CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046797	Vibrio furnissii strain 2013V-1001 chromosome 1, complete sequence	1 crisprs	DEDDh,csx1,DinG,csa3,cas3,WYL	0	0	4	0
NZ_CP046798	Vibrio furnissii strain 2013V-1001 chromosome 2, complete sequence	0 crisprs	DEDDh,RT,csa3,WYL,cas3	0	0	2	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046797_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046797_1

630846-630986

Orphan

Consensus_repeat	Method
GGCACATGCGAAGAGGGCGAACCTCGTGCCCAAGCTGGTCGCGTCG	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046797_1

>merge|NZ_CP046797|1|630846-630986|CRISPRCasFinder
GGCACATGCGAAGAGGGCGAACCTCGTGCCCAAGCTGGTCGCGTCGCTCCAAACAAAGAAAGCCCGATCAGAAATGGTCGGGTTTTTTGTTATCCGGCACATGCGATGAGGGCGAACCTCGTGCCCAAGCTGGTCGCGTCG

>NZ_CP046797|1|1|630846-630986|CRISPRCasFinder
GGCACATGCGAAGAGGGCGAACCTCGTGCCCAAGCTGGTCGCGTCG	CTCCAAACAAAGAAAGCCCGATCAGAAATGGTCGGGTTTTTTGTTATCC
GGCACATGCGATGAGGGCGAACCTCGTGCCCAAGCTGGTCGCGTCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046797.1\|WP_158107269.1\|634591_635074_-\|GNAT-family-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366181
NZ_CP046797.1\|WP_004726210.1\|635424_636408_+\|phenylalanine--tRNA-ligase-subunit-alpha	unknown	unknown	gnl\|CDD\|234780
NZ_CP046797.1\|WP_158107272.1\|642905_644081_-\|phosphoribosylglycinamide-formyltransferase-2	unknown	unknown	gnl\|CDD\|236454
NZ_CP046797.1\|WP_004726216.1\|627659_629489_+\|excinuclease-ABC-subunit-UvrC	unknown	unknown	gnl\|CDD\|234792
NZ_CP046797.1\|WP_004726220.1\|622328_622649_-\|YciU-family-protein	unknown	unknown	gnl\|CDD\|179934
NZ_CP046797.1\|WP_004726219.1\|622653_623220_-\|elongation-factor-P-like-protein-YeiP	unknown	unknown	gnl\|CDD\|179863
NZ_CP046797.1\|WP_158107267.1\|624204_626568_-\|DNA-polymerase-II	unknown	unknown	gnl\|CDD\|235595
NZ_CP046797.1\|WP_038151446.1\|623421_624189_+\|nucleotidyltransferase-domain-containing-protein	unknown	unknown	gnl\|CDD\|143393
NZ_CP046797.1\|WP_004726207.1\|639602_640379_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|143389
NZ_CP046797.1\|WP_004726212.1\|633647_634583_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176109
NZ_CP046797.1\|WP_154181057.1\|621947_622265_+\|ASCH-domain-containing-protein	unknown	unknown	gnl\|CDD\|179908
NZ_CP046797.1\|WP_004726222.1\|620911_621631_-\|histidine-utilization-repressor	unknown	unknown	gnl\|CDD\|188194
NZ_CP046797.1\|WP_004726215.1\|629535_630093_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	unknown	unknown	gnl\|CDD\|182763
NZ_CP046797.1\|WP_158107268.1\|631084_632125_-\|PQQ-dependent-sugar-dehydrogenase	unknown	unknown	gnl\|CDD\|369642
NZ_CP046797.1\|WP_158107270.1\|636426_638814_+\|phenylalanine--tRNA-ligase-subunit-beta	unknown	unknown	gnl\|CDD\|234804
NZ_CP046797.1\|WP_004726208.1\|639259_639553_+\|integration-host-factor-subunit-alpha	unknown	unknown	gnl\|CDD\|178961
NZ_CP046797.1\|WP_158107271.1\|641527_642838_+\|PAS-domain-S-box-protein	unknown	unknown	gnl\|CDD\|206779
NZ_CP046797.1\|WP_055466766.1\|640701_641349_+\|thiopurine-S-methyltransferase	unknown	unknown	gnl\|CDD\|183921
NZ_CP046797.1\|WP_038151245.1\|627014_627659_+\|UvrY/SirA/GacA-family-response-regulator-transcription-factor	unknown	unknown	gnl\|CDD\|236538
NZ_CP046797.1\|WP_158107266.1\|619552_620755_-\|imidazolonepropionase	unknown	unknown	gnl\|CDD\|236478

Protein	Function_ID	Function_description	E-value
NZ_CP046797.1\|WP_158107269.1\|634591_635074_-\|GNAT-family-N-acetyltransferase	gnl\|CDD\|366181	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.	2.05597e-20
NZ_CP046797.1\|WP_004726210.1\|635424_636408_+\|phenylalanine--tRNA-ligase-subunit-alpha	gnl\|CDD\|234780	PRK00488, pheS, phenylalanyl-tRNA synthetase subunit alpha; Validated.	0
NZ_CP046797.1\|WP_158107272.1\|642905_644081_-\|phosphoribosylglycinamide-formyltransferase-2	gnl\|CDD\|236454	PRK09288, purT, formate-dependent phosphoribosylglycinamide formyltransferase.	0
NZ_CP046797.1\|WP_004726216.1\|627659_629489_+\|excinuclease-ABC-subunit-UvrC	gnl\|CDD\|234792	PRK00558, uvrC, excinuclease ABC subunit UvrC.	0
NZ_CP046797.1\|WP_004726220.1\|622328_622649_-\|YciU-family-protein	gnl\|CDD\|179934	PRK05094, PRK05094, dsDNA-mimic protein; Reviewed.	2.85939e-50
NZ_CP046797.1\|WP_004726219.1\|622653_623220_-\|elongation-factor-P-like-protein-YeiP	gnl\|CDD\|179863	PRK04542, PRK04542, elongation factor P; Provisional.	1.76577e-117
NZ_CP046797.1\|WP_158107267.1\|624204_626568_-\|DNA-polymerase-II	gnl\|CDD\|235595	PRK05762, PRK05762, DNA polymerase II; Reviewed.	0
NZ_CP046797.1\|WP_038151446.1\|623421_624189_+\|nucleotidyltransferase-domain-containing-protein	gnl\|CDD\|143393	cd05403, NT_KNTase_like, Nucleotidyltransferase (NT) domain of Staphylococcus aureus kanamycin nucleotidyltransferase, and similar proteins. S. aureus KNTase is a plasmid encoded enzyme which confers resistance to a wide range of aminoglycoside antibiotics which have a 4'- or 4''-hydroxyl group in the equatorial position, such as kanamycin A. This enzyme transfers a nucleoside monophosphate group from a nucleotide (ATP,GTP, or UTP) to the 4'-hydroxyl group of kanamycin A. This enzyme is a homodimer, having two NT active sites. The nucleotide and antibiotic binding sites of each active site include residues from each monomer. Included in this subgroup is Escherichia coli AadA5 which confers resistance to the antibiotic spectinomycin and is a putative aminoglycoside-3'-adenylyltransferase. It is part of the aadA5 cassette of a class 1 integron. This subgroup also includes Haemophilus influenzae HI0073 which forms a 2:2 heterotetramer with an unrelated protein HI0074. Structurally HI0074 is related to the substrate-binding domain of S. aureus KNTase. The genes encoding HI0073 and HI0074 form an operon. Little is known about the substrate specificity or function of two-component NTs. The characterized members of this subgroup may not be representive of the function of this subgroup. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, co-ordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition. These carboxylate residues are conserved in this subgroup.	2.92654e-07
NZ_CP046797.1\|WP_004726207.1\|639602_640379_-\|hypothetical-protein	gnl\|CDD\|143389	cd05399, NT_Rel-Spo_like, Nucleotidyltransferase (NT) domain of RelA- and SpoT-like ppGpp synthetases and hydrolases. This family includes the catalytic domains of Escherichia coli ppGpp synthetase (RelA), ppGpp synthetase/hydrolase (SpoT), and related proteins. RelA synthesizes (p)ppGpp in response to amino-acid starvation and in association with ribosomes. (p)ppGpp triggers the bacterial stringent response. SpoT catalyzes (p)ppGpp synthesis under carbon limitation in a ribosome-independent manner. It also catalyzes (p)ppGpp degradation. Gram-negative bacteria have two enzymes involved in (p)ppGpp metabolism while most Gram-positive organisms have a single Rel-Spo enzyme (Rel), which both synthesizes and degrades (p)ppGpp. The Arabidopsis thaliana Rel-Spo proteins, At-RSH1,-2, and-3 appear to regulate a rapid (p)ppGpp-mediated response to pathogens and other stresses. This catalytic domain is found in association with an N-terminal HD domain and a C-terminal metal dependent phosphohydrolase domain (TGS). Some Rel-Spo proteins also have a C-terminal regulatory ACT domain. This subgroup belongs to the Pol beta-like NT superfamily. In the majority of enzymes in this superfamily, two carboxylates, Dx[D/E], together with a third more distal carboxylate, coordinate two divalent metal cations involved in a two-metal ion mechanism of nucleotide addition.Two of the three catalytic carboxylates are found in Rel-Spo enzymes, with the second carboxylate of the DXD motif missing. Evidence supports a single-cation synthetase mechanism.	2.11408e-09
NZ_CP046797.1\|WP_004726212.1\|633647_634583_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176109	cd08417, PBP2_Nitroaromatics_like, The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	4.26532e-42
NZ_CP046797.1\|WP_154181057.1\|621947_622265_+\|ASCH-domain-containing-protein	gnl\|CDD\|179908	PRK04980, PRK04980, hypothetical protein; Provisional.	6.83762e-59
NZ_CP046797.1\|WP_004726222.1\|620911_621631_-\|histidine-utilization-repressor	gnl\|CDD\|188194	TIGR02018, Histidine_utilization_repressor, histidine utilization repressor, proteobacterial. This model represents a proteobacterial histidine utilization repressor. It is usually found clustered with the enzymes HutUHIG so that it can regulate its own expression as well. A number of species have several paralogs and may fine-tune the regulation according to levels of degradation intermediates such as urocanate. This family belongs to the larger GntR family of transcriptional regulators. [Energy metabolism, Amino acids and amines, Regulatory functions, DNA interactions].	2.22291e-117
NZ_CP046797.1\|WP_004726215.1\|629535_630093_+\|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase	gnl\|CDD\|182763	PRK10832, PRK10832, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase.	3.89432e-82
NZ_CP046797.1\|WP_158107268.1\|631084_632125_-\|PQQ-dependent-sugar-dehydrogenase	gnl\|CDD\|369642	pfam07995, GSDH, Glucose / Sorbosone dehydrogenase. Members of this family are glucose/sorbosone dehydrogenases that possess a beta-propeller fold.	2.09221e-135
NZ_CP046797.1\|WP_158107270.1\|636426_638814_+\|phenylalanine--tRNA-ligase-subunit-beta	gnl\|CDD\|234804	PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta; Reviewed.	0
NZ_CP046797.1\|WP_004726208.1\|639259_639553_+\|integration-host-factor-subunit-alpha	gnl\|CDD\|178961	PRK00285, ihfA, integration host factor subunit alpha; Reviewed.	2.06345e-61
NZ_CP046797.1\|WP_158107271.1\|641527_642838_+\|PAS-domain-S-box-protein	gnl\|CDD\|206779	cd11386, MCP_signal, Methyl-accepting chemotaxis protein (MCP), signaling domain. Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.	6.2216e-44
NZ_CP046797.1\|WP_055466766.1\|640701_641349_+\|thiopurine-S-methyltransferase	gnl\|CDD\|183921	PRK13255, PRK13255, thiopurine S-methyltransferase; Reviewed.	5.07143e-122
NZ_CP046797.1\|WP_038151245.1\|627014_627659_+\|UvrY/SirA/GacA-family-response-regulator-transcription-factor	gnl\|CDD\|236538	PRK09483, PRK09483, response regulator; Provisional.	7.79297e-169
NZ_CP046797.1\|WP_158107266.1\|619552_620755_-\|imidazolonepropionase	gnl\|CDD\|236478	PRK09356, PRK09356, imidazolonepropionase; Validated.	0

>NZ_CP046797.1|WP_004726215.1|629535_630093_+|CDP-diacylglycerol--glycerol-3-phosphate-3-phosphatidyltransferase
MRFNIPNILSLVRLFLIPVFVVCFYLPYHWAPFAAAMVFWVAGFTDWLDGMLARKLGQTSRFGAFIDPVADKVLVATALILITEYYHNIWITIPAVTMIAREIIISALREWMAEIGKRASVAVSWIGKVKTLTQMFALWVLIWRYDDWMVWLGYAAIYVATILTYWSMVQYLAAAKDDLLSEEHQ
>NZ_CP046797.1|WP_004726216.1|627659_629489_+|excinuclease-ABC-subunit-UvrC
MSSFDSTSFLKTVTNQPGVYRMYNAEAEVIYVGKAKDLKKRLSSYFRKKIDSEKTRALVTHIEKIDVTITHTETEALILEHNYIKQYLPKYNVLLRDDKSYPYIFISGHRHPRLSMHRGAKKRKGEYFGPYPDSGAVRETLHLIQKIFPVRQCEDTVYSNRTRPCLMYQIGRCAGPCVSSIISDDEYAELVNYVRLFLQGKDKQVLEILIDKMEKASMGLRFEDAAKFRDQIHAIRRVQEQQFVSEDSMDDMDVLGFAQEKGIACIHILMIRQGKVLGSRSHFPKIPHNTSQEEVFESFLSQYYLSHNEARTMPSRILLNDGLLVDAKPMQDALTQLAGRKVTFHVNPTGTRGRYLKLSNTNALTAITTKINHKMTINQRFKALQDELGIDNITRMECFDISHTMGESTIASCVVFNQEGPLKQEYRRYNITGITGGDDYAAMGQVLERRYGKQLDVDKIPDIIFIDGGKGQLNRAHEIMTQCWQDWPKRPRLIGIAKGVTRKPGLETLITTDGDEFHLPSDAPALHLIQHIRDESHNHAIAGHRAKRGKTRRTSALEGIEGVGPKRRQALLKYMGGLQELKRATVEEIAKVPGISHSLAEIIYQTLKQ
>NZ_CP046797.1|WP_038151245.1|627014_627659_+|UvrY/SirA/GacA-family-response-regulator-transcription-factor
MISVFLVDDHELVRTGIRRIIEDVRGMNVAGEADSGEEAVKWCRSQHADVVLMDMNMPGIGGLEATKKILRFNPDVKIIVLTVHTENPFPTKVMQAGAAGYLTKGAAPDEMVNAIRVVHSGQRYISPEIAQQMALSQFSPASENPFADLSERELQIMLMITKGQKVTDISEQLNLSPKTVNSYRYRLFAKLDISGDVELTHLAIRHGMLDTEKL
>NZ_CP046797.1|WP_158107267.1|624204_626568_-|DNA-polymerase-II
MSIQQGFLLTRQARDIQGQTQIELWLATDQGPTQLIIRGEQPVFFIHQQDIDAAQAIAQQHQITVEIRPLPLKSFDQEPLAACYCIQIQHAQSLAHQLEQAQLLTLEADIRLADRYLMERFVKGSVEFTGHITPHADYRQVRQAKCRQGDYLPALSVVSLDLECSEKGILYSIGLDSPLDSRVIMIGEPQEADTPIQWVADEYALLQALIEWFERFDPNVIIGWNVIDFDFRLLHKRAEWHKMKLILGRAKQPSFFRSASQTQQGFITIPGRVVLDGIDTLKTATYHFRSWSLESVSQELLGEGKEIHNVHDRMDEINRMYREDKPSLAKYNLQDCVLVNKIFTQTHLLDFAIERSRLTGVELDRIGGSVAAFTNLYLPQLHRAGYIAPNLHSEDWLASPGGYVMDSIPGLYDSVLVLDFKSLYPSIIRSFLIDPMGLIEGLQQPLGNAPDQAVPGFRGGQFHRSKHFLPQMIETLWAARDVAKKNNEKAFSQAIKIIMNSFYGVLGSSGCRFFDTRLASSITMRGHEIMKQTKQLIEAQGYQVIYGDTDSTFVSLGREHAQHDADAIGQGLVQHINQWWTNHLQQEYALTSILELEYETHYRKFLMPTIRGAETGSKKRYAGLIGEGDKERMVFKGLESARTDWTPLAQRFQHQLYWMIFHGEAPDDYIRTTVEATQAGEYDSELVYQKRLRRKLHEYQKNVPPQVRAARMADDINARLGRPLQYQNRGLIEYCITVNGPEPKEYMNSPMDYQHYIDKQLKPVADAILPFIGRQFEQISAPQLGLF
>NZ_CP046797.1|WP_038151446.1|623421_624189_+|nucleotidyltransferase-domain-containing-protein
MSLPVIDPQQPFQPEYQPAIADLVKFLRAGLGERLHSIYLYGSVARKTARPGESNLDVVVITKRGFDDNKTTLLNTIRWRFQKSFPFITDVSVKTALVSDVATLDSIFSWGFMLRHCCVCVYGDDLAECFGHYEPSWEIAKHWNQDVGDWLTFYRDKIAKAGNAAEQSAAQKTIAKKLLRASYSLIMYRDKQWFDDPAACGAHFLRYHPEKQQDVERLTILLSGRVIPKRSVIGLLDSFGPWLVKQYEKTEFRIG
>NZ_CP046797.1|WP_004726219.1|622653_623220_-|elongation-factor-P-like-protein-YeiP
MPKASELKKGFAIVSNGKTLLIKDIEVTTPGGRGGSKIYKLRCTDLTTGARVDERYKSDDFLDTVDMNKRNISFSYVDGDECIFMDNEDYSQFTFKQADIEDELLFITEEIQGMQVVLVDGKAVAIELPSSVEMVIEETDPSIKGASASARTKPARFATGLVVQVPEYIATGERVIVNTTERKFMSRA
>NZ_CP046797.1|WP_004726220.1|622328_622649_-|YciU-family-protein
MSDLISYDDAIDAAYDIFLEMAPDNLEPADVILFTAQFDDRGAAEIVEVGDDWDEQVGFEVDKEVFTEVRIGLVNEENDVLDDVFARMLISRDPDQKACHMMWKRD
>NZ_CP046797.1|WP_154181057.1|621947_622265_+|ASCH-domain-containing-protein
MTAPTTMTFFARFERDILAGKKVITIRDASEKDYQPGTVVDVSTLEEGRWFCRLHIESVEPVQFSALTAYHAEQENMTLDELKQVISDIYPGIEELYVITYQLVE
>NZ_CP046797.1|WP_004726222.1|620911_621631_-|histidine-utilization-repressor
MSESPLYLQIKHFILDNIESGRWPVGHRIATEMALTEQFNVSRMTVNKAIRDLVTEGKLQRRPRLGTFVCAPEEKAESPLLDIRNIADEVVSRGKRYHSKVIQQQQMIADESVATKLGVMLGTPVFYSEILHYANDAPLQLEVRWVNARYAPHYLQQDFSRITPNQYLSENCPLSAIEHTVEAIVPDSHIKATLALNPNEPCLLLNRRTWSGDKLVSSALLYHPGSKYKLTSKVLLDDN
>NZ_CP046797.1|WP_158107266.1|619552_620755_-|imidazolonepropionase
MELILTNARIVSMQAGSAGYQPSEPMNVLIQNGQMTAISTKAIDTDAKRIDCSGKLVTPGLIDCHTHLIYAGNRANEFEMRLQGMPYQTIAAQGGGIISTVKATRRASVDELVELALPRLDGLLKSGVTSVEVKSGYGLTLNDEVKMLRAAKALENHRRVKITTTLLAAHALPPEYIGRADDYIEHVCQTIIPQVAEEKLATSVDVFCESVGFNLAQTERVFQCAQTHGLQIKGHTEQLSNLGGTALTARYQGLSADHIEYLDQDGVKALAKSGTVATLLPGAFYFLRETQKPPVATLRAYQVPMALATDMNPGTSPFADLTLMMNMGCTLFGLTPEETLRGVTVHAAKALGFAETRGQVATGFDADLAIWNIDHPADLSYQVGVPRLHARIVDGAFCHD
>NZ_CP046797.1|WP_158107268.1|631084_632125_-|PQQ-dependent-sugar-dehydrogenase
MWLCSFNAAAWEAEKVMSGLLVPWGMSFVSNDQLLVTERNGDIVLVDLKTQTKTSLLHVASVAANGQGGLLDVALSPHDPTVFYFTYSKQHDSGVDTTLAMANWDGKTVTAWRDVLITVSNSITTRHFGSRIAFDATHLYFTIGDRGMRPNGQDRRTHAGSVLRLNLDGTTPDDNPFAGNPNAQAQIWSYGHRNPQGLYYDAPSQTLWEIEHGPRGGDEINLIRKGANYGWATTSYGKEYWGPVSVGDSEEADGIDSPRKVYIPSIAPSGLLLYRGQRYPQLNGKLLTGALKLTHINVITLDDNQSAIEETRLLESLNERIRDIRRSPDDWIYFSTDSGNIYRLKP
>NZ_CP046797.1|WP_004726212.1|633647_634583_-|LysR-family-transcriptional-regulator
MNNYKLLPALMALLETRNLTDAARRLNVTQPAMSKALRLIRDEFQDPILIRDGQQFTLTQRGEQLKERLPALLFQLDQLYLPPQANIQHCDRSFRLAFNSFISMDILPALCAELYEKAPQAGIQTSLWQNAPLSELGETNFDLLGTLAVTVPENLYGKRLASDHYVICCCQTNEIATHGMSMEHYFSARHILVSDLHEETRQVDNLFRQHKKQRRIFATLPSLRLALETVIGTHCLVTVPLHIAAQYAKRYPLAVLSAPFELATHNYYLLWHAKFQNDDEHRWFRELCFAHLQRDFQAKLALGSALITSSN
>NZ_CP046797.1|WP_158107269.1|634591_635074_-|GNAT-family-N-acetyltransferase
MNTHIQPICTDDDPIICTIIKSVGAEFGAIGDGFGPSDDEVLAMSQHYVAENRSGYWVATLGGKIVGGGGIAPFNGSDSVCELKKLFLLPESRGHGLGKALATQCLTFAKHQGFTHCYLDTLSNMSTAVRLYESLGFEHLPSAMPGTEHNGCDVWMLKTL
>NZ_CP046797.1|WP_004726210.1|635424_636408_+|phenylalanine--tRNA-ligase-subunit-alpha
MQHLQEIIANATAAINAAESLVALDEVRVQYLGKKGELTAQLQSLGKLPPEERRTAGQEINVAKETVQKAIAARKDSLQRAELEAKLAAETIDVTLPGRRIENGGLHPVTRTIERIESFFGELGFTVESGPEIEDDFHNFDALNIADDHPARTDHDTFFFNPKLMLRTHTSGVQIRTMEENQPPLRFIAPGRVYRNDYDQTHTPMFHQVEGMLVDENVNFAQLKGILHDFLCNFFEEDLEVRFRPSYFPFTEPSAEVDVKGKNGKWLEVLGCGMVHPNVLRSVGIDPEKYSGFAFGMGVERLTMLRYGVNDLRAFFENDLRFLKQFK
>NZ_CP046797.1|WP_158107270.1|636426_638814_+|phenylalanine--tRNA-ligase-subunit-beta
MKFSESWLREWVNPAVTTDELTHQITMAGLEVDDVLPVAGTFTGVKVGHVVECGQHPDADKLRVTKVDVGEEELLDIVCGAPNCRQGLKVAVATVGAVLPGDFKIKKAKLRGQPSHGMLCSFSELGIDVESNGIMELAEDAVIGTDFREFLALNDVTIDVDLTSNRADCFSLRGMAREVGVLNRADVAEPAVSPVAPTIDANISIEVKAPAACPRYLGRIVKNVNVQAQTPLWMQEKLRRCGIRSIDPIVDITNYVMLEQGQPMHAFDLAKIEGGIVVRLAEQGEKLTLLDGSEAELNADTLIIADHNKALAIAGIFGGEHSGVSTETKDVLLECAFFAPDHIRGRARSYGLHTDSSMRYERGVDYALQHAAMERATQLLIDICGGDVAPVVAAESDTDLPKPNTVALRRTKLDNLLGHHIADADVVEILQRLGMSVETTAEGWTATAPTWRFDIAIEQDLVEEVGRIYGYDNIPNQAPAAALNMNLHKEANLPLKRVRDLLVDRGYHEAITYSFVEPEQQKLIVPDVEPLILPNPISADMSAMRLSLIQGLLNTVVHNQKRQQPRVRLFEQGLRFIPDQAAENGMRQEPMLAGVISGTRGEEHWNLETATVDFFDLKGDVEAILELTANGKAYSFAAAKHPALHPGQSAAIVLDGKTIGVIGTVHPELERKFGLNGRTIVFEIEWSAINTKVIPEAVALSKFPSNRRDIAVVVDDAVASGDIVKACLEQGGEFLKDAKLFDVYVGKGVEDGKKSLAIALTLQSAERTLEDADIAGAVEAIVAHVSAKFGATLRD
>NZ_CP046797.1|WP_004726208.1|639259_639553_+|integration-host-factor-subunit-alpha
MALTKADLAENLFEKLGFSKRDAKETVEVFFEEIRKALEGGEQVKLSGFGNFDLRDKNERPGRNPKTGEDIPITARRVVTFRPGQKLKARVENIKKS
>NZ_CP046797.1|WP_004726207.1|639602_640379_-|hypothetical-protein
MSLFLRTTALMLLVLSRAPAFAAALPFDTTSEDNRGESQNQVSSKLFKHSLSGLYGIQTTQNSVLQPYQDFDILYSKAHQAQCELETLCKSTALLTSTHAYFSGVKSHHRALEKIELELNGQPERITDLARATIIADDVPSLVDAYEALSREATVMKVKNRFKSPAESGYRDLNVLVQLPKTGIIAEVQFHLKAIADVKSGPEHDLYKQIQNIERTAGRDQRALNDWEMAKIQKIRRESQDLYQQAWQPYITTHIQAA
>NZ_CP046797.1|WP_055466766.1|640701_641349_+|thiopurine-S-methyltransferase
MNDPEFWHAKWASNQIGFHLTDVNTLLSDHWHETQPKRDERVLVPLCGKSEDLIWLAEKHDDVQGVELSPIAVRAFFAEHFYTPTVTQINGLHELYQFDELSIYTGDYFTAPLQPVDIVYDRAALIALPEGMRADYVARLKSLLNPGARILLVTLDYDQQELSGPPFSVNEEEVKRLFSGFSVRRLLRDEANAQHPKRAKKGLSRFAEEVWLIES
>NZ_CP046797.1|WP_158107271.1|641527_642838_+|PAS-domain-S-box-protein
MFLFSSRKQEQNHQAQLDAMRSASMVLNAIKHRVPYIEFSSDGRILTANELFLSAMGYSLDEVQGQHHRLFCDKQLTSSASYQNFWRELAQGSPQHGTFRRVRKDGQDIWIEATYVPVVDEQGRVVKVVKVASDVTEEKLQLDSQAAIFEALKTSLAYIEFTPQGQILNANDNFCRCVGYSLREIQGQHHRLFCSEAFMQNNPDFWPSLARGEFKSGLFERRNRNGDVIWLEATYNPIKDQQGNVVRVVKFASEITARIHHLQAIQQASKVAQRTSLETLDIANDGAKTLDVAADVANQIDGSVEQASSLMEKLTEQSQQISQIVTTISTIADQTNLLALNAAIEAARAGEYGRGFAVVADEVRKLAANTSHATDEIGNIVKRNSELTQVSEQTMTEIQRKVIECNQQLQATQALIDEIRHGAQNVADTVSQLVND
>NZ_CP046797.1|WP_158107272.1|642905_644081_-|phosphoribosylglycinamide-formyltransferase-2
MLGTATRNSAKRVLLLGSGELGKEVAIECQRLGLEVIACDRYEHAPAMQVAHRSHVFDMLDANALQQVIDLEKPHYVVPEIEAIATSKLVELEAQGLNVVPTANATRLTMNREGIRRLASEELSLPTSLYQFADNYDDFVAAVEFVGIPCVCKPVMSSSGKGQSVIKTAEDVEKAWQYAQEGGRTGAGRVIVEGFIDFDYEITLLTVRAVDGVHFCAPIGHRQEDGDYRESWQPQAMSENALKAAEYVAEQIVNALGGYGLFGVELFVKGDQVIFNEVSPRPHDTGMVTLVSQDVSEFALHVRAFSGLPIGEITQYGPAASAAILGQGTSSDIQFSGLDDALCVPNSQIRLFGKPEINGRRRLGVALSRGKTTTEATTRAIECAKAVKIHY

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1715271 : 1755196

Vibrio_phage(90.62%)

tRNA,capsid,terminase,portal,head,tail

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158107660.1\|1715271_1715751_-\|tRNA	Cys-tRNA(Pro) deacylase	NA	NA	NA	NA
WP_004724748.1\|1715899_1717564_-	bifunctional UDP-sugar hydrolase/5'-nucleotidase	NA	NA	NA	NA
WP_004724752.1\|1717913_1718765_-	3-deoxy-8-phosphooctulonate synthase	E3T537	Cafeteria_roenbergensis_virus	1.2e-47	40.7
WP_041942496.1\|1718786_1719596_-	tetratricopeptide repeat protein	NA	NA	NA	NA
WP_004724756.1\|1719646_1720030_-	SirB2 family protein	NA	NA	NA	NA
WP_158107661.1\|1720014_1720896_-	peptide chain release factor N(5)-glutamine methyltransferase	NA	NA	NA	NA
WP_004724760.1\|1720906_1721995_-	peptide chain release factor 1	W8EDB3	Pseudomonas_phage	8.2e-06	48.2
WP_004724762.1\|1722028_1723288_-\|tRNA	glutamyl-tRNA reductase	NA	NA	NA	NA
WP_014204592.1\|1724061_1724949_+	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	NA	NA	NA	NA
WP_004724767.1\|1724978_1725923_+	ribose-phosphate pyrophosphokinase	A0A2K9L2G2	Tupanvirus	3.9e-44	38.0
WP_055465404.1\|1726075_1726666_+\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_004724775.1\|1730305_1731439_-	flagellin	NA	NA	NA	NA
WP_158107662.1\|1732888_1733269_-	hypothetical protein	NA	NA	NA	NA
WP_158107663.1\|1733492_1733690_-	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	5.0e-15	70.8
WP_158107664.1\|1733689_1735276_-	hypothetical protein	R9TNN7	Vibrio_phage	4.8e-265	83.1
WP_158107665.1\|1735272_1735746_-	DNA-binding protein	R9TPX7	Vibrio_phage	9.8e-65	86.5
WP_158107666.1\|1735733_1736627_-	hypothetical protein	R9TRQ4	Vibrio_phage	5.2e-115	71.7
WP_158107667.1\|1736630_1737110_-	hypothetical protein	A0A2D0YU91	Vibrio_phage	1.7e-19	54.9
WP_158107668.1\|1737109_1738675_-	hypothetical protein	R9TNR5	Vibrio_phage	2.3e-134	84.9
WP_158107669.1\|1738671_1739331_-\|tail	phage tail protein	R9TQ05	Vibrio_phage	7.4e-103	82.2
WP_158107670.1\|1739323_1740529_-	hypothetical protein	R9TRT3	Vibrio_phage	1.2e-196	85.0
WP_047461551.1\|1740525_1740858_-	DUF2590 family protein	R9TMS7	Vibrio_phage	1.5e-48	88.2
WP_158107671.1\|1740847_1742665_-\|tail	phage tail tape measure protein	R9TRA2	Vibrio_phage	4.3e-310	92.1
WP_158107672.1\|1742846_1743131_-	hypothetical protein	A0A160DHS7	Vibrio_phage	8.6e-32	78.3
WP_158108184.1\|1743127_1743367_-	hypothetical protein	A0A166YHN7	Vibrio_phage	1.7e-25	70.0
WP_158107673.1\|1743335_1743677_-	hypothetical protein	R9TNR2	Vibrio_phage	1.1e-49	92.9
WP_158107674.1\|1743651_1744242_-	glycoside hydrolase family protein	A0A2I7RNI5	Vibrio_phage	2.5e-73	64.8
WP_047461563.1\|1744228_1744429_-	hypothetical protein	R9TRT0	Vibrio_phage	1.4e-25	83.3
WP_158107675.1\|1744429_1744636_-	TraR/DksA family transcriptional regulator	R9TMS3	Vibrio_phage	9.3e-28	83.6
WP_024375116.1\|1744644_1745100_-	DUF2597 family protein	U3PCG7	Vibrio_phage	4.2e-73	88.7
WP_158107676.1\|1745096_1746206_-	DUF2586 family protein	R9TNQ8	Vibrio_phage	4.6e-198	94.6
WP_158107677.1\|1746207_1746867_-	phage virion morphogenesis protein	R9TPZ7	Vibrio_phage	3.9e-104	90.0
WP_143682317.1\|1746853_1747345_-	hypothetical protein	R9TRS7	Vibrio_phage	2.1e-73	82.8
WP_158107678.1\|1747341_1747803_-\|head	head completion/stabilization protein	U3PFL1	Vibrio_phage	3.0e-58	74.5
WP_158107679.1\|1747911_1748628_-\|terminase	terminase	U3PCG2	Vibrio_phage	3.8e-92	71.3
WP_158107680.1\|1748642_1749656_-\|capsid	phage major capsid protein, P2 family	A0A160DHH1	Vibrio_phage	7.3e-166	85.1
WP_158107681.1\|1749693_1750599_-\|capsid	capsid protein	U3PDG3	Vibrio_phage	1.7e-118	70.3
WP_158107682.1\|1750769_1752584_+\|terminase	terminase	U3PIL1	Vibrio_phage	1.3e-298	83.3
WP_143682311.1\|1752580_1753606_+\|portal	phage portal protein	U3PFK6	Vibrio_phage	2.3e-167	83.7
WP_047461589.1\|1753588_1753819_-	hypothetical protein	NA	NA	NA	NA
WP_075989875.1\|1753909_1754161_+	ogr/Delta-like zinc finger family protein	R9TNQ2	Vibrio_phage	2.8e-34	84.3
WP_065819907.1\|1754155_1754374_-	hypothetical protein	Q8HA64	Vibrio_phage	3.7e-27	87.5
WP_158107683.1\|1754998_1755196_-	hypothetical protein	R9TRR8	Vibrio_phage	1.6e-13	70.5

DBSCAN-SWA_2

1759137 : 1766828

Vibrio_phage(66.67%)

integrase

attL 1750669:1750684|attR 1767120:1767135

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
1750669:1750684	attL	NA	NA	NA	NA
WP_158107686.1\|1759137_1759974_-	DNA adenine methylase	A0A0K1LM14	Caulobacter_phage	4.6e-65	46.1
WP_158107687.1\|1759970_1760207_-	hypothetical protein	R9TPY7	Vibrio_phage	1.4e-32	83.3
WP_158107688.1\|1760188_1760656_-	DUF3850 domain-containing protein	A0A0A8WI22	Clostridium_phage	2.4e-07	35.2
WP_158107689.1\|1760652_1760949_-	hypothetical protein	NA	NA	NA	NA
WP_158107690.1\|1761034_1761319_-	hypothetical protein	NA	NA	NA	NA
WP_158107691.1\|1761330_1761870_-	transcriptional regulator	R9TRR3	Vibrio_phage	9.8e-53	58.1
WP_158107692.1\|1761981_1762197_-	hypothetical protein	R9TMQ7	Vibrio_phage	3.0e-21	71.8
WP_158107693.1\|1762351_1763032_+	chromosome partitioning protein ParA	A0A166YHA0	Vibrio_phage	1.7e-54	52.5
WP_158107694.1\|1763058_1763865_+	hypothetical protein	R9TNP2	Vibrio_phage	4.1e-10	47.7
WP_158107695.1\|1763865_1765095_+	AAA family ATPase	C7BGE8	Burkholderia_phage	1.6e-05	27.7
WP_158107696.1\|1765105_1765801_+	hypothetical protein	NA	NA	NA	NA
WP_158107697.1\|1765787_1766828_+\|integrase	tyrosine-type recombinase/integrase	R9TMQ4	Vibrio_phage	5.3e-196	97.4
1767120:1767135	attR	NA	NA	NA	NA

DBSCAN-SWA_3

3123774 : 3134921

uncultured_Mediterranean_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004723832.1\|3123774_3124542_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.5e-67	52.4
WP_158108062.1\|3124534_3125161_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.7e-35	51.5
WP_158108063.1\|3125160_3126096_+	murein hydrolase activator NlpD	I3PV79	Clostridium_phage	3.0e-12	31.7
WP_158108064.1\|3126168_3127158_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.3e-34	34.5
WP_004723840.1\|3127226_3129788_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.5e-34	23.6
WP_158108065.1\|3129872_3130367_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.0e-28	48.7
WP_004723845.1\|3130533_3131586_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	6.3e-112	60.7
WP_004723847.1\|3131680_3132151_+	recombination regulator RecX	NA	NA	NA	NA
WP_158108066.1\|3132338_3134921_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.3e-78	38.7

DBSCAN-SWA_4

3343022 : 3350066

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004729418.1\|3343022_3344237_+	IscS subfamily cysteine desulfurase	A0A0H3TPH2	Faustovirus	6.3e-31	30.2
WP_004729416.1\|3344273_3344657_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	9.1e-53	76.6
WP_004729414.1\|3344716_3345040_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	5.5e-27	54.2
WP_014205651.1\|3345106_3345622_+	co-chaperone HscB	NA	NA	NA	NA
WP_158108129.1\|3345643_3347497_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	1.9e-111	40.7
WP_004729409.1\|3347510_3347849_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_004729407.1\|3347904_3348099_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_055465968.1\|3348275_3349568_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	1.7e-34	34.1
WP_004729403.1\|3349634_3350066_+	nucleoside-diphosphate kinase	K7YW26	Megavirus	4.4e-19	38.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

101205 : 108415

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_004727429.1\|101205_102519_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-17	44.4
WP_014257838.1\|102762_103563_-	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.0e-53	47.0
WP_158108254.1\|103829_104735_+	NAD-binding protein	A0A077SLF7	Escherichia_phage	1.5e-109	72.9
WP_158108255.1\|104737_105994_+	hypothetical protein	A0A077SLJ7	Escherichia_phage	5.0e-132	60.5
WP_014257841.1\|105990_106623_+	aldolase	A0A077SK32	Escherichia_phage	4.0e-69	62.1
WP_158108256.1\|106622_107399_+	TIM barrel protein	NA	NA	NA	NA
WP_158108257.1\|107443_108415_+	NAD-dependent epimerase/dehydratase family protein	A0A0G3FXV3	Raccoon_poxvirus	1.6e-05	28.6

DBSCAN-SWA_2

769056 : 779705

Burkholderia_phage(25.0%)

portal,tail,head,terminase,capsid

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081454447.1\|769056_769164_-\|tail	GpE family phage tail protein	NA	NA	NA	NA
WP_075990071.1\|769199_769487_-\|tail	phage tail assembly protein	E5FFG7	Burkholderia_phage	4.3e-07	41.6
WP_158108517.1\|769470_770178_-	hypothetical protein	NA	NA	NA	NA
WP_075990073.1\|770188_770554_-	hypothetical protein	NA	NA	NA	NA
WP_158108518.1\|770557_771691_-\|tail	phage tail protein	C9DGP7	Escherichia_phage	1.5e-47	38.7
WP_014257446.1\|771687_771870_-	DUF2635 domain-containing protein	NA	NA	NA	NA
WP_158108519.1\|771870_772410_-	virion morphogenesis protein	NA	NA	NA	NA
WP_158108520.1\|772406_772871_-\|tail	phage tail protein	NA	NA	NA	NA
WP_158108521.1\|772870_773320_-\|head	head completion/stabilization protein	NA	NA	NA	NA
WP_158108522.1\|773428_774466_-\|capsid	phage major capsid protein, P2 family	A0A0U4K5I9	Pseudomonas_phage	8.2e-64	41.7
WP_158108523.1\|774508_775321_-\|capsid	phage capsid protein	A0A2H4J928	uncultured_Caudovirales_phage	4.8e-19	42.4
WP_158108524.1\|775491_777216_+\|terminase	terminase	E5E3X0	Burkholderia_phage	8.4e-114	41.5
WP_154179811.1\|777226_778183_+\|portal	phage portal protein	A0A0M3LS06	Mannheimia_phage	5.6e-59	42.4
WP_158108525.1\|778204_778798_-	cell filamentation protein Fic	S4TP71	Salmonella_phage	7.4e-09	29.2
WP_158108526.1\|779096_779705_-	KilA-N domain-containing protein	I6R977	Salmonella_phage	2.3e-18	55.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046797

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046798

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection