2217911_2219195_-	DUF3631 domain-containing protein	NA	NA	NA	NA
WP_023880708.1\|2219368_2219713_-	hypothetical protein	NA	NA	NA	NA
WP_080555769.1\|2219923_2221336_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_023879707.1\|2221626_2221887_-	excisionase family DNA-binding protein	A0A2P1CHK7	Mycobacterium_phage	1.8e-15	66.7
WP_023879706.1\|2222163_2223333_-\|integrase	tyrosine-type recombinase/integrase	A0A1D8EV90	Mycobacterium_phage	1.7e-62	39.2
WP_128971805.1\|2224481_2224973_+	hypothetical protein	NA	NA	NA	NA
WP_009980034.1\|2225751_2226183_-	hypothetical protein	NA	NA	NA	NA
WP_024637620.1\|2226172_2228404_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
2243938:2243956	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046507

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection