CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP033366	Mesorhizobium japonicum R7A chromosome, complete genome	2 crisprs	WYL,csa3,DEDDh,RT,cas3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP033366_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033366_1

2009335-2009422

Orphan

Consensus_repeat	Method
GCGTGTCACCCAAAAGTGCGCAGCGGTTTTG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033366_1

>merge|NZ_CP033366|1|2009335-2009422|CRISPRCasFinder
GCGTGTCACCCAAAAGTGCGCAGCGGTTTTGGGATAGTGACACGCGCGAACCCCAAAGCGTGTCACCCAAAAGTGCGCGGCGGTTTTG

>NZ_CP033366|1|1|2009335-2009422|CRISPRCasFinder
GCGTGTCACCCAAAAGTGCGCAGCGGTTTTG	GGATAGTGACACGCGCGAACCCCAAA
GCGTGTCACCCAAAAGTGCGCGGCGGTTTTG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033366.1\|WP_032931542.1\|2013387_2013957_+\|N-acetyltransferase	unknown	unknown	gnl\|CDD\|225695
NZ_CP033366.1\|WP_010911327.1\|2006137_2006350_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033366.1\|WP_032931539.1\|2015619_2016249_-\|rod-binding-protein	unknown	unknown	gnl\|CDD\|378407
NZ_CP033366.1\|WP_032931543.1\|2010362_2011559_-\|amidase	unknown	unknown	gnl\|CDD\|181375
NZ_CP033366.1\|WP_010911329.1\|2004359_2005046_+\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|224584
NZ_CP033366.1\|WP_032931541.1\|2014513_2015050_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033366.1\|WP_032931550.1\|2001776_2002532_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|212491
NZ_CP033366.1\|WP_032931547.1\|2005077_2006055_+\|cation-transporter	unknown	unknown	gnl\|CDD\|224151
NZ_CP033366.1\|WP_044548303.1\|2001600_2001780_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033366.1\|WP_032931548.1\|2003091_2004276_-\|pyridoxal-phosphate-dependent-aminotransferase	unknown	unknown	gnl\|CDD\|235596
NZ_CP033366.1\|WP_032931538.1\|2016505_2017546_+\|aminopeptidase	unknown	unknown	gnl\|CDD\|226774
NZ_CP033366.1\|WP_032931545.1\|2007382_2008594_-\|nickel/cobalt-transporter	unknown	unknown	gnl\|CDD\|225125
NZ_CP033366.1\|WP_010911323.1\|2009459_2010359_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176114
NZ_CP033366.1\|WP_010911321.1\|2012101_2013235_+\|type-III-PLP-dependent-enzyme	unknown	unknown	gnl\|CDD\|143482
NZ_CP033366.1\|WP_032933730.1\|2014047_2014332_-\|SCP2-sterol-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|225794
NZ_CP033366.1\|WP_032931540.1\|2015180_2015606_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP033366.1\|WP_032931546.1\|2006362_2007340_+\|SDR-family-oxidoreductase	unknown	unknown	gnl\|CDD\|187549
NZ_CP033366.1\|WP_051402011.1\|2017564_2018134_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|379112
NZ_CP033366.1\|WP_032931544.1\|2008590_2009259_-\|DUF1007-family-protein	unknown	unknown	gnl\|CDD\|226208
NZ_CP033366.1\|WP_032931549.1\|2002565_2002940_-\|YciI-family-protein	unknown	unknown	gnl\|CDD\|226318

Protein	Function_ID	Function_description	E-value
NZ_CP033366.1\|WP_032931542.1\|2013387_2013957_+\|N-acetyltransferase	gnl\|CDD\|225695	COG3153, COG3153, Predicted acetyltransferase [General function prediction only].	3.29794e-54
NZ_CP033366.1\|WP_032931539.1\|2015619_2016249_-\|rod-binding-protein	gnl\|CDD\|378407	pfam10135, Rod-binding, Rod binding protein. Members of this family are involved in the assembly of the prokaryotic flagellar rod.	3.87732e-05
NZ_CP033366.1\|WP_032931543.1\|2010362_2011559_-\|amidase	gnl\|CDD\|181375	PRK08310, PRK08310, amidase; Provisional.	0
NZ_CP033366.1\|WP_010911329.1\|2004359_2005046_+\|GNAT-family-N-acetyltransferase	gnl\|CDD\|224584	COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis].	6.31462e-29
NZ_CP033366.1\|WP_032931550.1\|2001776_2002532_+\|SDR-family-oxidoreductase	gnl\|CDD\|212491	cd05233, SDR_c, classical (c) SDRs. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human prostaglandin dehydrogenase (PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107, PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction.	4.66044e-56
NZ_CP033366.1\|WP_032931547.1\|2005077_2006055_+\|cation-transporter	gnl\|CDD\|224151	COG1230, CzcD, Co/Zn/Cd efflux system component [Inorganic ion transport and metabolism].	3.03978e-107
NZ_CP033366.1\|WP_051402011.1\|2017564_2018134_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|379112	pfam13302, Acetyltransf_3, Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.	1.13906e-28
NZ_CP033366.1\|WP_032931548.1\|2003091_2004276_-\|pyridoxal-phosphate-dependent-aminotransferase	gnl\|CDD\|235596	PRK05764, PRK05764, aspartate aminotransferase; Provisional.	1.49844e-159
NZ_CP033366.1\|WP_032931538.1\|2016505_2017546_+\|aminopeptidase	gnl\|CDD\|226774	COG4324, COG4324, Predicted aminopeptidase [General function prediction only].	0
NZ_CP033366.1\|WP_032931545.1\|2007382_2008594_-\|nickel/cobalt-transporter	gnl\|CDD\|225125	COG2215, COG2215, ABC-type uncharacterized transport system, permease component [General function prediction only].	1.12724e-104
NZ_CP033366.1\|WP_010911323.1\|2009459_2010359_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176114	cd08422, PBP2_CrgA_like, The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA and its related homologs, contains the type 2 periplasmic binding domain. This CD includes the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA and its related homologs. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	6.43531e-82
NZ_CP033366.1\|WP_010911321.1\|2012101_2013235_+\|type-III-PLP-dependent-enzyme	gnl\|CDD\|143482	cd00622, PLPDE_III_ODC, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase. This subfamily is composed mainly of eukaryotic ornithine decarboxylases (ODC, EC 4.1.1.17) and ODC-like enzymes from prokaryotes represented by Vibrio vulnificus LysineOrnithine decarboxylase. These are fold type III PLP-dependent enzymes that differ from most bacterial ODCs which are fold type I PLP-dependent enzymes. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. Members of this subfamily contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. They exist as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity. Also members of this subfamily are proteins with homology to ODC but do not possess any catalytic activity, the Antizyme inhibitor (AZI) and ODC-paralogue (ODC-p). AZI binds to the regulatory protein Antizyme with a higher affinity than ODC and prevents ODC degradation. ODC-p is a novel ODC-like protein, present only in mammals, that is specifically exressed in the brain and testes. ODC-p may function as a tissue-specific antizyme inhibitory protein.	3.95227e-179
NZ_CP033366.1\|WP_032933730.1\|2014047_2014332_-\|SCP2-sterol-binding-domain-containing-protein	gnl\|CDD\|225794	COG3255, COG3255, Putative sterol carrier protein [Lipid metabolism].	1.80963e-23
NZ_CP033366.1\|WP_032931546.1\|2006362_2007340_+\|SDR-family-oxidoreductase	gnl\|CDD\|187549	cd05238, Gne_like_SDR_e, Escherichia coli Gne (a nucleoside-diphosphate-sugar 4-epimerase)-like, extended (e) SDRs. Nucleoside-diphosphate-sugar 4-epimerase has the characteristic active site tetrad and NAD-binding motif of the extended SDR, and is related to more specifically defined epimerases such as UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), which catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup includes Escherichia coli 055:H7 Gne, a UDP-GlcNAc 4-epimerase, essential for O55 antigen synthesis. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif.	4.97564e-149
NZ_CP033366.1\|WP_032931544.1\|2008590_2009259_-\|DUF1007-family-protein	gnl\|CDD\|226208	COG3683, COG3683, ABC-type uncharacterized transport system, periplasmic component [General function prediction only].	2.07163e-86
NZ_CP033366.1\|WP_032931549.1\|2002565_2002940_-\|YciI-family-protein	gnl\|CDD\|226318	COG3795, COG3795, Uncharacterized protein conserved in bacteria [Function unknown].	4.15367e-49

>NZ_CP033366.1|WP_032931544.1|2008590_2009259_-|DUF1007-family-protein
MQLKRHAIILASALAATLAATRPAYVHPHVFAEARLDVILSPDHQSVKALRHLWRFDDLFSSTVMMEFDKNSDLKLDDKELKEVADTVHASLAEFNYFQLVTQNGKDVTMVPPPHLMANFDNDQLIILFESEPKVPIKLTGTIDIGVYDPTFYTAIDFTEDSNITVAGLPSNCTSKVIRPDPDEAIKENQKTLTDAFFNDPTGTDMSKIFATKLELTCQPEG
>NZ_CP033366.1|WP_032931545.1|2007382_2008594_-|nickel/cobalt-transporter
MKPVTKPSLRLAFGLLALTFAAMHFANAAHAQSSLGIGVNDGMAPTTGPFAHILMWINLRQQEFYRALATAMKAMRQDNSKLWVLIGLSFAYGIFHAAGPGHGKAVISSYMVANEVALKRGILLSFVSALLQGLTAIAVMLVAYFVLRGTTISMTDAAWFMEIMSFALVTLFGAWLLWRKLGPSILRLFGRAPAYSLSAAHAGHSHGGHATHSHAGHSHAAHSLSAHAHSHAVHGHDDHDHDHSHDHHDHAAHDHHHDHGTHAHHDHAHHDHAAVEVCETCGHSHAPDPALLSGDRFDWRTAWSAVAAVGIRPCSGALIVLSFALLNGLWLGGLLSVFAMSLGTAITVSALATLAVTAKNWAVYFAGDGRMGNRIHSIVEIGGAAFVFLFGLLLLSASLTGSV
>NZ_CP033366.1|WP_032931546.1|2006362_2007340_+|SDR-family-oxidoreductase
MRILITGAAGMVGRKLIARLAKDGTLRGKAITALDLHDIVSPQAPAMEGVSISTHTGDLAEAGAAESLVASRPDVVFHLAGIVSGEAEANFELGYRVNLDGTRALFDAIRLAGFAPRVVFTSSIAVFGAPFPDVIPDDFHPTPLTSYGTQKQMSEALLADYSRRGFFDGIGIRLPTICVRPGKPNKAASGFFSGIIREPLSGQEAILPVPRSVVHPHASPRSAVNFLIHAAEIDGAVVGPRRNLTMPGVAVTVGEQIEALERIAGPKVVKLIREVPDETIWAIVKGWPTRFEANRSRELGFSAEKSFDEIIRAHIEDELDGQIPG
>NZ_CP033366.1|WP_010911327.1|2006137_2006350_+|hypothetical-protein
MMDRDTRNAAVAALWIMLLFGIAAFYLPTVMLALGSLSTVLAGIFGIVFVLAFFLVFWLRARSQRKNQGK
>NZ_CP033366.1|WP_032931547.1|2005077_2006055_+|cation-transporter
MAHSHDHSGHDHDGAGHVHGATDKKRVLIAACLTAGFMVAEALGGLFTGSLALLADAGHMLADAIALGLAWYAFHLAGRPATGQLTYGFGRVKTLVAYTNGIAIFVIALWIVYEAWQRLLTPAPVLGGPMLVVAILGLLVNIGSFLVLHGGDRESLNMRGAILHVLGDLLGSAAAIVAAVVILVTGWTPIDPILSVLVSLLILSTAWSLMRAAAHVLLEGVPPSLDRDLIATDLETTIQGVREVHHMHVWSIDGSSNMATLHACLDEGVDAHRAVSAIKKRLASEHGISHATVEPEFGQCADEAGDHEHEHEHEHDAAAHHSHHH
>NZ_CP033366.1|WP_010911329.1|2004359_2005046_+|GNAT-family-N-acetyltransferase
MSENLRDWQARPRPERKAIDGRYVRLEPLSAAKHGDGLYEASSVSDVDGRFAWLPDYPPETRPAFQPWLDKVEASEDPLFFAVIDKASGKVAGRQTLMRIDPAYGVIEIGNIYWGPLISRKPGATEAQFLFMKYIFDELGYRRYEWKCNNRNEPSKRAAERFGFKFEGIFRQHLIVKGENRDTAWYSIIDKEWPALRKAYEAWLDPANFDGAGQQKRRLEDCRAEFGA
>NZ_CP033366.1|WP_032931548.1|2003091_2004276_-|pyridoxal-phosphate-dependent-aminotransferase
MLHTISAFDRLGEENAFAVLARATALAQQGRDIVNLGIGQPDFKTPQHIVEAAIKALRDGHHGYTPANGLLATREAVVRRTLTTTGVEVSPETVMILPGGKPTMFAAILMFGEPGAEILYPDPGFPIYRSMIEFTGAAPIPVPMREENGFAFSAEETLALITSKTRLLILNSPANPTGGVTPRAEIEKLVKGLEKHPDVAILSDEIYDVMTYDGETHCSLLGFPEIRDRLIVLNGWSKTWAMTGWRMGWSIWPNGDKGAHLYDKVRKLAVNCWSCVNAPSQFAGIAAIDGPQDDVDTMMRAFDRRRKVVVEGLNALPNISCITPKGAFYAFPNVSKTGWKAKKLASALLDDAGVALIGGPDFGILGEGYVRLSYANSEENILRALERIGAFLSK
>NZ_CP033366.1|WP_032931549.1|2002565_2002940_-|YciI-family-protein
MFYAILAYHVEDAIKALTPQEDAALMADLLKINTRLREEGTLGPSARLGATQDAFTLRGPGDGVVIDGPFAETKEQLLGLYVVDCATRDKAIAIARDLRRVNSTAVYEIRPILLFKPGAPLAGK
>NZ_CP033366.1|WP_032931550.1|2001776_2002532_+|SDR-family-oxidoreductase
MTEERTAIVTGAGTGIGKSVATALLNAGWNTVFCGRRKAVLDAAIVEAGRTEAKALAVACDISKAGEVDDLFETVAEAFGRVDLLFNNAGMGYKSTPIDEIPVEVWNDIVGVNLTGSFLCARAAFGAMRKQRPMGGRIINNGSVSAYAPRPGSVPYTATKHAITGLTKTLALDGRPYDIACGQIDIGNALTDMAQPMTVGVPQANGSIAAEAVMDVQHVADAVVHMASLPLEANVLFMTVMATKMPFVGRG
>NZ_CP033366.1|WP_044548303.1|2001600_2001780_+|hypothetical-protein
MTALFVGPRWAFSENRAPFFEDMPMQVRLPSLPSFAIPSAEPNPEDQSGTLGAAGGHQP
>NZ_CP033366.1|WP_010911323.1|2009459_2010359_-|LysR-family-transcriptional-regulator
MDTLTRMRAFIDVVEAEGFSAAARKIGRSKALLSKYVRELEDELGALLLNRTTRQFSMTEAGHTYYRRASEIVREVDSLADAVRESSGDVRGRIKLSAPRTFADAPIGQSLIDFAKQHPDIVLDIQLDDRFVDLVEEGFDLAVRISRLENSSLIARRLAPFSVKLCASPELIAKHGMPTRPQDLGHMPCIVDTNGRGLNNWAFKGDNNDQLSVAVAGPIEVNSPMAARAAALSGLGFCILPDFIASPDLKSGQLVTALDDRILSGGGIFAVYPHRRYLPAKVRVFVDFLVQWFRTREVA
>NZ_CP033366.1|WP_032931543.1|2010362_2011559_-|amidase
MTGTHGPYNAFLDLRQMPVAHAELGPLAGLRLAVKDIYDVAGYRTGCGNSRKFAESNAASRTAPAVQTILDAGARFVGKTQTDELAFALFGQNAHFPFPVNPAAPDRVTGGSSSGSASAVAGRLADIATGSDTGGSIRAPASFCGLIGLRTTHGRIALDGTMKLAPSFDTFGWFADDIETYETVGKLLLGRDPHQHSLDRPISLTWLDEMVARPALGEYAAMKALAGAVFGMPATSTTRFSSSPDELYWCFRRLQAREAWGVHGEWITSGERDLGPGVEERFGFGRAVDDRTAQAENVRRLTFRGELSALLGQDGFLVLPTVPGPAPYVDSTPEQFQAYRERALHLLCLAGLSGFPQITLPIGSVAGAPFGLSLLGPSGSDIALIRLGRKLLDAAQRA
>NZ_CP033366.1|WP_010911321.1|2012101_2013235_+|type-III-PLP-dependent-enzyme
MATQRILDFLATRRPSGPCLVVDLDVVRDNFRAFEKALPDSKIYYAVKANPAPEILRLLAAMGSSFDTASVAEVEMAMDAGAPADRISFGNTIKKERDIARAYQLGIRLFAVDCVEEVEKIARVAPGARVFCRVLTDGEGAEWPLSRKFGCVPAMAVDVLRHAKGLGLDAYGVSFHVGSQQTDLTAWDRALADAKKVFATLAEEGIVLKMVNMGGGFPTRYLRDVPAAQAYGQAIFSALRKHFGNAIPETIIEPGRGMVGNAGVIKSEVVLISKKADNDNVRWVFLDIGKFGGLAETMDEAIRYPLVTRHDGSETAPCVLAGPTCDSADVMYEKTPYPLPLSLTIGDEVLIEGTGAYTTTYSAVAFNGFEPLRSYVI
>NZ_CP033366.1|WP_032931542.1|2013387_2013957_+|N-acetyltransferase
MEMSVEIVAHVPAFSMVAETVADVAAREALLDRAMGPMRRKKSSEKLRRGRRPSEGLAFVARDASGGVAGTVRLWDVRLGEGGPAALLLGPLAVDPSLKNAGIGSALMRHAVAEAARLGHAAILLVGDAPYYGRFGFSADKTGRLAMPGPYERHRLLALELVEGALDGVHGTLKACGRKLKAQAPTLAA
>NZ_CP033366.1|WP_032933730.1|2014047_2014332_-|SCP2-sterol-binding-domain-containing-protein
MSVQEIAEKIKSRVASSGFDRSVKFDTGGDGVIVIDGATVSTTDAPTDCTIKLSLEDLDSLIAGDLNPTMAFMTGKIKVEGDMTVAMALSQLIG
>NZ_CP033366.1|WP_032931541.1|2014513_2015050_-|hypothetical-protein
MIKIIAIAVWVCAATLGAVFYSFQAAGERGVGEKPKPMLGGLDYVKTDVISVPLIRDSKIGGYFLAKLVYTVEPEQIKKLSIPAEALITDQVYSYLYANPQIDFTKKATIDLDAFRAAIRDTVNTRVGANLVHEVLVDQVNFLSKDEIRDNWLRRRQDSDTAAAETAKPAEADAPPAH
>NZ_CP033366.1|WP_032931540.1|2015180_2015606_-|hypothetical-protein
MADSSEFTANLPARTAGSEAPIPFARPGNLAAIIGRIEEVVEEETAGIRSDTSYDLKASNARKSRYLYELTRAMKGGSEAEFLEQHREGLTRLRQKLAKNEAAILAHLSAVNEVAGLLRSAIQRAETDGTYSAGEFGRMKG
>NZ_CP033366.1|WP_032931539.1|2015619_2016249_-|rod-binding-protein
MVWLRKTGKRRTFLAISPPSDIVMDVARAADPMDIEAARAALTKRAGGAAGAFSIDTPGSLDTAASVDAGSVLSRATADKAAATADPAKKFKKFEAMVLQTFIQNMLPKDTEGVYGTGLAGDMWKSQLAERVADVMAERGGIGIAKSLVADHYMDGKRKVPIGPVSDGPEKTEIDQQTRLSTSLVQELQRKAARSMTGDETTIKTDIKI
>NZ_CP033366.1|WP_032931538.1|2016505_2017546_+|aminopeptidase
MLAAVIVASGLAGCTSISYYAQSVEGHVQIMAARKNVGRLIRDPSTPEALRAKLTSASAIRRFATEELALPDNSSYRTYVDIGRADVTLAVFAAPRFSLTPITWCFPVFGCVPYRGYFSRKSAAESAAELQRQGLDVYVSGVTAYSTLGWFSDPLLSTMLRQDDTYIASLIFHELAHQKIYVNNDSAFNEAFAVAVETSGVRKWLRATGDRAGLRRYETKRKRQADFLGLIAETRDELRQVYGSPRAPEQMAAAKAATIDRLRMRYRQMRDRRWAGYRGYDAWFDAPINNAKLAATAVYGEQVPAFLHLFNLCSGDYPRFYASVRRIADLHEPSRAEALKAADTCG
>NZ_CP033366.1|WP_051402011.1|2017564_2018134_-|GNAT-family-N-acetyltransferase
MEAVRFPKLTTPRLVLRSPSERDIPAWFARATDVESASLAGDPVPDDIRAGERWLARSRQRFADGKAIQWSIDQAGVSDAIGTITLSFDATGAKAAALGFVLARAHWGHGLGSEAAREVLRYAFETLALEQVTAEAATRNLASLRIMAKLGFKHIESFIDDTDGERCERFALDADIGSSLLASNAMPGC

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP033366_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP033366_2

2973911-2974031

Orphan

Consensus_repeat	Method
AGAGCAATTCCAGGAAAAGTGTGAAACGGTTTTCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP033366_2

>merge|NZ_CP033366|2|2973911-2974031|CRISPRCasFinder
AGAGCAATTCCAGGAAAAGTGTGAAACGGTTTTCCCGGGAAAGCGCGTGGCGCTTTCCCTAGGGAATTGCGTCAAAACAAAGAGTGAGAGCAATTCCAGGAAAAGTGTGAAACGGTTTTCC

>NZ_CP033366|2|2|2973911-2974031|CRISPRCasFinder
AGAGCAATTCCAGGAAAAGTGTGAAACGGTTTTCC	CGGGAAAGCGCGTGGCGCTTTCCCTAGGGAATTGCGTCAAAACAAAGAGTG
AGAGCAATTCCAGGAAAAGTGTGAAACGGTTTTCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP033366.1\|WP_032930880.1\|2983800_2984787_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP033366.1\|WP_010910361.1\|2970745_2971489_-\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP033366.1\|WP_032933540.1\|2977370_2978600_+\|MFS-transporter	unknown	unknown	gnl\|CDD\|340913
NZ_CP033366.1\|WP_010910364.1\|2968095_2968539_-\|SRPBCC-family-protein	unknown	unknown	gnl\|CDD\|176863
NZ_CP033366.1\|WP_032930886.1\|2969691_2970690_-\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP033366.1\|WP_010910366.1\|2966742_2967225_-\|(2Fe-2S)-binding-protein	unknown	unknown	gnl\|CDD\|224991
NZ_CP033366.1\|WP_169627197.1\|2978734_2979769_+\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380489
NZ_CP033366.1\|WP_032930882.1\|2980076_2981204_+\|ABC-transporter-substrate-binding-protein	unknown	unknown	gnl\|CDD\|380653
NZ_CP033366.1\|WP_032930888.1\|2967285_2968080_-\|FAD-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|224238
NZ_CP033366.1\|WP_032933541.1\|2965249_2966617_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP033366.1\|WP_032930884.1\|2974065_2975004_-\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|224995
NZ_CP033366.1\|WP_010910368.1\|2964243_2965248_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	unknown	unknown	gnl\|CDD\|224446
NZ_CP033366.1\|WP_032930887.1\|2968658_2969486_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225117
NZ_CP033366.1\|WP_032930883.1\|2976901_2977192_-\|DUF3175-domain-containing-protein	unknown	unknown	gnl\|CDD\|337995
NZ_CP033366.1\|WP_010910360.1\|2971938_2972928_+\|sugar-binding-protein	unknown	unknown	gnl\|CDD\|380537
NZ_CP033366.1\|WP_010910352.1\|2981279_2982827_+\|sugar-ABC-transporter-ATP-binding-protein	unknown	unknown	gnl\|CDD\|224053
NZ_CP033366.1\|WP_032930885.1\|2973114_2973897_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097
NZ_CP033366.1\|WP_010910357.1\|2975122_2976013_+\|NAD(P)-dependent-oxidoreductase	unknown	unknown	gnl\|CDD\|223528
NZ_CP033366.1\|WP_032930881.1\|2982823_2983804_+\|ABC-transporter-permease	unknown	unknown	gnl\|CDD\|224093
NZ_CP033366.1\|WP_027047041.1\|2976120_2976897_+\|FadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|225097

Protein	Function_ID	Function_description	E-value
NZ_CP033366.1\|WP_032930880.1\|2983800_2984787_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	8.38383e-68
NZ_CP033366.1\|WP_010910361.1\|2970745_2971489_-\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	3.65783e-110
NZ_CP033366.1\|WP_032933540.1\|2977370_2978600_+\|MFS-transporter	gnl\|CDD\|340913	cd17355, MFS_YcxA_like, MFS-type transporter YcxA and similar proteins of the Major Facilitator Superfamily of transporters. This group is composed of uncharacterized bacterial MFS-type transporters including Bacillus subtilis YcxA and YbfB. YcxA has been shown to facilitate the export of surfactin in B. subtilis. The YcxA-like group belongs to the Monocarboxylate transporter -like (MCT-like) family of the Major Facilitator Superfamily (MFS) of membrane transport proteins. MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	2.65943e-55
NZ_CP033366.1\|WP_010910364.1\|2968095_2968539_-\|SRPBCC-family-protein	gnl\|CDD\|176863	cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins. The PYR/PYL/RCAR-like family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. PYR/PYL/RCAR plant proteins are receptors involved in signal transduction. They bind abscisic acid (ABA) and mediate its signaling. ABA is a vital plant hormone, which regulates plant growth, development, and response to environmental stresses. Upon binding ABA, these plant proteins interact with a type 2C protein phosphatase (PP2C), such as ABI1 and ABI2, and inhibit their activity. When ABA is bound, a loop (designated the gate/CL2 loop) closes over the ligand binding pocket, resulting in the weakening of the inactive PYL dimer and facilitating type 2C protein phosphatase binding. In the ABA:PYL1:ABI1 complex, the gate blocks substrate access to the phosphatase active site. A conserved Trp from PP2C inserts into PYL to lock the receptor in a closed formation. This group also contains Methylobacterium extorquens AM1 MxaD. The mxaD gene is located within the mxaFJGIR(S)ACKLDEHB cluster which encodes proteins involved in methanol oxidation. MxaD may participate in the periplasmic electron transport chain for oxidation of methanol. Mutants lacking MxaD exhibit a reduced growth on methanol, and a lower rate of respiration with methanol.	4.80507e-42
NZ_CP033366.1\|WP_032930886.1\|2969691_2970690_-\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	1.86486e-83
NZ_CP033366.1\|WP_010910366.1\|2966742_2967225_-\|(2Fe-2S)-binding-protein	gnl\|CDD\|224991	COG2080, CoxS, Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion].	3.96222e-71
NZ_CP033366.1\|WP_169627197.1\|2978734_2979769_+\|substrate-binding-domain-containing-protein	gnl\|CDD\|380489	cd01575, PBP1_GntR, ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. This group represents the ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators. The ligand-binding domain of GntR is structurally homologous to the periplasmic sugar-binding domain of ABC-type transporters and both domains contain the type 1 periplasmic binding protein-like fold. The LacI-GalR family repressors are composed of two functional domains: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal ligand-binding domain, which is homologous to the type 1 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcription repressor undergoes a conformational change upon ligand binding, which in turn changes the DNA binding affinity of the repressor.	1.12066e-118
NZ_CP033366.1\|WP_032930882.1\|2980076_2981204_+\|ABC-transporter-substrate-binding-protein	gnl\|CDD\|380653	cd19998, PBP1_ABC_sugar_binding-like, monosaccharide ABC transporter substrate binding protein such as CUT2. Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type 1 periplasmic binding protein superfamily, which consists of two alpha/beta globular domains connected by a three-stranded hinge. This Venus flytrap-like domain undergoes transition from an open to a closed conformational state upon ligand binding. Members of this group are predicted to be involved in the transport of sugar-containing molecules across cellular and organellar membranes; however their substrate specificity is not known in detail.	7.03343e-142
NZ_CP033366.1\|WP_032930888.1\|2967285_2968080_-\|FAD-binding-domain-containing-protein	gnl\|CDD\|224238	COG1319, CoxM, Aerobic-type carbon monoxide dehydrogenase, middle subunit CoxM/CutM homologs [Energy production and conversion].	4.89628e-59
NZ_CP033366.1\|WP_032933541.1\|2965249_2966617_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	5.03527e-134
NZ_CP033366.1\|WP_032930884.1\|2974065_2975004_-\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|224995	COG2084, MmsB, 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism].	1.35783e-101
NZ_CP033366.1\|WP_010910368.1\|2964243_2965248_-\|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit	gnl\|CDD\|224446	COG1529, CoxL, Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL homologs [Energy production and conversion].	1.26105e-93
NZ_CP033366.1\|WP_032930887.1\|2968658_2969486_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|225117	COG2207, AraC, AraC-type DNA-binding domain-containing proteins [Transcription].	4.1828e-26
NZ_CP033366.1\|WP_032930883.1\|2976901_2977192_-\|DUF3175-domain-containing-protein	gnl\|CDD\|337995	pfam11373, DUF3175, Protein of unknown function (DUF3175). This family of proteins with unknown function appears to be restricted to Proteobacteria.	4.18613e-48
NZ_CP033366.1\|WP_010910360.1\|2971938_2972928_+\|sugar-binding-protein	gnl\|CDD\|380537	cd06314, PBP1_tmGBP, periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs. Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs from other bacteria. They are members of the type 1 periplasmic binding protein superfamily which consists of two domains connected by a three-stranded hinge. TmGBP is specific for glucose and its binding pocket is buried at the interface of the two domains. TmGBP also exhibits high thermostability and the highest structural similarity to E. coli glucose binding protein (ecGBP).	1.03638e-90
NZ_CP033366.1\|WP_010910352.1\|2981279_2982827_+\|sugar-ABC-transporter-ATP-binding-protein	gnl\|CDD\|224053	COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism].	0
NZ_CP033366.1\|WP_032930885.1\|2973114_2973897_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	9.94603e-57
NZ_CP033366.1\|WP_010910357.1\|2975122_2976013_+\|NAD(P)-dependent-oxidoreductase	gnl\|CDD\|223528	COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism].	7.31453e-42
NZ_CP033366.1\|WP_032930881.1\|2982823_2983804_+\|ABC-transporter-permease	gnl\|CDD\|224093	COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism].	3.55416e-63
NZ_CP033366.1\|WP_027047041.1\|2976120_2976897_+\|FadR-family-transcriptional-regulator	gnl\|CDD\|225097	COG2186, FadR, Transcriptional regulators [Transcription].	2.08088e-61

>NZ_CP033366.1|WP_032930885.1|2973114_2973897_+|FadR-family-transcriptional-regulator
MPQDKAKKQASRAKAQASRDPAVVRRADAAHFPGSSVHASLASEIGLRIVRGDYPPGSILPNEAKWAETFNVSRSAVREAIKMLMAKSLLASRPKIGSWVEPKERWNLLDRDVLAWYATAPDREAFLRTVQEFRHIIEPEASAFAAMRRSDEQMAEISLACREMGEAANLPERIRADTRFHLAILRASGNDLLVPLGVLIESALDHLFIFTTRQVGDQNRAQKLHEAIEKNIRLQRPAAARNAVHKLLADTDEGIGSRRR
>NZ_CP033366.1|WP_010910360.1|2971938_2972928_+|sugar-binding-protein
MRKTVLLAAVAAMALGAGPALAKKQLVIVVKGLDNPFFEAIHQGCEKWNKENASSEYACFYTGPASTSDEAGEAQIVQDMLSKPDTVAMAISPSNAPLIAQTIKSANPSIPIMTVDADLAKEDAALRKTYLGTDNYLMGKKIGEYIKKAKPKGGTICTIEGNPAADNILRRAQGMRDALTGKEGLATLAGEGGWTEVAGCPVFTNDDGAKGVQAMTDILAANPKLDAFGIMGGWPLFGAPQPYRDLVGPLKDRLAKNDFVIGAADTIGDEVAIAKDGLVTALVGQRPFEMGYKAPSVMIDLITGKKVDDPVFTGLDECTKDTVDTCIQK
>NZ_CP033366.1|WP_010910361.1|2970745_2971489_-|sugar-ABC-transporter-ATP-binding-protein
MAVLELTNISKHFGAIQAVNDVSLSIEPGQVVGLMGDNGAGKSTLVKMIAGNFHASHGTMRMDGKELILNKPAEARQHGIEIVHQDLALCNNLTAAANVYLGRELRRGFGPFRILDYAAMYKRAGQLFAELKSETRPRDLVKQMSGGQRQAVAIARTMLSQAKIVLMDEPTAAISVRQVAEVLNLIRHLRDQGIAVVLISHRMPDVFDVADRVIVMRRGRKVADKAIASSSPEEVTGLITGAIEQVS
>NZ_CP033366.1|WP_032930886.1|2969691_2970690_-|ABC-transporter-permease
MAVTLDQTIAQKQHSFFSRLFSTQTFWVVIAVILACIFLSFATDAFATSKNLYNITRNITFVAIVALGMTFVIITGGIDLSVGSVLCLSSMVLAVTMHAGYSIEIGILASIATALAIGAFNGILTAYLGFPPFVVTLGMLSIARSLAMVASNNTVVFQFGPDHDKLLALGGGAWVFGIANPVLYMILLALITGFILRWTKFGRHIFAIGGNEHAATLTGVPVKQIKVAVYMISALSAGIAGIIQTGWLGAVTTNLGTGMELQVIAATVIGGANLAGGVGTAFGAIVGAALIEVIRNSLGLLGINAFWQGTFIGGAILLAVLFDRIRNFRRSD
>NZ_CP033366.1|WP_032930887.1|2968658_2969486_-|helix-turn-helix-transcriptional-regulator
MTEAIRLYWGRFGHVSVLNVASDFVTHAHVEAHLIIWLEGTAGEMTIGRETVRLGPRTAAGINSFQPHSHVLSQNGTPGLFLAFYIDPDWARRRRDLPSSAPLFAQAAITLEPWLHQAAGSLLDHLTDNESVDDVANYEIERFIDSVLDAADASAPQEARTRINTMQDFRVRKAIQLMKANVCERISFDDVARSVGLSRPHFFALFKEQTNLTPNVYWNTLRMEEAVRQLQWSQEPLISVACNLGFTTQGNFSRFFRDHVGVPPTLYREAARANA
>NZ_CP033366.1|WP_010910364.1|2968095_2968539_-|SRPBCC-family-protein
MAKVTISSVIDAPVEKVWARIRDFNGLPCWHPRMVESHIEDGKNASTIGCVRNFELITGARLREKLLDFSDENFLVSYSILETPQPLTNHKATLQLRRVTDGDRTYAEWTASFDAAPEEADKIAAGMGANVFQGGFNALKSHFSGQD
>NZ_CP033366.1|WP_032930888.1|2967285_2968080_-|FAD-binding-domain-containing-protein
MALALQTFPTVKDANAALKAAGTRYLGGGTLVVRAANEGDVSVFGLIRATDPALSAIAVADGKVRIGASVTMAAIARHPELGALAKAARAVGGPAIRNMATIGGNLFAPAPYGDFAVALLALDATVGTEDGELPIEIFLARRDGSRSIVTSVSFTLPKADGFRFLKVSRVKPKGVSVLSIAAVLERAADGTVSSARIALGCMADRPVRAKAAEKALEGKKLDQNGIAAALAAATEGIAPITDPIASAWYRAEVLPVHLGRLLLT
>NZ_CP033366.1|WP_010910366.1|2966742_2967225_-|(2Fe-2S)-binding-protein
MAKVPVQFILNGSEKAEFIDSGTTLLNALRDKIGDTSPKGGCHQGTCGACSVIIDGELRLSCLTLAETCDGAAITTTSGLAEGGVLHPLQRAFLDTFATQCGFCTPGMIMAAKVLLDQTPNPSRDEVVEALSGNICRCTGYEPIIQAVLTAARANSQNAA
>NZ_CP033366.1|WP_032933541.1|2965249_2966617_-|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MELRKNYFADVRKDDLHEIGQPRPRSDSPGHVTGKTAFFADRSFPGMLHLKMVRSPHHHARIRSIDTSEAEKHPGVVKVLTAKDVPHNVYTILILIQIGPEDETVLADGKVRWKGEAVVAVLAETERAAQEAAAKVKIDYEVLPAVFDMEEALKPGAPLVNEYHGQNYYLYDSGECRKVRFGDVEAGFAGADHILEQSYQSSPIEHAPTETTGCVVAPEGNDRFTCYTNTQAMFFTLDNTSIILQMPGSKLHFVGGTVGGGFGGKVDVIVEPIAILGAKLTGRPVCFIYSREEEMQISSPRAAEKVVIKDGVMKDGRIVARKVTGYTDAGAYSRHSPYGAQKGAGHYPGPYTIPNVWIDTYCVYTNRTPSSAMRGFGVTIGDFALEVQMDKLARLIGMDPLEFRFINAYRDGDMKAHRQPTEGAALIECMQEASRAANWPVAEEFMAMSSYRKGA
>NZ_CP033366.1|WP_010910368.1|2964243_2965248_-|xanthine-dehydrogenase-family-protein-molybdopterin-binding-subunit
MAIRRGRGVAAINYPTGMNLGGDPTQALVHSTPTGNFMVTLSSVDLGQGMKQIMAQICAETIGVPTDRVVVDTADTDTGPHCMGTFASRGTHRAGNAVIQAAREARQVMLEVAAEELEVNASDLETDGQGNILVKGAPQKSISIFDVALSAHFKRGRSISGRGMFLIPRSYPEKETGAMKPSTCYAHACTVAEVEVDDETGEVTVLTVKNVFEIGRALNPKMVEQQLVGGSWMGISHALYETTEPYYPNRDHGGTDFNQYLMPGPGDLAQTEIIVLERPSADGPYGAKGPGEMCANPQIPAVANAVFDAVGVRIDTLPITPERILRALKAQAAN
>NZ_CP033366.1|WP_032930884.1|2974065_2975004_-|NAD(P)-dependent-oxidoreductase
MNTTTAREKIGFIGLGLMGHGIAKNIVDKGYPLTFLGRKNRKPAEDLLGRGAREASTSRDVAVASDIVFICVTGSREVEAIIRGPGGLKEGLKKGSVVVDCSTSDPVSTVALAAELKALGIDYVDAPLSRTPKEAWEGTLDAMVGAPDAVFARVKPVIETWAGRIVHIGDTGDGHRMKLLNNFISLGYAAIYSEALALAEKVGISPPRFDSVIRNGRMDCGFYQTFMRWTLEGDRDAHKFTIANAFKDLTYLESMAGAAGIANPLGNATKNSFAGAHATGPAEQFVPMLATHIGKVNGVDLMPTKDGKKQTI
>NZ_CP033366.1|WP_010910357.1|2975122_2976013_+|NAD(P)-dependent-oxidoreductase
MTKRIMFTGGSGKAGRHVVQYLVEQGCQVLNIDTKPLDNPKVRTLITDITDSGQVFNALSSYMGLHEFDPSLRPQPVDAVVHFAAIPRIMITPDNEVFRINAMGTYNVIEAAVKLGIRKVIVASSETTYGLVFANEPRDPKYFPLDEEYDVDPMDSYALSKVVNEKTARAFAQRNGTDIYALRIGNVIEPHEYSLFPKWFADPGFRKRIAWSYIDARDLGQITLRAIEKDGLGYQVFNAANDDTSSDLPTAELLKRFYPNVPVKAALGEYETLLSNRKARDMLGFRPEHSWRKYVK
>NZ_CP033366.1|WP_027047041.1|2976120_2976897_+|FadR-family-transcriptional-regulator
MRDAKPNKEKSPKKPASAERPSGVRRPDAARIPGASVHTSLASEIGLRIVRGDYPPGTILPNEAKWSETFSVSRSAVREAIKMLMAKSLLASRPKIGSWVEPRERWNLLDRDVLAWYATSPDREVFLKTVQEFRHIIEPEATAFAAMRRTDEQMAEISQACREMGEAASLQERTRADTRFHLAILRASGNDLLVPLGVLIESAFDHLFTFTTRAVDDLNHVQKLHEAIEKNIRLQRPDAARAAVRKLLANTDHVIKSR
>NZ_CP033366.1|WP_032930883.1|2976901_2977192_-|DUF3175-domain-containing-protein
MTPARQKWSAEVTEHSNAMDLEDHIFEADDAKKIAASLKRSAVHSHRRKAEPFQSAMSMLNFYINRAGKNLPAARRQVLERAKDELRVAFDREKED
>NZ_CP033366.1|WP_032933540.1|2977370_2978600_+|MFS-transporter
MTRTDFSRPSPGIDSSYAWMRLAISMVLATIGAVGMWAVVVVLPAVQGEFGVDRAAASMPYTATMVGFAAGNVLVGRAIDRMGYWIPALISSVALSAGLLLAALSTSILQFTLAQGVLIGVGTSVIFGPLIADISHWFNRRRGVAVTAAAAGNYLAGALWPTIMPTLIKAEGWRFTYAAIGIFCLVTMVPLVLMLRRGAPEATAAGSPGSRSVQPIPMSPAAMQGLLVVAGLGCCVAMSMPQVHIVAYCMDLGYGMAHGADMLSIMMAAGVVSRLASGFVADRIGGVKTLLIGSVLQCLSLLFYIPFDGLASLYVVSLVFGLSQGGIVPCYAIIVREYLPAKEAGQRIGIVMMATIFGMAIGGWMSGWIYDLTGSYAVAFLNGIAWNLLNIGAIGLFMWKARPRAVMAA
>NZ_CP033366.1|WP_169627197.1|2978734_2979769_+|substrate-binding-domain-containing-protein
MALIKPRSRRGGGRPTIADVARKAGVGAITVSRALREPERVSEELRRQIQAAVDELGYVPDPNARALASARAEVFGVLVPSLTNNVFAEVVRGIYDSLSDSPFRIQLGNTHYSGLEEERLLQLFGSQRPAALIVAGIDQTPTSRKLLENAGCPVVQVMETGPDPVDMMVGFSHFDGGRTATEHLIEAGYRRIGFIGARMDPRSQRRLAGYRAAMEKAGLFDPRLVTTTPLLSSVPLGRELFRDALAKMPTLDGVFCNNDDIALGVLFECHRAAIDVPKTIGIVGFNDLDMMQVAFPSITSIRTHRYEIGRRAVAMALSAIAGNRPEQRIVDLGFELKRRESTAR
>NZ_CP033366.1|WP_032930882.1|2980076_2981204_+|ABC-transporter-substrate-binding-protein
MIKSLVGGIVAATAFVMLSSSAIAAGPEIVKGPAAEPDCFAPWAADTQFFKFPKKAGPYRIALANGYIANTWRIQMVQTAKAYAAQKDVAAKLKEFKVVSTGEDVPAQISAINNFIDSGYDAIVVNAQNPTAFGPVIKRAKEAGVVLVAFDNILDTKDAINVNVDQKGLGELWGKWLVSHVPNGGKVLEVRGVAGTSVDTDRHNGIHEVLDASGKKWAVTEVVGKWDDGVAQKASADAIATNGPFDGVTGQGGDTGIVQAMIDAKHPFVPFGGETENGFRKFCAAHAADGLKCSSAGTGPAQVAVAIKTAIAALEGNVVPQSVKLPLAIVEDPNFKAGQDFFPDQSDNFFVGNSFPTCGINFTAQEIMGQTKADQ
>NZ_CP033366.1|WP_010910352.1|2981279_2982827_+|sugar-ABC-transporter-ATP-binding-protein
MDSAVPLFQMEGISKRYGGVRALEKAELVVTSGSIHAILGENGAGKSTLIKVMAGVVAPDEGRMTLDGREVTFLSPAAANQAGIVCIFQELSLVPDLSVADNIVISDPPKRFGMIDRKAQRRVAEEALARAGAADIHPLALVKDLPLSRRQMVEIAKALARKPRILILDEATSALTAADVSKIFGVLKRLRSEGLALLYISHRMNEIAELADQCTVFRNGRNVASYKAGSKSDNEVVELMIGREYSHIFPAKPAAVPATAAPRLEARKLSWTDRLHDISLTVRAGEVVGLGGLDGQGQRELLLAFFGVLRGLSGEVLIDGKPVAIGSPAKARQDGIGMALIPEDRKTEGLMLPMTVRENLSFAALDRLSKGGIIDRAAEQRLIDDMVGLLAIKTAGLDIPVGALSGGNQQKVVIAKWLMRQPRIILLNDPTRGIDVGTKQELYQLMRKLADAGAAILFYSTDYDELIGCCDRVLVLYDGALKRELVGSEITERALIASALNIHGEESPVGLGASA
>NZ_CP033366.1|WP_032930881.1|2982823_2983804_+|ABC-transporter-permease
MKDWRYWLAEQRGTLLALGIFIVMFIIYTSNHPAGFTANVVQTAANKGVLLAFVAMAQTLVVITAGIDLSVGMIFLLTNCLASWLVVGTPMQTALGVIAVLAAGLLCGAINGAIVIYGRLQPIVATIATGAVYYGIGLLLRPFPGGSVNEDLADAMTGRVFDVVPASLVVLFAIVLLIWVPFSRSVLGRAAYAAGSSETAAYMSGVPIRRGKFAAYTLAGLLAAIGGLFLTFFTYTGDAAYASGNAYTLFSIAAVVLGGVSLFGGKGSAIGAIFGALAFRTIGDLLFVFDFDPLWQPLFQGVILLIAVSLGAFALFRVRNRLEWFL
>NZ_CP033366.1|WP_032930880.1|2983800_2984787_+|ABC-transporter-permease
MSETTLGGIAGRMPKFIRRADPAVLTAFACIVLLLFVGSLYSRSFLSPEYLLQQLKVASFLGVIATGMMLVILLGQIDLSVPWSVAAGAMMACAAAAYGPLGVALAIPFGIFCGVLIGVVNGIGVAYLRIPSMIITLATNAVAQGLMVVYTGGFSPQDSATGAMRFLATGFAIPGVPNAVIIWALIGAAMVFVLTRTGFGRTVYGIGNRERAAYLSGIDTRRVVMIAFAVSGGLSAFGGVLLAGYASKAAQSMGDAYLLPSIAAVVLGGTSILGGRGSYLGTVAGVILITLLQSILSVMQMPEAGRQIIYGVVIVAMLLLYGRAPASR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

3478954 : 3485424

uncultured_Mediterranean_phage(100.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044550554.1\|3478954_3479758_+	segregation/condensation protein A	A0A1B1IVW1	uncultured_Mediterranean_phage	8.4e-32	33.1
WP_010909893.1\|3479754_3480519_+	SMC-Scp complex subunit ScpB	A0A1B1IVT7	uncultured_Mediterranean_phage	9.4e-41	46.2
WP_032930543.1\|3480699_3480921_+	twin-arginine translocase TatA/TatE family subunit	A0A1B1IVR9	uncultured_Mediterranean_phage	8.8e-08	63.6
WP_032930542.1\|3480952_3481735_+	twin-arginine translocase subunit TatB	NA	NA	NA	NA
WP_032930541.1\|3481731_3482607_+	twin-arginine translocase subunit TatC	A0A1B1IVR7	uncultured_Mediterranean_phage	1.1e-50	46.3
WP_032930540.1\|3482711_3484016_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	1.8e-100	56.3
WP_032930538.1\|3484015_3484774_+	5'/3'-nucleotidase SurE	NA	NA	NA	NA
WP_032930536.1\|3484770_3485424_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	6.2e-17	37.9

DBSCAN-SWA_2

4594246 : 4618225

Sinorhizobium_phage(52.94%)

tail,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_032929680.1\|4594246_4595476_-	acyltransferase	A0A2H4JA46	uncultured_Caudovirales_phage	9.9e-08	24.1
WP_032929678.1\|4595474_4595720_+	hypothetical protein	NA	NA	NA	NA
WP_065141602.1\|4595728_4597561_-	SGNH/GDSL hydrolase family protein	NA	NA	NA	NA
WP_032929676.1\|4597574_4599872_-	hypothetical protein	A0A076G8H4	Sinorhizobium_phage	2.6e-195	51.8
WP_032929675.1\|4599841_4600249_-	hypothetical protein	A0A076G6J4	Sinorhizobium_phage	8.0e-23	42.2
WP_032929674.1\|4600282_4600483_+	hypothetical protein	NA	NA	NA	NA
WP_032929673.1\|4600521_4600896_-	hypothetical protein	NA	NA	NA	NA
WP_032929672.1\|4600954_4601269_-	hypothetical protein	NA	NA	NA	NA
WP_032929670.1\|4601346_4601979_-	hypothetical protein	A0A076G707	Sinorhizobium_phage	1.7e-67	60.4
WP_032929669.1\|4601982_4602735_-	hypothetical protein	A0A076GD29	Sinorhizobium_phage	1.1e-73	54.0
WP_157279968.1\|4602738_4605525_-\|tail	phage tail length tape measure family protein	A0A076G7H2	Sinorhizobium_phage	4.6e-61	37.1
WP_157279969.1\|4605514_4605793_+	hypothetical protein	NA	NA	NA	NA
WP_032929667.1\|4606076_4606424_-	hypothetical protein	NA	NA	NA	NA
WP_010915293.1\|4606420_4606609_-	hypothetical protein	NA	NA	NA	NA
WP_032929666.1\|4606621_4607356_-	hypothetical protein	A0A076GD25	Sinorhizobium_phage	1.3e-52	49.0
WP_032929664.1\|4607407_4607824_-	DUF4128 domain-containing protein	NA	NA	NA	NA
WP_141245612.1\|4607832_4608423_-	hypothetical protein	A0A076G7D2	Sinorhizobium_phage	9.8e-22	37.3
WP_032929663.1\|4608512_4608962_-	hypothetical protein	A0A076G8G8	Sinorhizobium_phage	1.0e-07	32.3
WP_032929661.1\|4608961_4610002_-	hypothetical protein	A0A076G6I6	Sinorhizobium_phage	2.5e-68	42.5
WP_051402071.1\|4610005_4610365_-	hypothetical protein	NA	NA	NA	NA
WP_032929659.1\|4610387_4610873_-	hypothetical protein	A0A2R3UAR2	Siphoviridae_environmental_samples	3.1e-13	39.9
WP_032933267.1\|4610878_4611211_-	hypothetical protein	NA	NA	NA	NA
WP_032929657.1\|4611221_4612175_-	DUF2184 domain-containing protein	L7TMZ5	Rhizobium_phage	1.3e-71	48.9
WP_032929655.1\|4612189_4612627_-	DUF2190 family protein	NA	NA	NA	NA
WP_032929653.1\|4612630_4613779_-	DUF2213 domain-containing protein	L7TMD6	Rhizobium_phage	1.2e-71	44.1
WP_106406540.1\|4613814_4614024_+	hypothetical protein	NA	NA	NA	NA
WP_032929652.1\|4614106_4615480_-	DUF1073 domain-containing protein	L7TRA1	Rhizobium_phage	1.8e-122	51.0
WP_032929650.1\|4615488_4616877_-\|terminase	phage terminase large subunit	A0A291AYH9	Shigella_phage	4.7e-91	42.7
WP_032929647.1\|4616863_4617328_-	DUF2280 domain-containing protein	A0A125RNL6	Pseudomonas_phage	2.2e-40	60.6
WP_032929646.1\|4617598_4618225_-	hypothetical protein	A0A059VJU8	Pseudomonas_phage	6.7e-53	51.0

DBSCAN-SWA_3

6189978 : 6268745

Paenibacillus_phage(11.11%)

tRNA,transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_152536301.1\|6189978_6190956_-\|transposase	IS1595 family transposase	NA	NA	NA	NA
WP_106406555.1\|6192585_6193382_-\|transposase	IS5 family transposase	A0A0N9SHJ4	Paenibacillus_phage	2.0e-25	49.5
WP_027033261.1\|6194566_6195091_-	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_027033260.1\|6195083_6198050_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_027033259.1\|6198049_6198325_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_027033258.1\|6198343_6199594_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_027033257.1\|6199689_6200646_+	GlxA family transcriptional regulator	NA	NA	NA	NA
WP_106406554.1\|6202080_6203269_+\|transposase	IS3 family transposase	S5WIU1	Leptospira_phage	1.9e-48	41.6
WP_027033253.1\|6203385_6204129_-	amino acid ABC transporter ATP-binding protein	A0A2H4UUX5	Bodo_saltans_virus	2.5e-06	23.3
WP_027033252.1\|6204248_6205223_-	amino acid ABC transporter permease	NA	NA	NA	NA
WP_027033251.1\|6205284_6206118_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_027033250.1\|6206715_6208050_+\|transposase	ISNCY-like element ISMlo5 family transposase	NA	NA	NA	NA
WP_051371477.1\|6208916_6210146_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	2.8e-34	27.0
WP_027033249.1\|6210215_6211175_-	aminotransferase class IV	NA	NA	NA	NA
WP_027033248.1\|6211497_6211953_-	Lrp/AsnC family transcriptional regulator	NA	NA	NA	NA
WP_158673669.1\|6212701_6213859_-	M24 family metallopeptidase	NA	NA	NA	NA
WP_080680520.1\|6214591_6215992_-	MmgE/PrpD family protein	NA	NA	NA	NA
WP_080680393.1\|6216193_6216904_-	gamma-glutamyl-gamma-aminobutyrate hydrolase family protein	A0A2P9FI75	Pseudomonas_phage	1.6e-05	41.2
WP_080680519.1\|6216925_6218062_-	aminopeptidase P family protein	NA	NA	NA	NA
WP_027033242.1\|6220075_6220630_-	sarcosine oxidase subunit gamma	NA	NA	NA	NA
WP_027033241.1\|6220622_6223556_-	sarcosine oxidase subunit alpha family protein	NA	NA	NA	NA
WP_027033240.1\|6223552_6223843_-	sarcosine oxidase subunit delta	NA	NA	NA	NA
WP_027033239.1\|6223850_6225101_-	sarcosine oxidase subunit beta family protein	NA	NA	NA	NA
WP_027033238.1\|6226195_6227233_+\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_027033237.1\|6227709_6228552_-	hypothetical protein	NA	NA	NA	NA
WP_027033236.1\|6228541_6229801_-	diaminobutyrate--2-oxoglutarate transaminase	NA	NA	NA	NA
WP_152536176.1\|6230417_6230651_+	hypothetical protein	NA	NA	NA	NA
WP_027033235.1\|6230819_6231140_+	iron-sulfur cluster assembly accessory protein	NA	NA	NA	NA
WP_027033234.1\|6231166_6231628_+	iron-sulfur cluster assembly scaffold protein	A0A218MKD1	uncultured_virus	3.3e-09	43.9
WP_027033232.1\|6231864_6232500_+	7-carboxy-7-deazaguanine synthase	NA	NA	NA	NA
WP_027033231.1\|6232496_6232850_+	6-carboxytetrahydropterin synthase QueD	S4U060	uncultured_phage	8.2e-08	35.8
WP_027033230.1\|6232854_6233592_+	7-cyano-7-deazaguanine synthase QueC	A0A2I2L6M4	Escherichia_phage	2.0e-43	42.5
WP_027033229.1\|6234077_6235118_+	LacI family DNA-binding transcriptional regulator	NA	NA	NA	NA
WP_167334839.1\|6236165_6236585_+	hypothetical protein	NA	NA	NA	NA
WP_027033225.1\|6237454_6238468_-	1-aminocyclopropane-1-carboxylate deaminase	NA	NA	NA	NA
WP_027033224.1\|6239760_6240081_-	exopolysaccharide repressor protein	NA	NA	NA	NA
WP_027033223.1\|6240118_6240436_-	ferredoxin III, nif-specific	NA	NA	NA	NA
WP_027033222.1\|6240432_6240636_-	hypothetical protein	NA	NA	NA	NA
WP_027033221.1\|6242195_6244196_-\|tRNA	class I tRNA ligase family protein	NA	NA	NA	NA
WP_027033220.1\|6244523_6245303_-	phytanoyl-CoA dioxygenase family protein	NA	NA	NA	NA
WP_027033219.1\|6246064_6247369_-	lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase family protein	NA	NA	NA	NA
WP_027033218.1\|6248744_6249791_-	radical SAM/SPASM domain-containing protein	NA	NA	NA	NA
WP_027033217.1\|6250799_6251543_+	acetoacetate decarboxylase family protein	NA	NA	NA	NA
WP_027033216.1\|6251567_6251969_+	hypothetical protein	NA	NA	NA	NA
WP_027033215.1\|6253487_6254375_-	universal stress protein	NA	NA	NA	NA
WP_027033214.1\|6254473_6255259_-	response regulator transcription factor	NA	NA	NA	NA
WP_027033213.1\|6255283_6255763_-	NifX-associated nitrogen fixation protein	NA	NA	NA	NA
WP_027033212.1\|6255780_6256278_-	nitrogen fixation protein NifX	NA	NA	NA	NA
WP_027033211.1\|6256243_6257626_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifN	NA	NA	NA	NA
WP_027033210.1\|6257635_6259126_-	nitrogenase iron-molybdenum cofactor biosynthesis protein NifE	NA	NA	NA	NA
WP_027033209.1\|6259186_6260728_-	nitrogenase molybdenum-iron protein subunit beta	NA	NA	NA	NA
WP_027033208.1\|6260855_6262361_-	nitrogenase molybdenum-iron protein alpha chain	NA	NA	NA	NA
WP_006331760.1\|6262465_6263359_-	nitrogenase iron protein	NA	NA	NA	NA
WP_152536177.1\|6264378_6264684_+	hypothetical protein	NA	NA	NA	NA
WP_152536178.1\|6264704_6265235_+	hypothetical protein	NA	NA	NA	NA
WP_027033206.1\|6266357_6266804_+	IS66 family insertion sequence hypothetical protein	NA	NA	NA	NA
WP_023772705.1\|6266800_6267157_+	IS66 family insertion sequence element accessory protein TnpB	NA	NA	NA	NA
WP_106406564.1\|6267266_6268745_+\|transposase	IS66 family transposase	A0A0P0ZEB3	Stx2-converting_phage	2.8e-105	43.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP033366

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection