CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046741	Vibrio cholerae strain 3523-03 chromosome 2, complete sequence	0 crisprs	csa3,cas3	0	0	2	0
NZ_CP046742	Vibrio cholerae strain 3523-03 chromosome 1, complete sequence	1 crisprs	cas3,csx1,DEDDh,DinG,csa3,cas7f,cas6f	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

547941 : 619834

106

Staphylococcus_prophage(53.85%)

holin,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_038964128.1\|547941_548886_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_123011828.1\|549138_549210_+	hypothetical protein	NA	NA	NA	NA
WP_055064865.1\|549241_549655_+	NUDIX domain-containing protein	NA	NA	NA	NA
WP_033928096.1\|549885_550311_+	hypothetical protein	NA	NA	NA	NA
WP_000090011.1\|551324_551840_+	hypothetical protein	NA	NA	NA	NA
WP_032482862.1\|551992_552475_+	hypothetical protein	NA	NA	NA	NA
WP_123011650.1\|552535_552670_+	superoxide dismutase	NA	NA	NA	NA
WP_076025842.1\|552690_553608_+	alpha/beta hydrolase	A0A2L2DMU8	Acanthamoeba_polyphaga_mimivirus	4.2e-27	32.1
WP_123011651.1\|553670_553832_+	acetyltransferase	NA	NA	NA	NA
WP_114721771.1\|554375_554801_+	hypothetical protein	NA	NA	NA	NA
WP_080479241.1\|555036_555360_+	DUF3709 domain-containing protein	NA	NA	NA	NA
WP_000221352.1\|555618_555909_-	type II toxin-antitoxin system RelE/ParE family toxin	A0A2H4JBF4	uncultured_Caudovirales_phage	1.6e-17	54.3
WP_019829909.1\|555898_556147_-	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_123011652.1\|557022_557415_+	nuclear transport factor 2 family protein	NA	NA	NA	NA
WP_001893682.1\|557607_557865_+	hypothetical protein	NA	NA	NA	NA
WP_043992912.1\|558044_558512_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_095467781.1\|558680_559184_+	damage-inducible protein DinB	NA	NA	NA	NA
WP_000838533.1\|559365_559596_-	hypothetical protein	NA	NA	NA	NA
WP_123011653.1\|559829_560507_+	hypothetical protein	NA	NA	NA	NA
WP_123011654.1\|560543_561503_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_123011587.1\|561741_562521_+	alpha/beta hydrolase	NA	NA	NA	NA
WP_000057239.1\|562668_563625_+	DUF4263 domain-containing protein	NA	NA	NA	NA
WP_123011829.1\|563585_563732_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_123011640.1\|563760_564165_+	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_033932139.1\|564294_564594_-	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_001107719.1\|564590_564833_-	type II toxin-antitoxin system ParD family antitoxin	NA	NA	NA	NA
WP_000578471.1\|565045_565324_-	type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family	NA	NA	NA	NA
WP_076008603.1\|565320_565605_-	damage-inducible protein J	NA	NA	NA	NA
WP_123011656.1\|565810_566479_+	hypothetical protein	NA	NA	NA	NA
WP_001889218.1\|566612_567011_+	VOC family protein	NA	NA	NA	NA
WP_001008376.1\|567180_567552_+	hypothetical protein	NA	NA	NA	NA
WP_029628683.1\|567710_568094_+	hypothetical protein	NA	NA	NA	NA
WP_002045689.1\|568252_569053_+	PhzF family phenazine biosynthesis protein	NA	NA	NA	NA
WP_114807768.1\|569071_569179_+	exlusion protein FxsA	NA	NA	NA	NA
WP_076025899.1\|569170_569617_-	BLUF domain-containing protein	NA	NA	NA	NA
WP_123011657.1\|570322_570577_+	type II toxin-antitoxin system prevent-host-death family antitoxin	NA	NA	NA	NA
WP_123011658.1\|570566_570833_+	Txe/YoeB family addiction module toxin	NA	NA	NA	NA
WP_000092503.1\|571202_571817_-	hypothetical protein	NA	NA	NA	NA
WP_038964128.1\|571899_572844_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_123011830.1\|573043_573157_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_123011654.1\|573973_574933_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_095482534.1\|575847_576441_+	cell filamentation protein Fic	NA	NA	NA	NA
WP_080475875.1\|576620_576944_+	DUF3709 domain-containing protein	NA	NA	NA	NA
WP_123011633.1\|578501_578984_+	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_123011660.1\|579120_579666_+	hypothetical protein	NA	NA	NA	NA
WP_123011654.1\|579717_580677_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_148039151.1\|580928_581936_+	hypothetical protein	NA	NA	NA	NA
WP_000248697.1\|582073_582388_+	DUF4144 domain-containing protein	NA	NA	NA	NA
WP_000923156.1\|582698_582881_+	DUF645 family protein	NA	NA	NA	NA
WP_123011662.1\|583086_584082_+	hypothetical protein	NA	NA	NA	NA
WP_024700764.1\|584232_584637_+	DUF1801 domain-containing protein	NA	NA	NA	NA
WP_038964128.1\|584685_585630_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_005526655.1\|585960_586386_+	hypothetical protein	NA	NA	NA	NA
WP_123011664.1\|586557_587295_+	SDR family oxidoreductase	A0A0M4JSW6	Mollivirus	9.8e-19	28.5
WP_123011665.1\|587484_587796_+	DUF3709 domain-containing protein	NA	NA	NA	NA
WP_000772130.1\|588112_588349_-	hypothetical protein	NA	NA	NA	NA
WP_069217474.1\|588600_589377_+\|holin	choline kinase	NA	NA	NA	NA
WP_086495616.1\|589593_590775_+	helix-hairpin-helix domain-containing protein	NA	NA	NA	NA
WP_123011666.1\|590771_590891_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_071180065.1\|590974_591238_+	hypothetical protein	NA	NA	NA	NA
WP_095430848.1\|591459_591789_+	hypothetical protein	NA	NA	NA	NA
WP_072599414.1\|591818_591911_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_114710020.1\|591955_592285_+	hypothetical protein	NA	NA	NA	NA
WP_123011654.1\|592331_593291_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_080478887.1\|593684_593807_+	DUF645 family protein	NA	NA	NA	NA
WP_108254100.1\|593825_593864_+	hypothetical protein	NA	NA	NA	NA
WP_055044996.1\|594078_594372_+	hypothetical protein	NA	NA	NA	NA
WP_001106980.1\|594357_594801_-	hypothetical protein	NA	NA	NA	NA
WP_000752393.1\|594790_595111_-	hypothetical protein	NA	NA	NA	NA
WP_000861987.1\|595418_595676_+	type II toxin-antitoxin system Phd/YefM family antitoxin	NA	NA	NA	NA
WP_000229320.1\|595663_595966_+	type II toxin-antitoxin system RelE/ParE family toxin	NA	NA	NA	NA
WP_043993102.1\|596156_596441_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_123011667.1\|596497_596626_+	acetyltransferase	NA	NA	NA	NA
WP_148039152.1\|596586_597498_+	hypothetical protein	NA	NA	NA	NA
WP_057563745.1\|597634_598069_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_057556343.1\|598220_598670_+	GyrI-like domain-containing protein	NA	NA	NA	NA
WP_080390558.1\|598656_598785_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_032479075.1\|598837_599077_+	hypothetical protein	NA	NA	NA	NA
WP_123011669.1\|599418_600342_+	arginase	A0A1V0SD83	Indivirus	7.0e-06	20.4
WP_057556343.1\|600959_601409_+	GyrI-like domain-containing protein	NA	NA	NA	NA
WP_080390558.1\|601395_601524_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_038964128.1\|601922_602867_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_086017798.1\|603539_603650_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005527200.1\|604204_604759_+	hypothetical protein	NA	NA	NA	NA
WP_123011654.1\|604792_605752_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_123011617.1\|606022_606307_+	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000452032.1\|606447_606858_+	hypothetical protein	NA	NA	NA	NA
WP_114721798.1\|606951_607377_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_123011671.1\|607637_608570_+	Abi family protein	A3QSC6	Clostridium_virus	1.7e-28	26.8
WP_123011832.1\|608566_608683_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_142993951.1\|609038_609245_+	hypothetical protein	NA	NA	NA	NA
WP_123011673.1\|609438_609672_+	DUF3709 domain-containing protein	NA	NA	NA	NA
WP_123011674.1\|609681_609882_+	hypothetical protein	NA	NA	NA	NA
WP_038964128.1\|610289_611234_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_123011834.1\|611430_611589_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_123011833.1\|612180_612597_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_000405988.1\|612757_613267_+	N-acetyltransferase	NA	NA	NA	NA
WP_080480573.1\|613537_613705_+	DUF3709 domain-containing protein	NA	NA	NA	NA
WP_032470611.1\|614199_614379_+	DUF645 family protein	NA	NA	NA	NA
WP_123011675.1\|614557_615604_+	hypothetical protein	NA	NA	NA	NA
WP_114763293.1\|615600_615723_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_108315918.1\|616022_616061_+	hypothetical protein	NA	NA	NA	NA
WP_032473198.1\|616266_616731_+	ASCH domain-containing protein	NA	NA	NA	NA
WP_123011654.1\|617133_618093_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5
WP_001894921.1\|618327_618843_+	lipocalin family protein	A0A1W6JNX6	Morganella_phage	1.0e-46	49.4
WP_123011654.1\|618874_619834_-\|transposase	IS30 family transposase	Q9MBM9	Staphylococcus_prophage	4.8e-42	36.5

DBSCAN-SWA_2

732025 : 738991

Vibrio_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000484926.1\|732025_732394_-	hypothetical protein	R9TE55	Vibrio_phage	4.2e-55	89.3
WP_123011723.1\|732571_732820_+	hypothetical protein	O56843	Vibrio_virus	3.1e-38	98.8
WP_000502184.1\|732830_733034_+	hypothetical protein	C3W4P3	Vibrio_phage	2.7e-35	100.0
WP_123011724.1\|733023_734127_+	replication initiation factor family protein	Q8W6E3	Vibrio_phage	7.3e-220	99.2
WP_001284207.1\|734131_734470_+	DUF1293 domain-containing protein	Q858R2	Vibrio_phage	4.9e-58	100.0
WP_001143737.1\|734479_734725_+	single-stranded DNA-binding protein	C3W4N5	Vibrio_phage	4.3e-40	100.0
WP_123011725.1\|734736_734871_+	hypothetical protein	C3W4N6	Vibrio_phage	1.1e-13	97.7
WP_123011726.1\|735012_736527_+	adsorption protein	Q858Q8	Vibrio_phage	1.3e-102	75.4
WP_123011727.1\|736528_736843_+	DUF2523 domain-containing protein	Q8W6D1	Vibrio_phage	6.1e-47	97.1
WP_123011728.1\|736845_738000_+	assembly protein	C3W4P0	Vibrio_phage	1.2e-220	98.2
WP_123011729.1\|738592_738991_-	phage protein	Q858Q4	Vibrio_phage	5.5e-61	92.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046742

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046742_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046742_1

2497781-2497990

TypeI-A

Consensus_repeat	Method
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	PILER-CR
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	CRT
GTGTTCTGCCGAATAGGCAGCCAAGAA	CRISPRCasFinder

3 spacers

cas6f,cas7f,csa3

The CRISPR arrays of NZ_CP046742_1

>merge|NZ_CP046742|1|2497781-2497990|PILER-CR,CRT,CRISPRCasFinder
AGTGTTCTGCCGAATAGGCAGCCAAGAAACGTCTGCGGCGGAGACGGTGGACGGATTGCCGAGTGTTCTGCCGAATAGGCAGCCAAGAAATCAGTCGCAACGCGAGCCAGAGTTTCAGCTAGGTGTTCTGCCGAATAGGCAGCCAAGAAATATGCAAGTGAACAGGAAGTCATCTAAAATAAGTGTTCTGCCGAATAGGCAGCCAAGAAT

>NZ_CP046742|1|1|2497781-2497990|PILER-CR
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	CGTCTGCGGCGGAGACGGTGGACGGATTGCCG
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	TCAGTCGCAACGCGAGCCAGAGTTTCAGCTA
GGTGTTCTGCCGAATAGGCAGCCAAGAAA	TATGCAAGTGAACAGGAAGTCATCTAAAATA
AGTGTTCTGCCGAATAGGCAGCCAAGAAT

>NZ_CP046742|1|1|2497781-2497990|CRT
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	CGTCTGCGGCGGAGACGGTGGACGGATTGCCG
AGTGTTCTGCCGAATAGGCAGCCAAGAAA	TCAGTCGCAACGCGAGCCAGAGTTTCAGCTA
GGTGTTCTGCCGAATAGGCAGCCAAGAAA	TATGCAAGTGAACAGGAAGTCATCTAAAATA
AGTGTTCTGCCGAATAGGCAGCCAAGAAT

>NZ_CP046742|1|1|2497782-2497989|CRISPRCasFinder
GTGTTCTGCCGAATAGGCAGCCAAGAA	ACGTCTGCGGCGGAGACGGTGGACGGATTGCCGA
GTGTTCTGCCGAATAGGCAGCCAAGAA	ATCAGTCGCAACGCGAGCCAGAGTTTCAGCTAG
GTGTTCTGCCGAATAGGCAGCCAAGAA	ATATGCAAGTGAACAGGAAGTCATCTAAAATAA
GTGTTCTGCCGAATAGGCAGCCAAGAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046742.1\|WP_069212616.1\|2491904_2492588_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046742.1\|WP_114717056.1\|2488268_2491886_+\|DUF4145-domain-containing-protein	unknown	unknown	gnl\|CDD\|226581
NZ_CP046742.1\|WP_000936745.1\|2503879_2504221_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	csa3	COG0640_csa3_CAS-I-A	gnl\|CDD\|236654
NZ_CP046742.1\|WP_114717054.1\|2485451_2487059_+\|SAM-dependent-DNA-methyltransferase	unknown	unknown	gnl\|CDD\|223363
NZ_CP046742.1\|WP_114717053.1\|2483003_2484386_+\|diguanylate-cyclase	unknown	unknown	gnl\|CDD\|223989
NZ_CP046742.1\|WP_123011418.1\|2482054_2482363_-\|helix-turn-helix-transcriptional-regulator	unknown	unknown	gnl\|CDD\|238045
NZ_CP046742.1\|WP_158126981.1\|2501948_2502455_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|273638
NZ_CP046742.1\|WP_123011419.1\|2496003_2497035_+\|type-I-F-CRISPR-associated-protein-Csy3	cas7f	cd09737_cas7f_CAS-I-F	gnl\|CDD\|187868
NZ_CP046742.1\|WP_123011427.1\|2511017_2511848_-\|CPBP-family-intramembrane-metalloprotease	unknown	unknown	gnl\|CDD\|376806
NZ_CP046742.1\|WP_123011426.1\|2505868_2507098_+\|organoarsenical-effux-MFS-transporter-ArsJ	unknown	unknown	gnl\|CDD\|340883
NZ_CP046742.1\|WP_123011420.1\|2497046_2497685_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	cas6f	cd09739_cas6f_CAS-I-F:CAS-IV	gnl\|CDD\|187870
NZ_CP046742.1\|WP_123011421.1\|2498267_2500133_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|225253
NZ_CP046742.1\|WP_114717055.1\|2487058_2488234_+\|restriction-endonuclease-subunit-S	unknown	unknown	gnl\|CDD\|341196
NZ_CP046742.1\|WP_114774750.1\|2507661_2510928_+\|chitinase	unknown	unknown	gnl\|CDD\|225862
NZ_CP046742.1\|WP_123011425.1\|2505332_2505830_+\|phosphatase	unknown	unknown	gnl\|CDD\|350355
NZ_CP046742.1\|WP_038939483.1\|2484382_2485249_-\|GIY-YIG-nuclease-family-protein	unknown	unknown	gnl\|CDD\|198394
NZ_CP046742.1\|WP_123011424.1\|2502464_2503049_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|161676
NZ_CP046742.1\|WP_057554272.1\|2504317_2505319_+\|ArsJ-associated-glyceraldehyde-3-phosphate-dehydrogenase	unknown	unknown	gnl\|CDD\|169599
NZ_CP046742.1\|WP_123011422.1\|2500195_2501956_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046742.1\|WP_114717052.1\|2482464_2483001_+\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP046742.1\|WP_038939483.1\|2484382_2485249_-\|GIY-YIG-nuclease-family-protein	gnl\|CDD\|198394	cd10447, GIY-YIG_unchar_2, GIY-YIG domain of uncharacterized hypothetical protein found in bacteria and archaea. The family includes a group of uncharacterized hypothetical proteins, mainly found in bacteria and a few found in archaea, with a GIY-YIG domain that shows statistically significant similarity to the N-terminal catalytic domains of GIY-YIG family of intron-encoded homing endonuclease I-TevI and catalytic GIY-YIG domain of nucleotide excision repair endonuclease UvrC.	1.18258e-37
NZ_CP046742.1\|WP_114717056.1\|2488268_2491886_+\|DUF4145-domain-containing-protein	gnl\|CDD\|226581	COG4096, HsdR, Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms].	0
NZ_CP046742.1\|WP_000936745.1\|2503879_2504221_+\|metalloregulator-ArsR/SmtB-family-transcription-factor	gnl\|CDD\|236654	PRK10141, PRK10141, DNA-binding transcriptional repressor ArsR; Provisional.	2.94409e-27
NZ_CP046742.1\|WP_114717054.1\|2485451_2487059_+\|SAM-dependent-DNA-methyltransferase	gnl\|CDD\|223363	COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms].	1.39742e-56
NZ_CP046742.1\|WP_114717053.1\|2483003_2484386_+\|diguanylate-cyclase	gnl\|CDD\|223989	COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair].	3.3374e-30
NZ_CP046742.1\|WP_123011419.1\|2496003_2497035_+\|type-I-F-CRISPR-associated-protein-Csy3	gnl\|CDD\|187868	cd09737, Csy3_I-F, CRISPR/Cas system-associated RAMP superfamily protein Csy3. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; RAMP superfamily protein; predicted Cas7 ortholog.	5.48457e-151
NZ_CP046742.1\|WP_158126981.1\|2501948_2502455_+\|hypothetical-protein	gnl\|CDD\|273638	TIGR01462, Transcription_elongation_factor_GreA, transcription elongation factor GreA. The GreA and GreB transcription elongation factors enable to continuation of RNA transcription past template-encoded arresting sites. Among the Proteobacteria, distinct clades of GreA and GreB are found. GreA differs functionally in that it releases smaller oligonucleotides. Because members of the family outside the Proteobacteria resemble GreA more closely than GreB, the GreB clade (TIGR01461) forms a plausible outgroup and the remainder of the GreA/B family, included in this model, is designated GreA. In the Chlamydias and some spirochetes, the region described by this model is found as the C-terminal region of a much larger protein. [Transcription, Transcription factors].	2.10059e-18
NZ_CP046742.1\|WP_123011418.1\|2482054_2482363_-\|helix-turn-helix-transcriptional-regulator	gnl\|CDD\|238045	cd00093, HTH_XRE, Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators.	3.93008e-13
NZ_CP046742.1\|WP_123011427.1\|2511017_2511848_-\|CPBP-family-intramembrane-metalloprotease	gnl\|CDD\|376806	pfam02517, Abi, CAAX protease self-immunity. Members of this family are probably proteases (after a isoprenyl group is attached to the Cys residue in the C-terminal CAAX motif of a protein to attach it to the membrane, the AAX tripeptide being removed by one of the CAAX prenyl proteases). The family contains the CAAX prenyl protease. The proteins contain a highly conserved Glu-Glu motif at the amino end of the alignment. The alignment also contains two histidine residues that may be involved in zinc binding. While they are involved in membrane anchoring of proteins in eukaryotes, little is known about their function in prokaryotes. In some known bacteriocin loci, Abi genes have been found downstream of bacteriocin structural genes where they are probably involved in self-immunity. Investigation of the bacteriocin-like loci in the Gram positive bacteria locus from Lactobacillus sakei 23K confirmed that the bacteriocin-like genes (sak23Kalphabeta) exhibited antimicrobial activity when expressed in a heterologous host and that the associated Abi gene (sak23Ki) conferred immunity against the cognate bacteriocin. Interestingly, the immunity genes from three similar systems conferred a high degree of cross-immunity against each other's bacteriocins, suggesting the recognition of a common receptor. Site-directed mutagenesis demonstrated that the conserved motifs constituting the putative proteolytic active site of the Abi proteins are essential for the immunity function of Sak23Ki - thus a new concept in self-immunity.	2.81349e-12
NZ_CP046742.1\|WP_123011426.1\|2505868_2507098_+\|organoarsenical-effux-MFS-transporter-ArsJ	gnl\|CDD\|340883	cd17325, MFS_MdtG_SLC18_like, bacterial MdtG-like and eukaryotic solute carrier 18 (SLC18) family of the Major Facilitator Superfamily of transporters. This family is composed of eukaryotic solute carrier 18 (SLC18) family transporters and related bacterial multidrug resistance (MDR) transporters including several proteins from Escherichia coli such as multidrug resistance protein MdtG, from Bacillus subtilis such as multidrug resistance proteins 1 (Bmr1) and 2 (Bmr2), and from Staphylococcus aureus such as quinolone resistance protein NorA. The family also includes Escherichia coli arabinose efflux transporters YfcJ and YhhS. MDR transporters are drug/H+ antiporters (DHA) that mediate the efflux of a variety of drugs and toxic compounds, and confer resistance to these compounds. The SLC18 transporter family includes vesicular monoamine transporters (VAT1 and VAT2), vesicular acetylcholine transporter (VAChT), and SLC18B1, which is proposed to be a vesicular polyamine transporter (VPAT). The MdtG/SLC18 family belongs to the Major Facilitator Superfamily (MFS) of membrane transport proteins, which are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement.	1.59615e-15
NZ_CP046742.1\|WP_123011420.1\|2497046_2497685_+\|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4	gnl\|CDD\|187870	cd09739, Cas6_I-F, CRISPR/Cas system-associated RAMP superfamily protein Cas6f. CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) and associated Cas proteins comprise a system for heritable host defense by prokaryotic cells against phage and other foreign DNA; Cas6f is an endoribonuclease that generates crRNA; This family is specific for CRISPR/Cas system I-F subtype; Possesses RRM fold; also known as Csy4 family.	1.41059e-48
NZ_CP046742.1\|WP_123011421.1\|2498267_2500133_-\|hypothetical-protein	gnl\|CDD\|225253	COG2378, COG2378, Predicted transcriptional regulator [Transcription].	4.6223e-05
NZ_CP046742.1\|WP_114717055.1\|2487058_2488234_+\|restriction-endonuclease-subunit-S	gnl\|CDD\|341196	cd17515, RMtype1_S_MjaORF132P_Sau1132ORF3780P-TRD1-CR1_like, Type I restriction-modification system specificity (S) subunit Target Recognition Domain-ConseRved domain (TRD-CR), similar to MjaXIP/S.MjaORF132P TRD1-CR1, S.Sau1132ORF3780P TRD1-CR1, S.Mca353ORF290P TRD1-CR1, and other TRD-CR's. The Staphylococcus aureus subsp. aureus MSHR1132 S subunit (S.Sau1132ORF3780P) recognizes 5'... CAAGNNNNNRTC ... 3', and Moraxella catarrhalis S subunit (S.Mca353ORF290P) recognizes 5'... CAAGNNNNNNTGT ... 3'. The recognition sequence of Methanococcus jannaschii S subunit (MjaXIP/S.MjaORF132P) is undetermined. The restriction-modification (RM) system S subunit consists of two variable target recognition domains (TRD1 and 2) and two conserved regions (CR1 and CR2) which separate the TRDs. The TRDs each bind to different specific sequences in the DNA. For example, S.Sau1132ORF3780P-TRD1 recognizes CAAG/CTTG, and S.Sau1132ORF3780P-TRD2 recognizes GAY/RTC. RM systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The host genome is protected from cleavage by methylation of specific nucleotides in the target sites. In type I systems, both restriction and modification activities are present in one enzyme complex composed of one DNA specificity (S) subunit (this family), two modification (M) subunits and two restriction (R) subunits. This model contains both TRD1-CR1 and TRD2-CR2. It may also include TRD-CR-like sequence-recognition domains of various type II restriction enzymes and methyltransferases and type I DNA methyltransferases.	9.75567e-89
NZ_CP046742.1\|WP_114774750.1\|2507661_2510928_+\|chitinase	gnl\|CDD\|225862	COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism].	2.30202e-171
NZ_CP046742.1\|WP_123011425.1\|2505332_2505830_+\|phosphatase	gnl\|CDD\|350355	cd14505, CDKN3-like, cyclin-dependent kinase inhibitor 3 and similar proteins. This family is composed of eukaryotic cyclin-dependent kinase inhibitor 3 (CDKN3) and related archaeal and bacterial proteins. CDKN3 is also known as kinase-associated phosphatase (KAP), CDK2-associated dual-specificity phosphatase, cyclin-dependent kinase interactor 1 (CDI1), or cyclin-dependent kinase-interacting protein 2 (CIP2). It has been characterized as dual-specificity phosphatase, which function as a protein-serine/threonine phosphatase (EC 3.1.3.16) and protein-tyrosine-phosphatase (EC 3.1.3.48). It dephosphorylates CDK2 at a threonine residue in a cyclin-dependent manner, resulting in the inhibition of G1/S cell cycle progression. It also interacts with CDK1 and controls progression through mitosis by dephosphorylating CDC2. CDKN3 may also function as a tumor suppressor; its loss of function was found in a variety of cancers including glioblastoma and hepatocellular carcinoma. However, it has also been found over-expressed in many cancers such as breast, cervical, lung and prostate cancers, and may also have an oncogenic function.	1.22502e-59
NZ_CP046742.1\|WP_123011424.1\|2502464_2503049_+\|hypothetical-protein	gnl\|CDD\|161676	TIGR00041, Thymidylate_kinase, dTMP kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions].	5.39284e-13
NZ_CP046742.1\|WP_057554272.1\|2504317_2505319_+\|ArsJ-associated-glyceraldehyde-3-phosphate-dehydrogenase	gnl\|CDD\|169599	PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated.	0

>NZ_CP046742.1|WP_123011420.1|2497046_2497685_+|type-I-F-CRISPR-associated-endoribonuclease-Cas6/Csy4
MSQRYYFLIRYTNANADYGLLAGRCISQMHLFMVNHHQAMNRVGVSFPDWNESSVGQTIAFVSEDKEMMIGLSFQPYFSLMVNEGLFEISSVYEVPDTSEEVRFVRNQTIGKNFLGSKKRRIKRSMARAELFGIQQSLPVTNEDRVIDSFHQIPISSGSSRQDYILFIQKELADERAESGFNSYGFATNQEKRATVPDLRFNPFDEDSFLVR
>NZ_CP046742.1|WP_123011419.1|2496003_2497035_+|type-I-F-CRISPR-associated-protein-Csy3
MELCTQLNYVRSLSAGKAYFYYLSESGDMCPLNVDRTRLRAPKGSYSEAYKGNKFVDKNVAPQDLAYSNPQFIEECYVKPGVDEIYCAFSLRIRANSLTPDICSDDEVRSKLSMFAKIYKELNGYKELANRYAKNILLATWLWRNRECRNITIEVTTSELDTFVVEHAQKLSWYGHWDGDSTECLERLTAYLERALSDPTEYFYMDVKAKMRVGWGDEVYPSQEFLDSREDGIPTKQLATVELLSGKETVAFHGQKVGAALQSIDDWWHEEADKPLRVNEYGADREYVIARRHVAYGNDFYQLLRNTENWIESMTASESIPNDVHFIMSVLIKGGLFNCAKAN
>NZ_CP046742.1|WP_069212616.1|2491904_2492588_+|hypothetical-protein
MSYLYEYIDELLRLQSRAVEKFKHTGVLGDAREEFLRYQINERLDHVDGRLHKGEVFYQNIEHGQHDIILRRKGTVNPCIGNQVRICSTECVAIIEVKTNAKLTEIRDFERKSKQLKIHNENLLCGMFCYKINGQTSTVLARSGYIFDREYQMFEPDDSKKEYSSIDFIICLDDEEEVNGLSHSKEPIVYSKGFCLVRDSSSYKLFKAPPYSKTLFQEMMRADQSKP
>NZ_CP046742.1|WP_114717056.1|2488268_2491886_+|DUF4145-domain-containing-protein
MSDTVDSKGAQGDSNFAFMDVACGGGSDVYTTRCAEIQTRAKNAERNIKTDPRIAGFYARNALELMVETVFDIDNWLTRPRHDVALMSLIHDSGFKQSLTTNLFPKLKLVIKVGNEAVHSKTTLPQRDALQAVKELHHVLYWFIRTYTPNLDRSQFVVPPFDEALIPQQVSIDAAVATKALSSIKRVQELEKLLEQADKVERDAYLKQLKENEALKAANQALLEQIEQAKQSAEKVTDAHDYNEAETRTYLIDVLLHEAGWKLEHKRDREYPVSGMPISQANPNGNGFVDYVLWGDDGTALAVVEAKRTHRRAEDGQQQAKLYADCLEKQCGVRPVIFYTNGYETYLWDDHFYPPRQVQGFYTKAELELMVKRRTDRKPFFENGQPNSNLVINNDITNRHYQKSAITKLLQDFELEHERKGLFVMATGTGKTRTVISLVDLLVKNNWVKNILFLADRNALLTQAKKNFVKLLPRVSCSILDSSQSKDNIDSRLYFSTYPTMKNLLDRGANERPFGVGHFDLIVVDEAHRSVYSKYRQIFEYFDGFLLGLTATPKDEVEKDTYGIFDLQKGMPTYAYEDEKAYDQGFLVPPTKISVATKFLREGVKYKDLSPEEQEEWENKAELQDRDEVLPSEVNKFLFNQDTAEKMFAQLMSKDEHGGIHVEGGDVIGKTIIFAANNDHALFLEKMFNKNYPKWAGKLARVITFKETYAQSLIDEFSGDENERKDFDPKNPTCRIAISVDMLDTGIDVPEVVNLVFFKVVRSKVKFTQMIGRGTRLCKDLFGPNDDKKTFKVFDYCQNFEYFDANPEGLPVGVAKPVTQQVFEKRVLLSTLLNSKLNNEDFREQNPEDYERYSELNRYQLDMLHHIVSGMNLDNFIVRPKRRAIEPFLDRKYWDNIDDAKFSELENQISQLPTEAEAFNSDEQLNHLSHRFDSLVLTMQLDLLEKGMISEMLRGRVIEFAEQLEAKSTIPAVQAQLQLIQDVQTQEFWQDIHLVTLEELRRKLRNLMFALDKDKKEMVYTNFADEVQGVHDVTNVYKNPSVDLAQYRKKIELYIQDHQDHLTIQKLKRNKAITQADLDVLEGLLLEASGISDVETYREKILQEKPLGTFIRQLVGLDQNAAREAFSAFLDEASYNAEQIEFIDQVIDYLVNNGILDMSQLFEPPFTDNHGESAYGFFDEGTVVELFGVIRKVNANAVVAESQSA
>NZ_CP046742.1|WP_114717055.1|2487058_2488234_+|restriction-endonuclease-subunit-S
MEFVTLGDLFKISSGGTPSRREKSYYDNGDIPWIKTGDLHKCRIQQASEYITQLGLDKSSAKLFPKGTVLLAMYGATIGACSILDIEAATNQACAAFLPNEKVDTNYLYYFLISKKNDFIRDGVGGAQPNISATYLKTVSFPLPPLETQKQIAAVLEKADQLRKDCKLLEQELNSLAQSVFIDMFVGKDFPLVNLEDLASNKKHALSSGPFGSALSSKHYTDEGVLVLRGLNTTKGKIDLSKTKYISQEKYEELKRSKLSVNDVVVVAVGSSGFAISIPDGFPEAVMSQNFNKISPNMDLIVPKYLEFAINSSFVQRQFSREITDTVRTFLSLTKLKKVQIPLPPLELQKQFLSTIKSILKEEELNQEFVSEMDNCFSSLMQKAFKGELTL
>NZ_CP046742.1|WP_114717054.1|2485451_2487059_+|SAM-dependent-DNA-methyltransferase
MLTGKIRNQIDQVWEMFWTGGVANPISVIEQISYLLFIRRLDELQKTAERRSQATGLPLNNPTFGPDEQALRWSNFKDKDPDVMMEIVRDRVFPKIKTLQNEGSFAEHMKDAIFMIPSAKLLDQVVQLLSAINMDDKDTKGDLYEYLLSKLQQSGVNGQFRTPRNIIRMMVELMQPKVGDTICDPSSGTCGFLMAAVEYVEEHHAKEVNKPENRKHFNNEMFTGFDFDRHMLRIGAMNMLLHGIENPSVHYRDSLQDQGSENISEAYSLILANPPFKGSVDFDIVAPDLLRALGKNPIVKKSAPKFKTEIDEDGNEIQVEVKQKGPTEKSELLFLALILRMLKVGGRAAVIVPDGVLFGSTKSHQSIRQKIVNEQKLEAVISLPSGVFKPYAGVSTAILIFTKTNSGGTDNVWFYDMQADGYSLDDKRTQLFKEGEVPTHEQSNIADIIARFKTLTNADNTPNSDSPEYQRKRTEQSFMVPVSNITNNDFDLSINRYKEVVYEEVQYDSPKEILGRIKTLQEKMAKGVAELEKLL
>NZ_CP046742.1|WP_038939483.1|2484382_2485249_-|GIY-YIG-nuclease-family-protein
MTRGTQLKIYLANGSVTGIRHAEIVNWTGQAIAVPRVHIKELSEWEETHRPGVYFLFGYNADSGNSLVYVGEAEHIQKRLSQHLAGKEFWNEAICFTNKDENLTKAHVKYLEARLIEIIVESKRYDLDNDKLPPASSLPRGERDAMETFIDNIRTVIGSLGHKLLEPRVSLTSPSQTNEPENTVLQLKVKKVDAKAMLTDEGIVVLKGSQALTTAQPSLSKGYTKLRSNLEEKGILTPSGDHLVAVEDILFTSASQAAAVLLGYPCSGPDYWRDTSGKTLKEIEAESV
>NZ_CP046742.1|WP_114717053.1|2483003_2484386_+|diguanylate-cyclase
MLRVWQADCAEQAINKFASNRRPHFFCQATPGAGKTVMAAEVAMRLFEKDMIDLVLCFSPSLSVAEGMQKTFAWKLECSFNGGLGSLGGSYTYQSIRFFDDNFWNTISKHRVLVVFDEIHHCSFEEDGRSNSWGVEIVSKIQGLARYTLALSGTPWRSDRLPIVMAEYSDPEGMLICDYQYGLKQAVVDGVCRQPKIALIDNEHLSITSGGNRQHFASILDCLKQSDISYQSVIHNEEAMHYILNSACKKLAQIRELSPNAGGLVVAASIKHAKDIQKRLVEQFNQSASIVTYHHVNPLNEIESFRHSNVQWIVSVGMISEGTDIPRLQVCCHMSSVKTELYFRQVLGRILRVNDSVNQEAWLYTFAEESLIGFAERIEQDIPDTCMFLKQEEEAQNVADEPISLSSTVSDRIQSSYSQPSTLSWENIAAVIESNNTNNALLYDELRLGQFKQRVIAAFT
>NZ_CP046742.1|WP_114717052.1|2482464_2483001_+|hypothetical-protein
MNKVTRINPHMFNLLIEKGMDGFSVIDARDALLNSDVTFPSKDDARKYIYKQLLSFEEKGWLSVVGTQRAKRYHQTSEFKALTVEPRVARKSKVNVDPIAIQIADTSLTALEQEKKQYEGELAITLGEIEEYQSLLTRFPHSRQKMHPLFNAARERSAKLLGKINALTKWMQVSQGKV
>NZ_CP046742.1|WP_123011418.1|2482054_2482363_-|helix-turn-helix-transcriptional-regulator
MQKNNPIPERLKAARKKAKITQKDLGVKIGMEPSSASGRMNHYEKGRHVPDLGTLERMAEELNVPLNYFFCRNKLSAELACVIDKMSDEEKAALLDRLSREK
>NZ_CP046742.1|WP_123011421.1|2498267_2500133_-|hypothetical-protein
MSMELYEHLNQKRNGQAILKRLQWMEGQLSWIGEFNRKDLVTRFAISTQQASADIALYKEFAPNNLKFDNRSKVFFLSESFVPLFEHEPIEWLQQEQHKEVGNLLGLVDITGIPQKMEPKIFRTLNRCRKYETPVQVEVGTFSSSEKSEDLICPHSIVVTPVRWHVRAWSRERQKFIDLPISRILSAVPDDSRDWVSKEADREWLTEIPIILAPSEHLDPSQQQMVSNAYGMSDGVVAIPTKVCLVYYTLAAMKLLSAVREYKGEAIDPKLNIRVVNYKELLPLVKNSPSFVRSNWLELSEEIQELSDQVEQSQSHTTALLSSNYPLWIGSGFAKIAASYGAELCVTNGIMSTFMSAVDYKSSPLKTSFFPILLSFAGKGEDAIDTAENIANASSEAGIITCNSESEAVKKLSTTRCSYLFGKFPKRDKRFVNIKSILTLTALAEEYARKQFDLPLPELDLQSCAQKAQVIGMRVAEQFIENFSWRTKQLIVVGKGYNNPLEHVWKSILAEAGIITATWVDIKDFTHGDHRHVSLYQNHAFLLLEQPEIREYCDIFERRFGQVYPVERVSLAGMFREQFWLNLLTAIFFTHRITYEQGYNGNRPPKNEQVHSWRGWGRLNN
>NZ_CP046742.1|WP_123011422.1|2500195_2501956_+|hypothetical-protein
MNSNSTSNVLVSSQTDLLPLYCILEDETTIPTNSINARYSLYKEFRVFPQEVFARLRHFQPQSGCFNKCNFCSQGASSRIIEFSLENLRNIIAVIKAVSLEQNYSPNQITDVIDFDTGHFIDSRTIHDSPLIAYGREDRRGVIYCYLDNDPAIYPHIDTFARLVYENLGVKTRIATVGYSRHNQEIRQAFTNLSSSLRYCLAGVRLSISPYTYGWTEAGMRAGVTHRDEFEKDLAHFLDTFKNTGALFSAELRFQPMVDVGEVELIKYSDIHILTYKNYLYVSDTPLETLTTASISDSHDHALKMDTPGHKVIQLELKGNWRKSADLYLRGKLPGTPCLIHKLQNDDGIYFGVNVERNQAGKCYAKFFYPKSIARPNSGHIDGERYLLNAIIDTKATTNNASWQDIDALIQSIKNKARTLACAFQASSNYIEKDLIPLIESFVRTLKMARLPANSFLDKELTMDTGQICNLGRAYNEYKLLASRQDLPMTPNHERAFGKKGDLANEGTVFRLSPGGRQRISNKLGRTYTREDEFIIEELDLTSTSSADGQSKQHYKFFLPGNVVKTMKQLDEPIIVGQIPTRVTYE
>NZ_CP046742.1|WP_158126981.1|2501948_2502455_+|hypothetical-protein
MNKQKTYFTREGLARANNEIVALQKEIKECNVKIGKTVELDNDLRENPEFMALRTKAEYELPNKIQELSQLLEHKEVIEDMPHIRNNLCSYVTVGHQVTLIDEDDNTRMLTILGYGDSNPKENIVSYLTPIAQILLEHEVGEEVSLTSPHGNVLYVIDEIIVSPLLNK
>NZ_CP046742.1|WP_123011424.1|2502464_2503049_+|hypothetical-protein
MAGKFIVITGLDGSGTTSIGKTLAEMDPEGYYLQTPEGVFSEHREQFTQELRESYPDAHYLYYLMSVVKASNDIKKKLKTHNVYCVRYLIDTIVSHRTMGLDVDLDYELGFTSIVKPHLTLFIDINEGVRQQRITERGKSILDKALDDTDFRIRFKSQFERLSSHYTIVDNSTTLEACLCSAKNKVDNLIAENP
>NZ_CP046742.1|WP_000936745.1|2503879_2504221_+|metalloregulator-ArsR/SmtB-family-transcription-factor
MLPHQFFKLLADETRVRCLLMIAREEKVCVAELTEALNESQPKISRHLALLRASGVVVDIRQGQWVFYRISDQLPGWMRKQIQGLVESNCLKQEYQQDIQRLAEMTSRPQCCV
>NZ_CP046742.1|WP_057554272.1|2504317_2505319_+|ArsJ-associated-glyceraldehyde-3-phosphate-dehydrogenase
MAIKVGINGFGRIGRLALRASFDWPEIEFVQINDVAGDAATLAHLLEFDSVQGRWHHAVSSEADAILINGKRIRTTQEKAIDAVDWSGCDVVIEATGKHRKGEFLNQYLAQGVKRVVVSAPVKEEGIANIVVGVNDHIFNPEQHRIVTAASCTTNCIAPVVKVIHEKLGIAQASFTTIHNLTNTQTVLDAPHKDLRRARACGMSLIPTTTGSAKAIIEIFPDLKGKIDGHAVRVPLANASLTDIIFDVQRDTTVEEINQLLKQASENELKGILGFEERPLVSIDYQGDQRSTIVDALSTMVVGKRMVKIYAWYDNEMGYATRTAELVRKVGLA
>NZ_CP046742.1|WP_123011425.1|2505332_2505830_+|phosphatase
MTHPTWELPVADSQASLVLTPCPGTKGTPLAESIAQLKAQGVSAVVTALSHEEMELHGVGELPAEVEKAGLQWFHAPIEDDCAPDAAFAQDWQQCSPALHQALSRGEKVALHCMGGSGRTGLLAAHLLLEKGWPLESIITQVQALRPGAFTKEVQVQYVHQIVKP
>NZ_CP046742.1|WP_123011426.1|2505868_2507098_+|organoarsenical-effux-MFS-transporter-ArsJ
MFMLSQLNAHVRQYMLVTFNYWNFTLTDGALRMLVVLYFYDLGYSSLAIASLFLFYEFFGVVTNLIGGWLGARLGLNRTMNIGLGLQIIALLMLAVPASWLTIPWVMAAQALSGIAKDLNKMSAKSAIKTLVPENAQGALFKWIAILTGSKNALKGAGFFLGGALLSLIGFQYAVAAMAAVLVLVFIGSVMSLKSDLGKAKNKPKFSDIFSKSASVNILSAARLFLFGARDVWFVIALPIYLGSVFGWDHSAVGGFLALWVIGYGVIQGFAPKITGSKSEHPPAGRAAIGWALALSSVTGLIAYGVQIQWHPEVVIIGGLMLFGAVFAVNSSLHSYLIVSYAKDDGVSLDVGFYYMANAMGRLIGTILSGWVFQLWGLAACLWVSFGFLVLTTLISFWLPNRASQVNLK
>NZ_CP046742.1|WP_114774750.1|2507661_2510928_+|chitinase
MFNKISLEIMKRSALTLMPTVLALAVGMAMPAAQAAINSDASVVGTESQWWNTYKVTLTNNGSQPVELRGASIVFDTNLSLSTPSWSAQGISYPSMSFSSNAQGSVFSNRLTLSFDQGSWVKTQLLPGASIDLTLGVSGVLDLSLLQSTIALETDGEVEPGEPEISLELASPVQGAEFIEGQTVAIVANVTATNTTVKTVTFLVDGEQIALLEQAPFQANWTAAGEGAHSIKAIVEDASGLLKEQAVRITVKAEEIDPPVEPEVPVAPVIELTNPRNGQSVFLGKVTTLAANATDENNDLTAVEFLVNGESIGRVTQAPYQMAWTPVALGQYTIEAIAYDAAGHQTQTPMVTVNAKEMGTGNLSCDIKQIYREDGTECMGDDHPRRIIGYYTSWRTGKNGLPAYLAGDLPWEKLTHINYAFASINKSDFSMQVDDSATKMTWENVPGAEMDPSLPYQGHFNLLSKFKKQYPDVKTLISVGGWAETGGFYPMTTDLASCSVNMEGIKAFNKSAVDFIRQYDFDGVDIDYEYPSSMKDSGNPVDFEQSNKCRGQLWDNYMVMMTELRKALDKAGEEDGRRYMLTIASPSSGYLLRGMQDFAMQDVLDYVNIMSYDLHGTWNEFVGPQAALFDDGKDAELAKWGVYTTAEYQGIGYLNQAWTHHFFRGAFKPSQINMGIPYYTRGWQGVSGGEKGLWGRAVEPNQSSCPEGTTVCGWGAEGTDNIWHDVDANGNEIKAGVVPMWHAMNLMHAEKLGIDGMPSYGPAWGMDPNNPKHLIEGKYERVWSQELQTAWLWNDTKKVFLSIEDKDSLKPKLDYIVDNGLGGMMIWEMAGDYSYDAVKREYVIGSDMTSYAHEVFAAAEPMDIRHNDLPQPDSVIDVTVSTTEWPEGDSNYPINPKLVFTNHSNVAIPGGSTIEFLMPTSTGDIVKDWSGAGLKVIESGHTGSNFSVNGEKKLFHKVAVTLRSTETIPAGGEYSVDMVYYTPVSGVANGVRFIVGNETVGLKKDFPTLPAFEGATDGGNGNEGGAGQSCADAGINPNGLKVYPEFPRGDHAAGGDQLIHNGSVWQANWWTNSTPSSADASWKAVCKI
>NZ_CP046742.1|WP_123011427.1|2511017_2511848_-|CPBP-family-intramembrane-metalloprotease
MLLSASALLWLPLALAIMAGFARYHRVSWGLLIITLLSALGSGHLTFVGAGIVGIGFALAYLAANGQSHLRTTAWVALLLWCLALFLHWLPGFSNLKVLDKVIASAHSTPFSLYLNLDKPLVFFALLLAFPALLGQSKTANIKATLLTLVPLFALLPIAVWLGALAFEWSLPEWWWIFALNNLLFTCVAEEALFRGLIQQKAQQQFGAIAGLLIASALFGMAHFAGGPLLMIFAALAGLGYGLVFHFTGRLWVSVGVHFLFNFAHLLFFTYPMLAR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

838593 : 845210

Staphylococcus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_123011118.1\|838593_839064_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	8.9e-34	48.0
WP_123011119.1\|839328_840438_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	6.7e-64	39.8
WP_000493874.1\|840478_841132_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.2e-31	38.2
WP_123011120.1\|841136_842240_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	2.0e-44	33.3
WP_000543544.1\|842265_842715_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_123011121.1\|842814_844068_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	5.6e-99	49.2
WP_000210573.1\|844076_845210_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.4e-64	40.4

DBSCAN-SWA_2

1940419 : 1947683

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001883363.1\|1940419_1941211_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	8.4e-69	51.6
WP_057550676.1\|1941203_1941830_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	5.7e-36	51.5
WP_095461793.1\|1941829_1942765_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	7.8e-05	34.7
WP_123011330.1\|1942838_1943846_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	7.8e-35	34.2
WP_001934677.1\|1943939_1946528_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	2.2e-33	23.0
WP_123011331.1\|1946795_1947683_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	9.2e-56	41.1

DBSCAN-SWA_3

2179352 : 2186543

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000775249.1\|2179352_2180567_+	IscS subfamily cysteine desulfurase	A0A0H3TPH2	Faustovirus	8.8e-33	30.8
WP_000331703.1\|2180603_2180987_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.4e-53	78.2
WP_000301571.1\|2181047_2181371_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	3.0e-25	50.5
WP_001105750.1\|2181419_2181935_+	co-chaperone HscB	NA	NA	NA	NA
WP_123011365.1\|2181958_2183809_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	4.1e-106	41.1
WP_001124187.1\|2183822_2184161_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_000872174.1\|2184208_2184403_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_000107234.1\|2184621_2185911_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	6.5e-34	34.0
WP_001162850.1\|2186114_2186543_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.0e-20	38.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046741

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046742

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection