CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP041352	Casimicrobium huifangae strain SJ-1 chromosome, complete genome	1 crisprs	csa3,WYL,Cas9_archaeal,cas3,DEDDh,DinG,RT	0	0	1	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP041352_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP041352_1

2806342-2806436

Orphan

Consensus_repeat	Method
GCTGTCATCCCCGCGAAGGCGGG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP041352_1

>merge|NZ_CP041352|1|2806342-2806436|CRISPRCasFinder
GCTGTCATCCCCGCGAAGGCGGGTACCAAGACCGAACGCACCCTCGCTGTAGTTGCTCAGATCGCTTTAGTTGCCGTCATCCCCGCGAAGGCGGG

>NZ_CP041352|1|1|2806342-2806436|CRISPRCasFinder
GCTGTCATCCCCGCGAAGGCGGG	TACCAAGACCGAACGCACCCTCGCTGTAGTTGCTCAGATCGCTTTAGTT
GCCGTCATCCCCGCGAAGGCGGG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP041352.1\|WP_156864687.1\|2804250_2805555_-\|FAD-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|225459
NZ_CP041352.1\|WP_156863155.1\|2810433_2811225_-\|thioredoxin-fold-domain-containing-protein	unknown	unknown	gnl\|CDD\|239318
NZ_CP041352.1\|WP_156863150.1\|2807506_2808307_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP041352.1\|WP_156864686.1\|2803399_2804254_-\|DUF1365-family-protein	unknown	unknown	gnl\|CDD\|377778
NZ_CP041352.1\|WP_156863144.1\|2805685_2806300_+\|TetR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|366102
NZ_CP041352.1\|WP_156863152.1\|2808346_2808619_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|236623
NZ_CP041352.1\|WP_156863136.1\|2798851_2800186_-\|MFS-transporter	unknown	unknown	gnl\|CDD\|340890
NZ_CP041352.1\|WP_156863153.1\|2808979_2809987_+\|XdhC-family-protein	unknown	unknown	gnl\|CDD\|224886
NZ_CP041352.1\|WP_156863134.1\|2798303_2798855_-\|DUF3833-family-protein	unknown	unknown	gnl\|CDD\|378992
NZ_CP041352.1\|WP_162527510.1\|2800182_2800725_-\|chalcone-isomerase-family-protein	unknown	unknown	gnl\|CDD\|374318
NZ_CP041352.1\|WP_156863161.1\|2814423_2815377_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|224096
NZ_CP041352.1\|WP_156863132.1\|2796224_2798267_+\|sigma-54-interacting-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225822
NZ_CP041352.1\|WP_156863139.1\|2800804_2801260_-\|nuclear-transport-factor-2-family-protein	unknown	unknown	gnl\|CDD\|378915
NZ_CP041352.1\|WP_156863157.1\|2811276_2812713_-\|glutamate--tRNA-ligase	unknown	unknown	gnl\|CDD\|234953
NZ_CP041352.1\|WP_156863148.1\|2806948_2807362_+\|PIN-domain-containing-protein	unknown	unknown	gnl\|CDD\|350312
NZ_CP041352.1\|WP_156863163.1\|2815373_2816423_+\|ABC-transporter-permease-subunit	unknown	unknown	gnl\|CDD\|223472
NZ_CP041352.1\|WP_156863141.1\|2801256_2802147_-\|SDR-family-NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|187608
NZ_CP041352.1\|WP_156863143.1\|2802149_2803397_-\|class-I-SAM-dependent-methyltransferase	unknown	unknown	gnl\|CDD\|225139
NZ_CP041352.1\|WP_156863159.1\|2812985_2814212_+\|extracellular-solute-binding-protein	unknown	unknown	gnl\|CDD\|270303
NZ_CP041352.1\|WP_156863146.1\|2806705_2806939_+\|ribbon-helix-helix-protein,-CopG-family	unknown	unknown	gnl\|CDD\|279710

Protein	Function_ID	Function_description	E-value
NZ_CP041352.1\|WP_156864687.1\|2804250_2805555_-\|FAD-dependent-oxidoreductase	gnl\|CDD\|225459	COG2907, COG2907, Predicted NAD/FAD-binding protein [General function prediction only].	8.03419e-130
NZ_CP041352.1\|WP_156863155.1\|2810433_2811225_-\|thioredoxin-fold-domain-containing-protein	gnl\|CDD\|239318	cd03020, DsbA_DsbC_DsbG, DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold. They function as protein disulfide isomerases and chaperones in the bacterial periplasm to correct non-native disulfide bonds formed by DsbA and prevent aggregation of incorrectly folded proteins. DsbC and DsbG are kept in their reduced state by the cytoplasmic membrane protein DsbD, which utilizes the TRX/TRX reductase system in the cytosol as a source of reducing equivalents. DsbG differ from DsbC in that it has a more limited substrate specificity, and it may preferentially act later in the folding process to catalyze disulfide rearrangements in folded or partially folded proteins. Also included in the alignment is the predicted protein TrbB, whose gene was sequenced from the enterohemorrhagic E. coli type IV pilus gene cluster, which is required for efficient plasmid transfer.	4.3662e-53
NZ_CP041352.1\|WP_156864686.1\|2803399_2804254_-\|DUF1365-family-protein	gnl\|CDD\|377778	pfam07103, DUF1365, Protein of unknown function (DUF1365). This family consists of several bacterial and plant proteins of around 250 residues in length. The function of this family is unknown.	6.82624e-86
NZ_CP041352.1\|WP_156863144.1\|2805685_2806300_+\|TetR-family-transcriptional-regulator	gnl\|CDD\|366102	pfam00440, TetR_N, Bacterial regulatory proteins, tetR family.	3.09065e-13
NZ_CP041352.1\|WP_156863152.1\|2808346_2808619_-\|hypothetical-protein	gnl\|CDD\|236623	PRK09775, PRK09775, type II toxin-antitoxin system HipA family toxin YjjJ.	0.00462679
NZ_CP041352.1\|WP_156863136.1\|2798851_2800186_-\|MFS-transporter	gnl\|CDD\|340890	cd17332, MFS_MelB_like, Salmonella enterica Na+/melibiose symporter MelB and similar transporters of the Major Facilitator Superfamily. This family is composed of Salmonella enterica Na+/melibiose symporter MelB, Major Facilitator Superfamily domain-containing proteins, MFSD2 and MFSD12, and other sugar transporters. MelB catalyzes the electrogenic symport of galactosides with Na+, Li+ or H+. The MFSD2 subfamily is composed of two vertebrate members, MFSD2A and MFSD2B. MFSD2A is more commonly called sodium-dependent lysophosphatidylcholine symporter 1 (NLS1). It is an LPC symporter that plays an essential role for blood-brain barrier formation and function. Inactivating mutations in MFSD2A cause a lethal microcephaly syndrome. MFSD2B is a potential risk or protect factor in the prognosis of lung adenocarcinoma. MelB-like family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.52476e-29
NZ_CP041352.1\|WP_156863153.1\|2808979_2809987_+\|XdhC-family-protein	gnl\|CDD\|224886	COG1975, XdhC, Xanthine and CO dehydrogenases maturation factor, XdhC/CoxF family [Posttranslational modification, protein turnover, chaperones].	1.73987e-75
NZ_CP041352.1\|WP_156863134.1\|2798303_2798855_-\|DUF3833-family-protein	gnl\|CDD\|378992	pfam12915, DUF3833, Protein of unknown function (DUF3833). This is a family of uncharacterized proteins found in Proteobacteria.	2.00062e-99
NZ_CP041352.1\|WP_162527510.1\|2800182_2800725_-\|chalcone-isomerase-family-protein	gnl\|CDD\|374318	pfam16036, Chalcone_3, Chalcone isomerase-like. Chalcone_3 is a family of largely bacterial members.	1.35269e-07
NZ_CP041352.1\|WP_156863161.1\|2814423_2815377_+\|ABC-transporter-permease-subunit	gnl\|CDD\|224096	COG1175, UgpA, ABC-type sugar transport systems, permease components [Carbohydrate transport and metabolism].	5.93752e-79
NZ_CP041352.1\|WP_156863132.1\|2796224_2798267_+\|sigma-54-interacting-transcriptional-regulator	gnl\|CDD\|225822	COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription].	6.06178e-160
NZ_CP041352.1\|WP_156863139.1\|2800804_2801260_-\|nuclear-transport-factor-2-family-protein	gnl\|CDD\|378915	pfam12680, SnoaL_2, SnoaL-like domain. This family contains a large number of proteins that share the SnoaL fold.	1.49467e-08
NZ_CP041352.1\|WP_156863157.1\|2811276_2812713_-\|glutamate--tRNA-ligase	gnl\|CDD\|234953	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed.	0
NZ_CP041352.1\|WP_156863148.1\|2806948_2807362_+\|PIN-domain-containing-protein	gnl\|CDD\|350312	cd18745, PIN_VapC4-5_FitB-like, uncharacterized subgroup of the PIN_VapC4-5_FitB-like subfamily of the PIN domain superfamily. The PIN_VapC4-5_FitB-like subfamily includes the Virulence associated protein C (VapC)-like PIN (PilT N terminus) domain of Mycobacterium tuberculosis VapC4 and VapC5 ribonuclease toxins of the VapBC toxin/antitoxin (TA) system, and Neisseria gonorrhoeae FitB toxin of the FitAB TA system. This subfamily belongs to the VapC-like family of the PIN domain nuclease superfamily. VapC is the PIN-domain ribonuclease toxin from prokaryotic VapBC toxin-antitoxin (TA) systems. VapB is a transcription factor-like protein antitoxin acting as an inhibitor. Other members of the VapC-like nuclease family include eukaryotic ribonucleases such as Smg6, ribosome assembly factor NOB1, exosome subunit Rrp44 endoribonuclease and rRNA-processing protein Fcf1. The structural properties of the PIN (PilT N terminus) domain indicate its active center, consisting of three highly conserved catalytic residues which coordinate metal ions, in some members, additional metal coordinating residues can be found. Some members of the superfamily lack several of these key catalytic residues. The PIN active site is geometrically similar in the active center of structure-specific 5' nucleases, PIN-domain ribonucleases of eukaryotic rRNA editing proteins, and bacterial toxins of toxin-antitoxin (TA) operons.	5.16957e-58
NZ_CP041352.1\|WP_156863163.1\|2815373_2816423_+\|ABC-transporter-permease-subunit	gnl\|CDD\|223472	COG0395, UgpE, ABC-type sugar transport system, permease component [Carbohydrate transport and metabolism].	5.49585e-86
NZ_CP041352.1\|WP_156863141.1\|2801256_2802147_-\|SDR-family-NAD(P)-dependent-oxidoreductase	gnl\|CDD\|187608	cd05350, SDR_c6, classical (c) SDR, subgroup 6. These proteins are members of the classical SDR family, with a canonical active site tetrad and a fairly well conserved typical Gly-rich NAD-binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs.	3.51112e-67
NZ_CP041352.1\|WP_156863143.1\|2802149_2803397_-\|class-I-SAM-dependent-methyltransferase	gnl\|CDD\|225139	COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane].	6.85257e-103
NZ_CP041352.1\|WP_156863159.1\|2812985_2814212_+\|extracellular-solute-binding-protein	gnl\|CDD\|270303	cd13585, PBP2_TMBP_like, The periplasmic-binding component of ABC transport systems specific for trehalose/maltose and similar oligosaccharides; possess type 2 periplasmic binding fold. This family includes the periplasmic trehalose/maltose-binding component of an ABC transport system and related proteins from archaea and bacteria. Members of this group belong to the type 2 periplasmic-binding fold superfamily. PBP2 is comprised of two globular subdomains connected by a flexible hinge and bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. The majority of PBP2 proteins function in the uptake of small soluble substrates in eubacteria and archaea. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.14515e-44
NZ_CP041352.1\|WP_156863146.1\|2806705_2806939_+\|ribbon-helix-helix-protein,-CopG-family	gnl\|CDD\|279710	pfam01402, RHH_1, Ribbon-helix-helix protein, copG family. The structure of this protein repressor, which is the shortest reported to date and the first isolated from a plasmid, has a homodimeric ribbon-helix-helix arrangement. The helix-turn-helix-like structure is involved in dimerization and not DNA binding as might have been expected.	0.000284619

>NZ_CP041352.1|WP_156863144.1|2805685_2806300_+|TetR-family-transcriptional-regulator
MSLLKRISFKDQAFQQREDAILDAATRILTNRGFDLMTMDEVATDVGVSKPSLYKHFKSKEELAGECMIRLLDGANETLAALPDDLPALERIRRLLGWALDLRLKGGLPFLPATSPHVRDMLVKNLGYTMRALKLNNALVKLVRDAQKTGQMRKDLPEDVILYSFYARTCDPSVEFLRLYSKLSNAEIVEHTLSVYFGGVGAKP
>NZ_CP041352.1|WP_156864687.1|2804250_2805555_-|FAD-dependent-oxidoreductase
MAVVGAGVAGLGAAWLLQRQGHRVTLYERDGRFGGHANTVDVTLDGAIAPVDTGFLVFNGKTYPNLIGLFGELGVESYETEMTFGVSADRGRLEWAGTNLGTVFAQPGNLFSPRFIGMIRDLLRFNRNADAHLAECAQTPERTLGQLLDAHGYGQPLRDLYLVPMAASIWSTRADEILDYPAATFLRFCQNHCLLQVNNRPVWRSVLNGSRSYVQRILAAVPDCRHGAAVEAVISREAGVDIVAGGQMEHFDDVVLAAHAPESLALLKAGTAHGSAMTEGDQLLQTLAAFRYQANDAFLHTDTALLPKRRKVWSAWNYIDQDGAGAAGGNAQGGVCVSYLLNRLQRLPFTTPLVVTLNPRVLPLPDKRIQHFVYEHPIFDAAAIRAQDALPGVQGRGHVWLAGAWTRYGFHEDGLLSALRVAQQFGDLPGWARP
>NZ_CP041352.1|WP_156864686.1|2803399_2804254_-|DUF1365-family-protein
MIGAPRETLRPAGELIAATVVHERTRPARHRFSYPLFCLRLDVERLQELPDATNGWLRIDPQTRWQCLRPFTLQTRDYGARDGSDLGAWAREQVDAAGVKLLPGASRIELQTFPRLFGFVFNPVSFWFCRDENDALRVLIAEVNNTFGEHHFYVVTADDRGAIGTDTALTCRKAMHVSPFCEVRGRYRFRVTAGRTARRVDVDYYDGEQLLIATRIAGHAVALDGAVLRTQLWRFPLMTFGVVARIHWQALKLWLKRVPWFHKPDYAGPLRTGNTIVETKEGRA
>NZ_CP041352.1|WP_156863143.1|2802149_2803397_-|class-I-SAM-dependent-methyltransferase
MSTTESLNSGTHGIAHARHNQRIPFAARAFLRALEHLRHGHLVVHTPDGRHLSFGQAGVDGTVAAHLAIADWRACGKILSGGDIGFAEALREGWVDSADLTALLRLAIDNEQAVAKLVHSSGIAGLVHRIRHLLNRNSKAGSKRNIHAHYDLGNEFYRLWLDSTWTYSSALFVGDYAQPLATAQTNKYRRIVDTLGLKPGQRVLEIGCGWGGFAEYAAARGIQVHGITVSQAQLEFAQDRLRRAGLDQLAKLEFRDYRDLTGTYDAVVSIEMFEAVGEQYWAGYFDTVAARLAPGGQALIQSITIDDAQFEHYRRGTDFIQQFIFPGGMLPSPTRFRSEADKAGLGTLESFAFGKDYAETLRRWRDAFEQQLGSVRALGFDEAFIRIWRLYLAYCEAGFDSGRTDVMHFHLRKAG
>NZ_CP041352.1|WP_156863141.1|2801256_2802147_-|SDR-family-NAD(P)-dependent-oxidoreductase
MNRQFVAESPPATPVAGAVQTAQSTRWPWWRSPNRRRADWQGQRVWLIGASSGIGAALAAQLMARGASVALSARNVEALQRVADGASAGSNGRALVLPFDATQQGQWAGAHGKLNVAWGGVDVVVFCAGAYAPMRAWEIDDRQMSQIVDVNLRSVYHGLERVIPDLRAGGTGALVLVASVAGLMGLPNATVYGPTKAALINLAELLHSDLRGDGVDVYLVNPGFVQTPLTAKNEFPMPAIQTPEQAAQAIMRGLAAGRFSIHFPKRFTGWLYLLRHLPDRVRLAIVRGLMAARPAR
>NZ_CP041352.1|WP_156863139.1|2800804_2801260_-|nuclear-transport-factor-2-family-protein
MSEATTPASIGLPPLVERYNALRVDTLRELLACYAEQAHFKDPFNDVVGRAEIDRIFRHMFATLEQPTFVIGNALAGNRDAMLRWEFRFGLSGKSYLVPGSTALAFDDSGRVIDHVDYWDPTETVWAHLPLVGAPVRWLRRRFSSAHFERG
>NZ_CP041352.1|WP_162527510.1|2800182_2800725_-|chalcone-isomerase-family-protein
MLVLPQGSTAQTAQATPGGGEQPPDEVRRRRPAARLSGRGTLRFLGLHIYDALLWVENAIDSGNYAAHPLALELRYARSLYGSLIAERSLREMERAGPIPAIQSERWLAFMREAFPDVGAGDRITGLWNPADETSEFVINGKAGKALRDRAFGERFFGIWLGNSTSEPALRQALLGRKAP
>NZ_CP041352.1|WP_156863136.1|2798851_2800186_-|MFS-transporter
MTVATGSIVRYGALGLPLAFVALPLHVQWANVAASTWALPLGMIGGLLLAVRALDAVVDPWLGRVMDRVFAAQRAWLVAAFATSLVVAGFALLFSSPPSFVRGETDLTIAWAAAALALTYLGYSAAQIVHQAWGARWGGDAAQRARIVAGREAFALVGVVSATVLPAVMGWPGLSALLAALAVIALVMLRGVRTPASAASTLPATQLAAVASTSARGTQSPWRLPAFRQLMLVYVISGFAAAVPANLVIFYIRDRLLASAWEPAFLFAYFAAAALSMPLWTRLAGRYGLVRCWAGSMALATASFAGAAWLSTGHEWLFLAVCIGSGIALGAELIAPAALLAGVLQRSGGGYGGEGAWFGWWTFASKFNLALAAGVALPLVAQLGYTPGGREASAVQALALVYGVLPCVVKLVSLGLLLALGRELEPPAGSPNHRSTLANEVSSP
>NZ_CP041352.1|WP_156863134.1|2798303_2798855_-|DUF3833-family-protein
MNTVPTRRQLLLGTAAASLLALAGCASPQIADYAAEKPVLDLREYFNGKIEAHGVFRDRNGLVKRRFVVAMDCRWDGDDGVLDEQFVYSDGERQRRVWRLKHLGDGRYSGRADDVVGVADGSARGNAFRWQYTLRLPVDGKEYEVQFDDWMYLIDDRVMLNHATMSKFGIKLGEVQLSFHRPR
>NZ_CP041352.1|WP_156863132.1|2796224_2798267_+|sigma-54-interacting-transcriptional-regulator
MFAPQSPLSPASPGAIGTYHADSHAMVIETSWDRSRRAGLRTHESQDFHALATTDLRLLREQNTELMRHAAPVMETLHQQIIDTDSMVVLTDAKGVVLHSIGDDSFEQQAAKVALRPGVNWGEAQKGTNAIGTSIHERAPVVVHANEHFLTANHGLTCSAAPIFAPAGDLLGVLDVTGDYRGFHKHTMGLVRMSAQMIENTLFRRTYFGQLIVAFHARAEFIGTLMEGLLAIAPDGRILAANRSACLQTELSLSSIRTHTALSLLRRAPSELFELAYLAINKPLQCVLPSGVRIFAVPATTSTRTYAAAAREETSAAPPERATRADAPVAPTATKPAAVRPDAPTQTLPQANFDDLDSGDAQVASVIARLRRVAATDVSILLEAETGAGKEWFSLAIHRASARRDGPFVAINCAAVPEGLIESELFGYEDGAFTGARRKGHQGKLLQAHGGTLFLDEIGDMPLAMQARLLRVLQERVVTPLGSGKAIPVDVRLVCATHKRLRDLIKVGGFRDDLYYRLNGLTVRLPALRERSDLREIVSRLLHAQGGPQWRLAPDVWALVMQHQWPGNLRQLSNVLATAMAIAAPVTVIGREHLPDDFLDDVAELNSGSGSAANIAPPINASRTVSANAAASLDDLALDAMQRALARHHGNLSAAARELGVSRNTLYRKLPKDLLRPASP
>NZ_CP041352.1|WP_156863146.1|2806705_2806939_+|ribbon-helix-helix-protein,-CopG-family
MSQITLYLDDATQALVDQAAHAHGMSKSRWVAEAIRRYAAQEWPPACLNLAGSFPDFPLVGDGTGDAQPEDTPRLGF
>NZ_CP041352.1|WP_156863148.1|2806948_2807362_+|PIN-domain-containing-protein
MFILDSNTISYYFRGDPQVVPRLQAIRPADLGVPAIVEYELQYGLLRLPPEAAAPRLAALKQLLQPMQMLPFDSECAAEAARIRAELEAAGTPIGPHDTLIAATAMRYQGTLVTRNVREFSRVMGLRWVDWNEVSQR
>NZ_CP041352.1|WP_156863150.1|2807506_2808307_+|hypothetical-protein
MNKNCSIDVTQTCIDFLEKEVRESPIPGESAAAKRLLERSSELREVYEELGRNLRNRPDAINTFLGCVISTMAGWNPEENLNARKARQRLIGINRQIASVAGELATLLEQRSELQNSSGFRGGTHYDVCELIEDASSHIDRFGSDVKPKLRQLRREYDLKYWPSLSAIVFALAEDAASSHVEAGDPLTLAAVESSRASKADFIKALFESIAENTGAQINKLPPYFRLPDSEWASLINVALNLEPGEIADAVYIKGVRARRKQKREQ
>NZ_CP041352.1|WP_156863152.1|2808346_2808619_-|hypothetical-protein
MNKTASTDHVLFTISTTDSEIGVSRETLSRLVATLGMNETQVLHYALRQLARALLPAYEADDGPLSAKQLCAIRKAVPEGRHKSIKCSLF
>NZ_CP041352.1|WP_156863153.1|2808979_2809987_+|XdhC-family-protein
MDNLDLDVLKTALAWTDSGRRATLGTVVRTWGSAPRPIGAMMAIRDDGQVIGSVSGGCIEDDLIAKVKDGKLAARLPESVRYGVSADQAHQFGLPCGGTVEMVLEPLTPQSDIRGLLADLEAHRIVKRTLNLATAVTHRADATGADVLAFDGNTLTTIHGPRYRLLIIGAGQLSKYLATMAIPLDYQVTVCDPRDEYQEQWHDLPQVTMTKEMPDDTVIAMNLDRNSAVVALTHDPKLDDLALMEALKSPAFYVGALGSRRNNDKRRERLLEFDVTAEELTKLRGPVGLDIGAKTPSEIAISILAEMTAMKRGVTMTRSKSEVPAAATTSAGCAL
>NZ_CP041352.1|WP_156863155.1|2810433_2811225_-|thioredoxin-fold-domain-containing-protein
MMFASRLAARFAGVATALVLVALPALAQTPAGTVAPAVADNIRKVLGPKINGGGKIDAIRPAPMAGLYEVQIGTDVLYVNETANFLFQGSLVDLDKGRDLTRERKEALVAEMEAKVMPALWSGESLNDAVKLVKGKGTRKVVVFEDPYCGYCKKLRQSFAEMDDITVYTFMVAQLSQDSAPKARDLWCSADRIKAYDDWMLRSKAPAAADKACADPTQRVAGLAKRLGVGPVPHVVFADGSKNVGYMPSADLGKKLGTVKATF
>NZ_CP041352.1|WP_156863157.1|2811276_2812713_-|glutamate--tRNA-ligase
MTDRKTDTGPRAPIRTRFAPSPTGTLHLGNIRTALFAWAYARHHNGQFVLRIEDTDLERSSESSADGILRDMAWLGLDIDEGPFYQMQRMPRYREVVAQMLADGRAYHCYMSVEELDALREKQKANNEKPRYNGHWRPENVAKQGLTPPPGVLPVIRFRNPDDGVVAWDDAVKGRIEIANSELDDLVIARQAPVGEVGVPTYNFCVVVDDIDMQISHVIRGDGHVMNTPRQINIFRALGKEPPVFGHTPTVLGNDGEKLSKRHGATGLNEYAANGYLPEAIINGLARLGWSHGNDEIFTPQQLVEWFNLESLTPSPARFDAEKFEWLNGEHVKRLPVDVLAAKLEPFLREQGYDLNVGPSALAVAELLRERAPTLRKMAELAHFCYHAVTPDAALLAQHLTDANKPAIAWVKEQLAVTEWAKPALAAILKEAQAKFALKTPQVMMPLRVLLTGVAQAPAVDALMLTLGREKTLQRITV
>NZ_CP041352.1|WP_156863159.1|2812985_2814212_+|extracellular-solute-binding-protein
MSMLTAHAADLRVQCYSDGNECEVTGEIAKRFEAANPGTKIIIDKVPYKAVVETLPVQLAAGEGPDIARVTDLGGLNKYYLDLTPHLSAARQKAWQDNFASTLSWFRAGPTDKGIYGLMSQLTVTGLYVNKTLFEQAKVPMPPATATWDDWMAAAKKVADATKTPFAAAMDRTGHRFAPLAVAYGSKYFDAKGGPVIDDGFKLAANKFVGWHKSGLMPKEVWGGLGGSAYRDAFEEFANGRIVLYYSGSWQVNRMDKNVTKSFDWAVAPAPCGPAGCTAMPGGAAYVGLKRTKAPAEVAKFLDFLATDANYAEMMAKTENIPAHLGVAKAGVTYNVSPLAKAALNTFVGDVGKILKPNFDLQGYRLNRAVFQPTAARLGQAIAGEITVDDALKRLASDLDEQVKAAAK
>NZ_CP041352.1|WP_156863161.1|2814423_2815377_+|ABC-transporter-permease-subunit
MGDPAKRRKDQIMKTRPGTPWFFLAPNVIVILLFTFVPIAINIYYAFTGGVNLYPLQRPGVGVENFSTLLECGSYLDPSSCTKDVFWRSIFNTAKYAFFQVSLMVLFSLITALVLNRKIIGRGFWRGVFFYPVLLSPVVVALIWKWILQRDGLLNAAMVAVDAPPVLWLAEPGWAFFWVTFVSIWAHMGFYMLILLAGLQAIPADLYEAAQLDKASPWRSLTRVTLPLLMPNLMVVLVLALIKAVQTFDDVFVLTGGGPGSATTFIVQFIYHTGFVEPVRLYGIAAAGSLLLALALVALTLLQLRLSKADEMGERAK
>NZ_CP041352.1|WP_156863163.1|2815373_2816423_+|ABC-transporter-permease-subunit
MKALKFLTRTRNGRSLDWTDWLSYVYLTLGLFLMFGPVIWLVGSSFKTEAALNEFPPSFLPYGQKAVAVPGEEKMKPVYRIKLPDGTTKELPEVRRIGLMATHIDPARPDEPIRVNVKDREPVREFKLATENYTDLGGKIQFGTYLWNSVFITLVATILTLLFNSMAAFALSKYKFKGRTSVFLLILGTLMVPPAIVLVPNFLVVSELGMLNSLWGVIWPAIATPTGVFLLRQYMLTIPDELLDAARMDHASEWQIYWRIVLPLAAPALAVLAIFSVMWRWNDFLWPLIVLSKNEKFTLQLALNAFQGDLVTQWNYLLAMTVITLLPITIVFAFLQKYITQGIASAGVK

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

2286087 : 2364365

Bacillus_phage(27.27%)

integrase,transposase,plate,tRNA

attL 2280158:2280182|attR 2306920:2306944

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
2280158:2280182	attL	NA	NA	NA	NA
WP_156862697.1\|2286087_2288421_+\|transposase	Tn3 family transposase	NA	NA	NA	NA
WP_139235525.1\|2288424_2288757_-	hypothetical protein	NA	NA	NA	NA
WP_054257790.1\|2288832_2291835_-\|transposase	Tn3 family transposase	A0A1B0V7H9	Salmonella_phage	1.3e-80	25.6
WP_156862698.1\|2291841_2293125_-\|integrase	tyrosine-type recombinase/integrase	NA	NA	NA	NA
WP_156862699.1\|2293142_2295368_-	S8 family serine peptidase	NA	NA	NA	NA
WP_156862700.1\|2295368_2296541_-	AAA family ATPase	A0A1B0Z0Q4	Vibrio_phage	4.0e-06	30.0
WP_156862701.1\|2296966_2298484_-	efflux transporter outer membrane subunit	NA	NA	NA	NA
WP_156862702.1\|2298498_2299614_-	ABC transporter permease	NA	NA	NA	NA
WP_156862703.1\|2299619_2300750_-	ABC transporter permease	NA	NA	NA	NA
WP_156862704.1\|2300746_2302546_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.8e-18	27.8
WP_156862705.1\|2302542_2303544_-	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_156862706.1\|2303659_2304322_+	CerR family C-terminal domain-containing protein	NA	NA	NA	NA
WP_156862707.1\|2304502_2305579_+	DNA-binding protein	NA	NA	NA	NA
WP_156862708.1\|2305672_2306443_+	UPF0489 family protein	NA	NA	NA	NA
WP_156862709.1\|2306534_2306888_-	hypothetical protein	NA	NA	NA	NA
WP_156862710.1\|2307782_2308538_+	(d)CMP kinase	NA	NA	NA	NA
2306920:2306944	attR	NA	NA	NA	NA
WP_156862711.1\|2308778_2310476_+	30S ribosomal protein S1	NA	NA	NA	NA
WP_156862712.1\|2310542_2310872_+	integration host factor subunit beta	A7KV42	Bacillus_phage	1.4e-09	38.9
WP_156862713.1\|2310952_2312113_+	lipopolysaccharide assembly protein LapB	NA	NA	NA	NA
WP_156862714.1\|2312168_2313506_+	nucleotide sugar dehydrogenase	M1HEJ3	Acanthocystis_turfacea_Chlorella_virus	8.5e-29	27.9
WP_156862715.1\|2313636_2315013_+	DNA repair protein RadA	NA	NA	NA	NA
WP_156862716.1\|2315156_2316551_+	hypothetical protein	NA	NA	NA	NA
WP_156864655.1\|2316732_2317338_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_162527488.1\|2317381_2317783_+	type IV pilus modification protein PilV	NA	NA	NA	NA
WP_156864656.1\|2317779_2318886_+	PilW family protein	NA	NA	NA	NA
WP_156862718.1\|2318900_2319509_+	hypothetical protein	NA	NA	NA	NA
WP_162527489.1\|2319513_2323155_+	hypothetical protein	NA	NA	NA	NA
WP_156864657.1\|2323154_2323556_+	prepilin-type N-terminal cleavage/methylation domain-containing protein	NA	NA	NA	NA
WP_156862720.1\|2323580_2324594_-	4-hydroxy-3-methylbut-2-enyl diphosphate reductase	NA	NA	NA	NA
WP_156862721.1\|2324683_2325181_-	lipoprotein signal peptidase	NA	NA	NA	NA
WP_156862722.1\|2325491_2328314_-\|tRNA	isoleucine--tRNA ligase	A0A1V0SJ93	Klosneuvirus	2.5e-75	25.7
WP_156862723.1\|2328653_2330282_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	6.3e-18	34.9
WP_156862724.1\|2330300_2331293_-	bifunctional riboflavin kinase/FAD synthetase	NA	NA	NA	NA
WP_162527490.1\|2331506_2335013_-	UvrD-helicase domain-containing protein	A0A068EQC7	Bacillus_phage	2.4e-06	22.7
WP_156862726.1\|2335002_2337651_-	PD-(D/E)XK nuclease family protein	NA	NA	NA	NA
WP_156862727.1\|2337749_2338430_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_156862728.1\|2338439_2342021_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_156862729.1\|2342017_2343361_-	DotU family type VI secretion system protein	NA	NA	NA	NA
WP_156862730.1\|2343357_2344692_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA
WP_156862731.1\|2344709_2345099_-	hypothetical protein	NA	NA	NA	NA
WP_156862732.1\|2345111_2346233_-	hypothetical protein	NA	NA	NA	NA
WP_156862733.1\|2346246_2348622_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	3.7e-35	25.0
WP_156862734.1\|2348656_2349133_-	hypothetical protein	NA	NA	NA	NA
WP_156862735.1\|2349244_2350054_-	cold shock domain-containing protein	NA	NA	NA	NA
WP_156862736.1\|2350400_2351564_-	protein kinase	NA	NA	NA	NA
WP_156862737.1\|2351830_2354167_+	protein kinase	A0A2I2L395	Orpheovirus	1.7e-08	23.7
WP_156862738.1\|2354198_2355404_-	patatin-like phospholipase family protein	NA	NA	NA	NA
WP_156862739.1\|2355628_2356705_-	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_156862740.1\|2356701_2358063_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_156862741.1\|2358070_2358526_-	hypothetical protein	NA	NA	NA	NA
WP_156862742.1\|2358617_2361296_-	type VI secretion system ATPase TssH	A0A2I7SAX5	Vibrio_phage	3.7e-76	32.5
WP_156862743.1\|2361335_2362478_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_156862744.1\|2362490_2364365_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage