CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046760	Vibrio parahaemolyticus strain AM51552 chromosome 1, complete sequence	0 crisprs	DEDDh,DinG,cas3,csx1,RT,csa3	0	0	5	0
NZ_CP046759	Vibrio parahaemolyticus strain AM51552 chromosome 2, complete sequence	1 crisprs	WYL,cas3,csa3,DEDDh	0	0	147	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

383304 : 400476

uncultured_Mediterranean_phage(20.0%)

tRNA

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|383304_384945_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|385023_386325_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455577.1\|386727_387009_+	cell division protein FtsB	NA	NA	NA	NA
WP_020841271.1\|387010_387715_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	2.0e-05	25.0
WP_005380896.1\|387732_388209_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_025552420.1\|388255_389299_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_025536693.1\|389298_390075_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	1.3e-66	52.8
WP_005455562.1\|390074_390701_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_005455560.1\|390715_391639_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005478546.1\|392787_395349_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-33	23.7
WP_005493945.1\|395433_395916_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.9e-27	48.7
WP_005478550.1\|396116_397160_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_005455548.1\|397283_397751_+	recombination regulator RecX	NA	NA	NA	NA
WP_005455546.1\|397893_400476_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

DBSCAN-SWA_2

1120378 : 1162542

Bluetongue_virus(36.36%)

transposase,tRNA,integrase

attL 1124416:1124430|attR 1148123:1148137

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005458036.1\|1120378_1121779_-\|tRNA	asparagine--tRNA ligase	A0A2K9V902	Bandra_megavirus	2.5e-84	37.8
WP_083110908.1\|1121967_1123593_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-23	24.5
WP_005494779.1\|1123887_1124250_+	6-carboxytetrahydropterin synthase QueD	S4U060	uncultured_phage	4.1e-10	38.6
WP_083110907.1\|1124332_1124911_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
1124416:1124430	attL	NA	NA	NA	NA
WP_083110906.1\|1124982_1126698_-	EAL domain-containing protein	NA	NA	NA	NA
WP_005483216.1\|1127001_1128363_-	L-serine ammonia-lyase	NA	NA	NA	NA
WP_005458812.1\|1128461_1129715_-	serine transporter	NA	NA	NA	NA
WP_005458814.1\|1130069_1130669_-	CoA pyrophosphatase	NA	NA	NA	NA
WP_015296942.1\|1130960_1131500_+	guanylate cyclase-related protein	NA	NA	NA	NA
WP_005458818.1\|1131507_1133208_+	response regulator	A0A1V0SGX0	Hokovirus	6.7e-47	32.2
WP_025520933.1\|1133335_1134700_-	aminodeoxychorismate synthase component I	S4VT78	Pandoravirus	2.3e-42	40.2
WP_011105977.1\|1134878_1134968_-	hypothetical protein	NA	NA	NA	NA
WP_005376905.1\|1134971_1136489_+	fumarate hydratase	NA	NA	NA	NA
WP_005458825.1\|1136662_1136848_+	hypothetical protein	NA	NA	NA	NA
WP_083110905.1\|1137059_1138436_+	YcjX family protein	NA	NA	NA	NA
WP_042772260.1\|1138432_1139473_+	TIGR01620 family protein	NA	NA	NA	NA
WP_025520736.1\|1139573_1141118_+	transcriptional regulator TyrR	NA	NA	NA	NA
WP_025520734.1\|1141154_1141739_+	ribosomal protein S5-alanine N-acetyltransferase	NA	NA	NA	NA
WP_020838800.1\|1141740_1142328_+	HD domain-containing protein	NA	NA	NA	NA
WP_005458833.1\|1142341_1142815_+	DUF2947 domain-containing protein	NA	NA	NA	NA
WP_083110909.1\|1142865_1143828_-\|integrase	integron integrase	A0A0K2CP59	Brevibacillus_phage	1.5e-14	25.4
WP_069545923.1\|1144074_1144353_+	hypothetical protein	NA	NA	NA	NA
WP_134991287.1\|1144315_1144777_+	hypothetical protein	NA	NA	NA	NA
WP_005377014.1\|1144791_1144884_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_042765618.1\|1144910_1145270_+	hypothetical protein	NA	NA	NA	NA
WP_139138405.1\|1146254_1146458_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_024701703.1\|1146375_1146885_+	hypothetical protein	NA	NA	NA	NA
WP_079885542.1\|1146899_1146992_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_079858292.1\|1147351_1147474_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_069545634.1\|1147491_1148154_+	hypothetical protein	NA	NA	NA	NA
1148123:1148137	attR	NA	NA	NA	NA
WP_079858291.1\|1148168_1148261_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_158111769.1\|1148281_1149481_-\|transposase	IS4 family transposase	Q9E8P4	Bluetongue_virus	5.9e-98	45.8
WP_083110941.1\|1149954_1150044_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_005376987.1\|1150076_1150571_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_020198239.1\|1151234_1151591_+	hypothetical protein	NA	NA	NA	NA
WP_158111769.1\|1151736_1152936_-\|transposase	IS4 family transposase	Q9E8P4	Bluetongue_virus	5.9e-98	45.8
WP_079858339.1\|1153384_1153513_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_021822656.1\|1153539_1153998_+	transglutaminase-like superfamily protein	NA	NA	NA	NA
WP_011105946.1\|1154161_1154950_+	hypothetical protein	NA	NA	NA	NA
WP_042773169.1\|1155089_1155362_+	PnuC protein	NA	NA	NA	NA
WP_076665302.1\|1155393_1155483_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_042773103.1\|1155593_1156226_+	hypothetical protein	NA	NA	NA	NA
WP_158111769.1\|1156361_1157561_-\|transposase	IS4 family transposase	Q9E8P4	Bluetongue_virus	5.9e-98	45.8
WP_069545273.1\|1158211_1158778_-	hypothetical protein	NA	NA	NA	NA
WP_083110866.1\|1158840_1159026_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_025590586.1\|1159006_1159540_+	hypothetical protein	NA	NA	NA	NA
WP_080255292.1\|1159560_1159653_+	DUF3265 domain-containing protein	NA	NA	NA	NA
WP_020838906.1\|1159660_1159978_-	CcdB family protein	NA	NA	NA	NA
WP_025590680.1\|1159977_1160223_-	type II toxin-antitoxin system CcdA family antitoxin	NA	NA	NA	NA
WP_158111769.1\|1160410_1161610_-\|transposase	IS4 family transposase	Q9E8P4	Bluetongue_virus	5.9e-98	45.8
WP_020838909.1\|1161885_1162542_+\|transposase	IS3 family transposase	U5P429	Shigella_phage	3.1e-40	51.6

DBSCAN-SWA_3

1395965 : 1404556

Vibrio_phage(90.91%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_012842279.1\|1395965_1397351_-	toxin	Q783T9	Vibrio_phage	6.1e-264	99.8
WP_005477634.1\|1397355_1397700_-	DUF2523 domain-containing protein	Q783U0	Vibrio_phage	5.0e-58	100.0
WP_024701897.1\|1397701_1398808_-	hypothetical protein	Q783U1	Vibrio_phage	3.7e-155	98.1
WP_011105866.1\|1399210_1399321_-	hypothetical protein	NA	NA	NA	NA
WP_005495000.1\|1399333_1399579_-	hypothetical protein	Q783U2	Vibrio_phage	3.7e-31	97.5
WP_005477619.1\|1399584_1399815_-	hypothetical protein	Q783U3	Vibrio_phage	1.6e-36	100.0
WP_005477647.1\|1399818_1400178_-	DUF1293 domain-containing protein	Q783U4	Vibrio_phage	9.1e-63	100.0
WP_078554721.1\|1400181_1401390_-	phage replication protein	Q7DKP2	Vibrio_phage	7.9e-244	99.8
WP_005488200.1\|1401313_1401529_-	hypothetical protein	A0A1W6UGD1	Vibrio_phage	1.8e-34	98.6
WP_158111796.1\|1401532_1402156_-	3'-5' exonuclease	W6ASW5	Vibrio_phage	1.1e-39	50.3
WP_158111797.1\|1402289_1402658_+	hypothetical protein	Q9MCC3	Vibrio_phage	1.6e-33	59.5
WP_029862342.1\|1402825_1404556_-	response regulator	A0A1V0SGX0	Hokovirus	1.7e-42	31.0

DBSCAN-SWA_4

1650227 : 1664095

Vibrio_phage(45.45%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005495398.1\|1650227_1652453_-	ribonuclease R	Q0GXV6	Lactococcus_phage	8.2e-61	31.7
WP_005483265.1\|1652747_1652960_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.9e-16	61.2
WP_005483162.1\|1653866_1654070_+	hypothetical protein	NA	NA	NA	NA
WP_005495402.1\|1654292_1654700_-	APSE-2 prophage; Q protein	NA	NA	NA	NA
WP_158111816.1\|1654736_1655138_-	hypothetical protein	A0A2I7S3K0	Vibrio_phage	2.8e-20	45.0
WP_024702643.1\|1655306_1655957_-	DUF1367 family protein	K7PKS6	Enterobacteria_phage	7.0e-21	36.5
WP_005495410.1\|1655949_1656330_-	hypothetical protein	NA	NA	NA	NA
WP_158111817.1\|1656326_1656899_-	hypothetical protein	R9TPU9	Vibrio_phage	7.5e-27	40.0
WP_158111818.1\|1656840_1657179_-	hypothetical protein	A0A1V0E8B1	Vibrio_phage	1.6e-13	47.3
WP_005495414.1\|1657295_1657514_-	hypothetical protein	NA	NA	NA	NA
WP_005495415.1\|1657510_1657975_-	hypothetical protein	K7PJS5	Enterobacterial_phage	3.0e-18	48.0
WP_021486590.1\|1657994_1658216_-	helix-turn-helix transcriptional regulator	A0A1P8DTF8	Proteus_phage	2.8e-06	40.6
WP_024702645.1\|1658324_1658993_+	helix-turn-helix domain-containing protein	A0A1V0E8B5	Vibrio_phage	1.1e-66	57.1
WP_127463331.1\|1659705_1659885_+	hypothetical protein	NA	NA	NA	NA
WP_158111819.1\|1659897_1663062_+	hypothetical protein	I3PUZ3	Vibrio_phage	1.1e-23	33.6
WP_021453095.1\|1663054_1663582_+	siphovirus Gp157 family protein	NA	NA	NA	NA
WP_021453797.1\|1663906_1664095_+	hypothetical protein	F6LQB8	Bdellovibrio_phage	8.8e-09	52.8

DBSCAN-SWA_5

2365738 : 2372440

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005440184.1\|2365738_2366209_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3
WP_005496254.1\|2366378_2367488_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_025610181.1\|2367657_2368311_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_042772180.1\|2368323_2369448_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	2.4e-48	36.0
WP_005482986.1\|2369455_2369905_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_042772658.1\|2370032_2371283_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.0e-98	47.7
WP_005483011.1\|2371300_2372440_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046759

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046759_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046759_1

783990-784087

Orphan

Consensus_repeat	Method
TTTTTGAAAAGGCGTTTTAAAAATA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP046759_1

>merge|NZ_CP046759|1|783990-784087|CRISPRCasFinder
TTTTTGAAAAGGCGTTTTAAAAATATTGATTGCGATCTTGTTTTTCTGGATTCTTTAATTGCGTGGTTTCAAATTTTTGAAAAGGCATTTTAAAAATA

>NZ_CP046759|1|1|783990-784087|CRISPRCasFinder
TTTTTGAAAAGGCGTTTTAAAAATA	TTGATTGCGATCTTGTTTTTCTGGATTCTTTAATTGCGTGGTTTCAAA
TTTTTGAAAAGGCATTTTAAAAATA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046759.1\|WP_042772501.1\|789643_790792_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260
NZ_CP046759.1\|WP_005467181.1\|782257_782578_-\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP046759.1\|WP_042772499.1\|780592_781504_-\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP046759.1\|WP_005464959.1\|792599_793691_+\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP046759.1\|WP_005460779.1\|781581_782217_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP046759.1\|WP_042772867.1\|776198_776876_-\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP046759.1\|WP_005497706.1\|782585_783110_-\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP046759.1\|WP_031792263.1\|793700_794105_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046759.1\|WP_005482884.1\|779564_780494_-\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP046759.1\|WP_042772498.1\|777005_778745_+\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP046759.1\|WP_005464966.1\|790853_791693_+\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP046759.1\|WP_005482916.1\|783128_783890_-\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP046759.1\|WP_005464972.1\|787593_788463_-\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP046759.1\|WP_017447055.1\|785011_786880_+\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP046759.1\|WP_006740949.1\|788543_789350_-\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP046759.1\|WP_134991064.1\|773954_776183_-\|exopolygalacturonate-lyase	unknown	unknown	unknown
NZ_CP046759.1\|WP_005497702.1\|784130_784928_+\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP046759.1\|WP_042772500.1\|786882_787593_+\|3'-5'-exonuclease	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|176648
NZ_CP046759.1\|WP_005482833.1\|792138_792600_+\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP046759.1\|WP_005460834.1\|778929_779553_-\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577

Protein	Function_ID	Function_description	E-value
NZ_CP046759.1\|WP_042772501.1\|789643_790792_+\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP046759.1\|WP_005467181.1\|782257_782578_-\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP046759.1\|WP_042772499.1\|780592_781504_-\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	5.62645e-18
NZ_CP046759.1\|WP_005464959.1\|792599_793691_+\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP046759.1\|WP_005460779.1\|781581_782217_-\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP046759.1\|WP_042772867.1\|776198_776876_-\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	1.68103e-24
NZ_CP046759.1\|WP_005497706.1\|782585_783110_-\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP046759.1\|WP_042772498.1\|777005_778745_+\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	1.56259e-108
NZ_CP046759.1\|WP_005464966.1\|790853_791693_+\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.2905e-143
NZ_CP046759.1\|WP_005482916.1\|783128_783890_-\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP046759.1\|WP_005464972.1\|787593_788463_-\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP046759.1\|WP_017447055.1\|785011_786880_+\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	1.39963e-139
NZ_CP046759.1\|WP_006740949.1\|788543_789350_-\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.88138e-97
NZ_CP046759.1\|WP_005482884.1\|779564_780494_-\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP046759.1\|WP_005497702.1\|784130_784928_+\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP046759.1\|WP_042772500.1\|786882_787593_+\|3'-5'-exonuclease	gnl\|CDD\|176648	cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others.	3.16363e-38
NZ_CP046759.1\|WP_005482833.1\|792138_792600_+\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP046759.1\|WP_005460834.1\|778929_779553_-\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121

>NZ_CP046759.1|WP_005482916.1|783128_783890_-|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP046759.1|WP_005497706.1|782585_783110_-|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP046759.1|WP_005467181.1|782257_782578_-|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP046759.1|WP_005460779.1|781581_782217_-|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP046759.1|WP_042772499.1|780592_781504_-|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFDITHPEIVVFEPEQSNGMGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGSWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSIVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP046759.1|WP_005482884.1|779564_780494_-|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP046759.1|WP_005460834.1|778929_779553_-|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP046759.1|WP_042772498.1|777005_778745_+|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVIVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAHATPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATVVSGVLATATALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSLPLTPRESKDLSVVATLAVHLLVTGGFFLFTRVFYAKESPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILAGVVLTGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP046759.1|WP_042772867.1|776198_776876_-|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSITPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP046759.1|WP_134991064.1|773954_776183_-|exopolygalacturonate-lyase
MKKHTLALCLAAILAPAAHAAEIKFEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGEAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFIEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDFATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKMLAPLKQASVIDTQQAIPGKQEAMQLKQLIH
>NZ_CP046759.1|WP_005497702.1|784130_784928_+|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP046759.1|WP_017447055.1|785011_786880_+|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKDGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP046759.1|WP_042772500.1|786882_787593_+|3'-5'-exonuclease
MIKRWFKRWETPLSPEQKRQAIHVIDDWPMVLKDYLQRPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQALAKGLPLDEGMNRLLERITGKVVIAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP046759.1|WP_005464972.1|787593_788463_-|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP046759.1|WP_006740949.1|788543_789350_-|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP046759.1|WP_042772501.1|789643_790792_+|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGKPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP046759.1|WP_005464966.1|790853_791693_+|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP046759.1|WP_005482833.1|792138_792600_+|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP046759.1|WP_005464959.1|792599_793691_+|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP046759.1|WP_031792263.1|793700_794105_+|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTLSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATTNYVR

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 11601

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_134991017.1\|623_716_+	hypothetical protein	NA	NA	NA	NA
WP_134991016.1\|787_1192_+	Hpt domain-containing protein	NA	NA	NA	NA
WP_069545416.1\|1288_2920_+	response regulator	NA	NA	NA	NA
WP_005454149.1\|2993_3158_+	hypothetical protein	NA	NA	NA	NA
WP_005498652.1\|3138_3759_+	response regulator transcription factor	NA	NA	NA	NA
WP_011106339.1\|3769_4759_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158111555.1\|4816_6187_-	diguanylate cyclase	G3MA91	Bacillus_virus	3.4e-09	29.1
WP_042772589.1\|6196_6793_-	response regulator transcription factor	NA	NA	NA	NA
WP_017447645.1\|6785_7952_-	EAL domain-containing protein	NA	NA	NA	NA
WP_069545417.1\|7935_11601_-	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	4.2e-30	35.4

DBSCAN-SWA_2

28460 : 29369

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454057.1\|28460_29369_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.4e-06	36.8

DBSCAN-SWA_3

37978 : 43294

Escherichia_phage(50.0%)

integrase

attL 25107:25122|attR 49827:49842

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
25107:25122	attL	NA	NA	NA	NA
WP_025520387.1\|37978_39199_+\|integrase	tyrosine-type recombinase/integrase	A0A1B5FPC6	Escherichia_phage	5.5e-75	40.4
WP_158111557.1\|39344_40646_-	restriction endonuclease	NA	NA	NA	NA
WP_158111709.1\|40645_43294_-	AAA domain-containing protein	K4I1H4	Acidithiobacillus_phage	4.9e-28	38.7
49827:49842	attR	NA	NA	NA	NA

DBSCAN-SWA_4

48196 : 51141

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111559.1\|48196_49654_-	type I restriction endonuclease subunit S	A0A1V0SLK8	Klosneuvirus	2.5e-10	28.1
WP_158111560.1\|49650_51141_-	N-6 DNA methylase	J7I0U9	Acinetobacter_phage	5.5e-29	26.7

DBSCAN-SWA_5

99243 : 99423

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029559956.1\|99243_99423_-	AlpA family transcriptional regulator	A0A1V0E8E5	Vibrio_phage	2.4e-08	48.3

DBSCAN-SWA_6

107464 : 109849

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025626756.1\|107464_109849_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	6.6e-08	26.6

DBSCAN-SWA_7

114103 : 121660

Ectocarpus_siliculosus_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024701329.1\|114103_116152_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	6.1e-10	33.9
WP_005481262.1\|116471_117089_+	HAD family phosphatase	NA	NA	NA	NA
WP_015313129.1\|117174_117723_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025534581.1\|117994_119119_+	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.4e-32	33.1
WP_069545421.1\|119472_120840_+	anaerobic C4-dicarboxylate transporter DcuC	NA	NA	NA	NA
WP_079858226.1\|121057_121660_+	LemA family protein	A0A1X9IGG1	Lactococcus_phage	1.0e-18	36.4

DBSCAN-SWA_8

132665 : 135079

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025624892.1\|132665_133565_-	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.1e-11	23.8
WP_011106326.1\|133574_134504_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_158111567.1\|134653_135079_-	riboflavin-specific deaminase	A0A1V0SE20	Indivirus	2.2e-23	49.6

DBSCAN-SWA_9

140781 : 144793

Sulfolobus_monocaudavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376549.1\|140781_141765_-	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	1.5e-06	24.3
WP_158111571.1\|141850_143152_-	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_005454209.1\|143266_144793_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.1e-136	53.3

DBSCAN-SWA_10

148253 : 151658

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021452642.1\|148253_149801_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.5e-165	57.6
WP_025558453.1\|150110_151658_-	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.5e-135	50.6

DBSCAN-SWA_11

155015 : 161742

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111573.1\|155015_157982_-	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	2.4e-52	33.6
WP_031817305.1\|158070_159075_+	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_005454351.1\|159138_159594_+	methylglyoxal synthase	NA	NA	NA	NA
WP_158111574.1\|159672_161742_-	DNA helicase IV	A7KV33	Bacillus_phage	6.5e-20	26.6

DBSCAN-SWA_12

181849 : 182101

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454365.1\|181849_182101_+	membrane protein	A0A248SJ16	Salicola_phage	2.7e-05	38.9

DBSCAN-SWA_13

186258 : 188895

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005486233.1\|186258_187014_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.7e-14	26.2
WP_089183622.1\|187016_187967_-	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_025442666.1\|187959_188895_-	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	9.0e-70	43.2

DBSCAN-SWA_14

202835 : 207344

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545437.1\|202835_203669_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	6.9e-05	28.4
WP_042773140.1\|203684_204257_-	protocatechuate 3,4-dioxygenase	NA	NA	NA	NA
WP_020842245.1\|204427_205096_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_017448108.1\|205092_205782_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_005455702.1\|205783_206527_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_079858231.1\|206615_207344_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	2.6e-24	34.0

DBSCAN-SWA_15

211847 : 213233

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042773233.1\|211847_213233_-	FAD-binding oxidoreductase	S4VXI2	Pandoravirus	2.0e-36	27.4

DBSCAN-SWA_16

221733 : 223470

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772815.1\|221733_222492_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-06	26.8
WP_042772816.1\|222567_223470_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.2e-23	28.3

DBSCAN-SWA_17

231307 : 245548

Pike_perch_iridovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053316830.1\|231307_232912_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	66.7
WP_042772299.1\|232949_233795_+	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_053316829.1\|233791_234694_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	5.1e-46	37.7
WP_042772298.1\|234729_235281_-	membrane protein	NA	NA	NA	NA
WP_005485953.1\|235306_236185_-	DMT family transporter	NA	NA	NA	NA
WP_021450763.1\|236470_237784_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-18	39.9
WP_005483382.1\|238063_239257_-	acetate kinase	NA	NA	NA	NA
WP_005483343.1\|239289_239415_+	hypothetical protein	NA	NA	NA	NA
WP_011106309.1\|239554_241156_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	4.6e-13	32.0
WP_005483383.1\|241230_243162_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.4e-53	30.6
WP_017448089.1\|243541_245548_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	1.5e-32	24.7

DBSCAN-SWA_18

255049 : 258307

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074530807.1\|255049_256606_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.0e-33	44.6
WP_158111581.1\|256852_258307_+	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.1e-08	24.4

DBSCAN-SWA_19

265112 : 266405

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005482719.1\|265112_266405_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.5e-49	30.8

DBSCAN-SWA_20

271708 : 279769

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313050.1\|271708_272959_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.1e-46	31.2
WP_005375557.1\|273228_273444_-	hypothetical protein	NA	NA	NA	NA
WP_020842285.1\|273617_273926_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_074530813.1\|273967_274336_-	HopJ type III effector protein	NA	NA	NA	NA
WP_100550153.1\|274480_274576_-	hypothetical protein	NA	NA	NA	NA
WP_079858269.1\|274553_276293_+	alkaline phosphatase	E3SII1	Synechococcus_phage	1.2e-06	34.4
WP_065780171.1\|276454_276793_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_042772290.1\|276782_277577_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_025442903.1\|277798_279769_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.9e-17	25.5

DBSCAN-SWA_21

290242 : 295007

Clostridium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005461991.1\|290242_290722_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.8e-18	34.8
WP_158111583.1\|290938_292981_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.1e-15	28.1
WP_042773149.1\|293083_294301_-	hypothetical protein	NA	NA	NA	NA
WP_015313031.1\|294293_295007_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.3e-38	44.7

DBSCAN-SWA_22

298364 : 302525

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545463.1\|298364_299807_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.7e-14	31.4
WP_077280898.1\|299959_300178_-	hypothetical protein	NA	NA	NA	NA
WP_069545464.1\|300282_301626_+	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-13	52.6
WP_021450728.1\|301654_301948_-	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_005375625.1\|302315_302525_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1

DBSCAN-SWA_23

311355 : 316178

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772164.1\|311355_312993_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	2.6e-11	36.4
WP_023584659.1\|312989_314153_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_005482641.1\|314483_316178_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.1e-92	36.7

DBSCAN-SWA_24

324382 : 324997

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772171.1\|324382_324997_+	glutaredoxin	A0A0K1YA09	Cronobacter_phage	1.7e-08	42.3

DBSCAN-SWA_25

328345 : 331502

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005461969.1\|328345_330166_+	phosphodiesterase	A0A127AWB9	Bacillus_phage	4.7e-06	28.2
WP_011106286.1\|330218_331502_-	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	2.3e-15	48.9

DBSCAN-SWA_26

335921 : 337793

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020842326.1\|335921_337793_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-13	39.6

DBSCAN-SWA_27

355424 : 359228

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111590.1\|355424_357056_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-33	52.0
WP_083110663.1\|357349_358297_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158111591.1\|358301_359228_+	ATP-binding cassette domain-containing protein	A0A285PWH2	Cedratvirus	1.8e-22	34.1

DBSCAN-SWA_28

375904 : 378126

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005459715.1\|375904_376756_+	carbenicillin-hydrolyzing class A beta-lactamase CARB-18	A0A077SL40	Escherichia_phage	8.3e-54	44.4
WP_005459714.1\|377058_378126_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.0e-17	30.7

DBSCAN-SWA_29

387294 : 391230

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111594.1\|387294_389454_-	prolyl oligopeptidase family serine peptidase	A0A1V0SHT0	Klosneuvirus	7.9e-69	34.5
WP_158111595.1\|389658_391230_-	ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	3.8e-28	30.2

DBSCAN-SWA_30

404593 : 405064

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005457571.1\|404593_405064_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	1.7e-21	37.4

DBSCAN-SWA_31

410348 : 412253

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111600.1\|410348_412253_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	1.0e-43	31.1

DBSCAN-SWA_32

424161 : 431588

Proteus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005479244.1\|424161_424671_-	ribonuclease HI	A0A2H4PRM3	Proteus_phage	4.8e-17	36.9
WP_021454809.1\|424839_425451_-	hypothetical protein	NA	NA	NA	NA
WP_011105698.1\|425937_426099_-	hypothetical protein	NA	NA	NA	NA
WP_005479249.1\|426112_426313_-	hypothetical protein	NA	NA	NA	NA
WP_078532929.1\|426460_427111_-	resolvase	Q1MVP4	Enterobacteria_phage	8.3e-14	33.2
WP_005479243.1\|427292_428252_-	hypothetical protein	NA	NA	NA	NA
WP_005479264.1\|428336_430064_-	recombinase family protein	Q3HQV4	Burkholderia_phage	7.1e-28	28.7
WP_005479216.1\|430126_430408_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_011106269.1\|430312_430528_+	hypothetical protein	NA	NA	NA	NA
WP_005457535.1\|430673_431588_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	2.1e-23	25.4

DBSCAN-SWA_33

438861 : 439644

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111607.1\|438861_439644_+	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	1.8e-15	30.3

DBSCAN-SWA_34

445627 : 446458

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140052719.1\|445627_446458_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.4e-59	48.2

DBSCAN-SWA_35

465450 : 467034

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545497.1\|465450_467034_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-52	35.7

DBSCAN-SWA_36

474085 : 475144

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545502.1\|474085_475144_-	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	7.4e-12	25.7

DBSCAN-SWA_37

480432 : 490043

Brazilian_cedratvirus(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464135.1\|480432_481689_+	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	4.5e-48	31.7
WP_158111611.1\|482102_483167_+	L-asparaginase 2	NA	NA	NA	NA
WP_005464081.1\|483248_484085_-	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_005464140.1\|484283_486671_+	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.5e-172	38.0
WP_011106262.1\|486823_486934_-	hypothetical protein	NA	NA	NA	NA
WP_005498116.1\|486890_487670_+	hypothetical protein	NA	NA	NA	NA
WP_005498115.1\|487894_488701_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_089183559.1\|488783_490043_+\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	2.2e-87	43.9

DBSCAN-SWA_38

499244 : 500261

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447948.1\|499244_500261_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.3e-17	29.2

DBSCAN-SWA_39

504523 : 506143

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079725741.1\|504523_506143_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	7.4e-11	23.8

DBSCAN-SWA_40

510772 : 511792

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545511.1\|510772_511792_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-35	38.6

DBSCAN-SWA_41

517339 : 520498

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025526447.1\|517339_520498_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	5.1e-48	20.7

DBSCAN-SWA_42

532007 : 534032

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545518.1\|532007_534032_+	elongation factor G	A0A1S5SF82	Streptococcus_phage	1.8e-35	23.1

DBSCAN-SWA_43

540877 : 541762

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464181.1\|540877_541762_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.6e-13	35.8

DBSCAN-SWA_44

545207 : 550458

Agrobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021821357.1\|545207_546518_-	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.5e-41	31.2
WP_005463941.1\|546817_547543_+	NUDIX hydrolase	NA	NA	NA	NA
WP_005464054.1\|547575_548229_+	nicotinamidase	NA	NA	NA	NA
WP_089183553.1\|548347_548815_-	ankyrin repeat domain-containing protein	NA	NA	NA	NA
WP_079748628.1\|548916_550458_-	catalase	A0A2K9L0T1	Tupanvirus	7.1e-104	48.6

DBSCAN-SWA_45

561317 : 569304

Burkholderia_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089183549.1\|561317_562208_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.3e-12	25.6
WP_021821339.1\|562317_562929_+	LysE family transporter	NA	NA	NA	NA
WP_005463923.1\|563018_563990_-	leukocidin/Hemolysin toxin family	NA	NA	NA	NA
WP_005464025.1\|564146_564356_-	hypothetical protein	NA	NA	NA	NA
WP_005463958.1\|564461_566060_-	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.7e-181	66.2
WP_005373989.1\|566093_566384_-	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_005481539.1\|566643_566994_+	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	2.0e-06	30.8
WP_025516812.1\|567149_567614_-	hypothetical protein	NA	NA	NA	NA
WP_069545533.1\|567624_569304_-	LruC domain-containing protein	A0A1V0SGG5	Hokovirus	3.7e-13	25.8

DBSCAN-SWA_46

588520 : 590285

Halocynthia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025794569.1\|588520_589267_+	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	1.8e-12	36.8
WP_005464022.1\|589766_590285_-	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	3.5e-31	46.2

DBSCAN-SWA_47

599436 : 600414

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312861.1\|599436_600414_-	OmpA family protein	G3M9Z0	Bacillus_virus	8.7e-07	26.0

DBSCAN-SWA_48

608850 : 609969

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772253.1\|608850_609969_-	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-30	36.3

DBSCAN-SWA_49

619456 : 621490

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464000.1\|619456_621490_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.4e-28	30.9

DBSCAN-SWA_50

624734 : 626699

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545545.1\|624734_626699_-	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	2.7e-39	40.8

DBSCAN-SWA_51

634760 : 635447

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111617.1\|634760_635447_+	HTH domain-containing protein	A0A1B0RXM1	Streptococcus_phage	3.0e-14	30.7

DBSCAN-SWA_52

644847 : 649771

Bacillus_thuringiensis_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029559701.1\|644847_645555_-	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	4.3e-32	37.3
WP_029559702.1\|645554_647099_-	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	3.5e-50	28.4
WP_069545550.1\|647099_648437_-	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	1.4e-26	36.9
WP_005479978.1\|648757_649771_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-16	35.9

DBSCAN-SWA_53

654690 : 656789

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005479983.1\|654690_656046_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.1e-14	34.8
WP_005479964.1\|656183_656789_+	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A1X6WG33	Pacmanvirus	2.7e-19	34.6

DBSCAN-SWA_54

681528 : 682419

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111619.1\|681528_682419_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.3e-06	37.2

DBSCAN-SWA_55

687304 : 696269

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005393578.1\|687304_688225_+	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8
WP_025612041.1\|688636_689842_+	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_158111620.1\|690168_692334_+	prolyl oligopeptidase family serine peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	6.4e-34	27.0
WP_005497853.1\|692543_693539_-	porin	Q1MVN1	Enterobacteria_phage	6.6e-10	24.6
WP_025533286.1\|693754_694624_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005479618.1\|694659_695535_-	metal ABC transporter permease	NA	NA	NA	NA
WP_029831225.1\|695534_696269_-	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	5.7e-11	23.4

DBSCAN-SWA_56

707612 : 713469

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079858262.1\|707612_708989_-	sensor histidine kinase	W8CYF6	Bacillus_phage	2.7e-14	25.0
WP_069545558.1\|708985_709651_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-26	35.3
WP_025638189.1\|709809_710763_-	malate dehydrogenase	NA	NA	NA	NA
WP_017448053.1\|711020_711731_+	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	6.3e-15	26.1
WP_011106223.1\|711761_712259_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_021484391.1\|712473_713469_+	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.3e-69	42.7

DBSCAN-SWA_57

725855 : 726614

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069546027.1\|725855_726614_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	7.2e-25	38.0

DBSCAN-SWA_58

731528 : 736620

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069546026.1\|731528_733976_-	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	1.7e-80	30.6
WP_005459939.1\|733998_735093_-	cytochrome c	NA	NA	NA	NA
WP_042772902.1\|735363_735879_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015312791.1\|735888_736620_+	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	3.7e-26	31.7

DBSCAN-SWA_59

740373 : 743064

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140300040.1\|740373_741831_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	2.6e-23	26.4
WP_140300038.1\|741927_743064_-	glycerate kinase	W6LM47	Streptococcus_phage	2.2e-41	37.4

DBSCAN-SWA_60

748738 : 755631

Klosneuvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069546023.1\|748738_749275_+	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	1.1e-22	35.2
WP_069546022.1\|749300_750011_+	HAD family hydrolase	NA	NA	NA	NA
WP_024702302.1\|750107_750425_+	DUF4144 domain-containing protein	NA	NA	NA	NA
WP_025536220.1\|750563_751049_+	VOC family protein	NA	NA	NA	NA
WP_140290452.1\|751121_752063_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_069546021.1\|752177_753485_+	DUF1254 domain-containing protein	M1H738	Paramecium_bursaria_Chlorella_virus	5.2e-31	27.6
WP_042772862.1\|753636_754479_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017447038.1\|754633_755059_+	lactoylglutathione lyase	NA	NA	NA	NA
WP_025592664.1\|755118_755631_+	macro domain-containing protein	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	2.3e-27	52.5

DBSCAN-SWA_61

767086 : 768265

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447048.1\|767086_768265_-	spindolin	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	4.0e-30	37.3

DBSCAN-SWA_62

783128 : 796995

Chrysochromulina_ericina_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005482916.1\|783128_783890_-	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	A0A0N9R355	Chrysochromulina_ericina_virus	1.4e-12	25.5
WP_005497702.1\|784130_784928_+	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_017447055.1\|785011_786880_+	CBS domain-containing protein	NA	NA	NA	NA
WP_042772500.1\|786882_787593_+	3'-5' exonuclease	A0A1P8VVD4	Rathayibacter_phage	4.1e-06	25.9
WP_005464972.1\|787593_788463_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_006740949.1\|788543_789350_-	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_042772501.1\|789643_790792_+	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	1.2e-34	29.2
WP_005464966.1\|790853_791693_+	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_005482833.1\|792138_792600_+	oxidoreductase	NA	NA	NA	NA
WP_005464959.1\|792599_793691_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.5e-11	30.6
WP_031792263.1\|793700_794105_+	hypothetical protein	NA	NA	NA	NA
WP_042772502.1\|794215_795019_-	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_020841638.1\|795114_796002_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005455527.1\|796128_796995_+	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	1.2e-20	28.0

DBSCAN-SWA_63

801419 : 807077

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464995.1\|801419_802577_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-11	27.4
WP_005464981.1\|802596_802878_-	hypothetical protein	NA	NA	NA	NA
WP_005464991.1\|803048_803333_-	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_069546009.1\|803657_804161_+	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_005497676.1\|804530_807077_+	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	3.8e-147	47.9

DBSCAN-SWA_64

814127 : 814610

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464913.1\|814127_814610_-	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	8.9e-29	47.7

DBSCAN-SWA_65

824178 : 825036

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497657.1\|824178_825036_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-18	29.6

DBSCAN-SWA_66

830027 : 834942

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025594204.1\|830027_831689_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-18	48.3
WP_158111623.1\|831807_832302_+	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.7e-11	31.4
WP_158111624.1\|832404_833040_-	hypothetical protein	NA	NA	NA	NA
WP_005481713.1\|833117_833909_-	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	4.6e-06	19.7
WP_140325265.1\|833910_834942_-	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	9.1e-23	33.3

DBSCAN-SWA_67

838337 : 839036

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005481731.1\|838337_839036_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-42	42.9

DBSCAN-SWA_68

842491 : 848972

Hokovirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111627.1\|842491_844390_-	response regulator	A0A1V0SGX0	Hokovirus	9.4e-58	34.7
WP_005484702.1\|844458_845214_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_011106202.1\|845255_845351_-	hypothetical protein	NA	NA	NA	NA
WP_015312732.1\|845319_846381_-	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.5e-40	44.5
WP_005477395.1\|846625_846826_-	hypothetical protein	NA	NA	NA	NA
WP_074530969.1\|847149_848043_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	2.9e-17	30.5
WP_069545998.1\|848039_848972_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-14	33.2

DBSCAN-SWA_69

852950 : 861118

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005500197.1\|852950_854168_+	ParA family protein	Q1MVJ3	Enterobacteria_phage	3.8e-36	29.2
WP_025788641.1\|854175_855150_+	ParB/RepB/Spo0J family partition protein	O64340	Escherichia_phage	2.3e-23	31.4
WP_140283523.1\|855244_857296_+	GNAT family N-acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	5.9e-13	30.4
WP_020838336.1\|857722_859402_+	DUF342 domain-containing protein	NA	NA	NA	NA
WP_042772601.1\|859458_860118_-	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.4e-24	39.2
WP_042772602.1\|860206_861118_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.5e-10	24.8

DBSCAN-SWA_70

871000 : 873115

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464845.1\|871000_873115_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	3.1e-33	26.7

DBSCAN-SWA_71

881649 : 884020

Vibrio_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_043028050.1\|881649_882405_-	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	4.9e-34	41.1
WP_005484739.1\|883086_883206_+	hypothetical protein	NA	NA	NA	NA
WP_005468852.1\|883207_884020_+	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.8e-05	35.4

DBSCAN-SWA_72

891424 : 896775

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772611.1\|891424_891958_-	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	8.9e-06	30.8
WP_020838321.1\|892318_892567_+	hypothetical protein	NA	NA	NA	NA
WP_083110887.1\|892574_892742_-	hypothetical protein	NA	NA	NA	NA
WP_005465952.1\|893064_893541_+	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005484721.1\|893621_894329_-	hypothetical protein	NA	NA	NA	NA
WP_083110886.1\|894924_896775_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	4.3e-31	23.9

DBSCAN-SWA_73

900263 : 901502

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_045587170.1\|900263_901502_+	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	9.9e-48	32.5

DBSCAN-SWA_74

905742 : 909434

Burkholderia_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111631.1\|905742_906675_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.0e-13	24.7
WP_025536452.1\|906696_907782_-	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-13	47.2
WP_011106555.1\|907793_907952_+	hypothetical protein	NA	NA	NA	NA
WP_005477491.1\|908051_908747_-	hypothetical protein	NA	NA	NA	NA
WP_021450468.1\|908948_909434_-	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	1.5e-07	27.9

DBSCAN-SWA_75

912792 : 914361

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025520520.1\|912792_914361_-	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.6e-40	32.4

DBSCAN-SWA_76

924936 : 936656

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005477485.1\|924936_926457_+	L-arabinose ABC transporter ATP-binding protein AraG	G3M9Y6	Bacillus_virus	8.8e-14	28.3
WP_005477508.1\|926471_927461_+	L-arabinose ABC transporter permease AraH	NA	NA	NA	NA
WP_089183511.1\|927554_929546_-	U32 family peptidase	Q6DW11	Phage_TP	8.2e-20	27.4
WP_042772558.1\|929773_930220_+	DUF302 domain-containing protein	NA	NA	NA	NA
WP_017447155.1\|930315_931758_-	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	5.6e-10	42.4
WP_011106551.1\|931831_931921_+	hypothetical protein	NA	NA	NA	NA
WP_005383484.1\|932005_932713_+	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-33	37.5
WP_042772559.1\|932702_934133_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.2e-07	22.1
WP_042772560.1\|934135_935380_+	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_042772561.1\|935453_936656_-	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	1.7e-12	23.8

DBSCAN-SWA_77

950275 : 961066

Planktothrix_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111636.1\|950275_951040_+	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	3.7e-13	29.3
WP_025633767.1\|951158_953045_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.2e-23	45.4
WP_158111637.1\|953461_956209_+	insulinase family protein	L7RBE7	Acanthamoeba_polyphaga_moumouvirus	2.4e-17	33.3
WP_017447171.1\|956266_956719_-	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_005455166.1\|956622_957576_-	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	7.9e-13	41.2
WP_086583475.1\|958049_959777_+	hypothetical protein	NA	NA	NA	NA
WP_025537137.1\|959857_961066_-	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	2.3e-25	24.4

DBSCAN-SWA_78

969464 : 971081

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_140123908.1\|969464_971081_+	endonuclease I	A0A2P0VMP9	Tetraselmis_virus	1.5e-11	30.3

DBSCAN-SWA_79

987052 : 987349

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480175.1\|987052_987349_-	PTS transporter subunit EIIB	A0A2I7SAJ6	Vibrio_phage	1.6e-09	54.1

DBSCAN-SWA_80

994241 : 996695

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480123.1\|994241_996695_+	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	2.3e-16	43.8

DBSCAN-SWA_81

1008652 : 1009027

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005458336.1\|1008652_1009027_+	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.1e-25	53.5

DBSCAN-SWA_82

1021063 : 1022527

Apis_mellifera_filamentous_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772428.1\|1021063_1022527_-	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.5e-13	31.2

DBSCAN-SWA_83

1026536 : 1027694

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111643.1\|1026536_1027694_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.2e-77	43.1

DBSCAN-SWA_84

1049919 : 1054164

Synechococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025625756.1\|1049919_1050594_-	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	8.0e-28	31.8
WP_042772440.1\|1050808_1051738_+	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	4.2e-11	26.6
WP_042772441.1\|1051740_1054164_+	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	2.0e-07	49.1

DBSCAN-SWA_85

1058582 : 1059014

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079725303.1\|1058582_1059014_+	PH domain-containing protein	A5GYQ0	Lactococcus_phage	8.8e-28	50.0

DBSCAN-SWA_86

1083098 : 1084136

Neodiprion_lecontei_nucleopolyhedrovirus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031846193.1\|1083098_1084136_-\|protease	serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	4.6e-14	28.3

DBSCAN-SWA_87

1093907 : 1096610

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079858365.1\|1093907_1094669_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.5e-27	30.5
WP_025520562.1\|1094693_1096067_+	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_005462859.1\|1096094_1096610_-	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.5e-45	59.6

DBSCAN-SWA_88

1102091 : 1104482

Emiliania_huxleyi_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485813.1\|1102091_1103285_+	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	3.6e-39	28.5
WP_005478141.1\|1103450_1104482_+	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5

DBSCAN-SWA_89

1117206 : 1121108

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772350.1\|1117206_1119240_+	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	7.0e-67	32.7
WP_069545963.1\|1119476_1121108_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.5e-19	31.7

DBSCAN-SWA_90

1124477 : 1126106

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478090.1\|1124477_1126106_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.6e-21	38.0

DBSCAN-SWA_91

1129309 : 1130080

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005462912.1\|1129309_1130080_+	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	1.2e-08	28.1

DBSCAN-SWA_92

1133238 : 1139210

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_089183505.1\|1133238_1134978_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	35.1
WP_005375133.1\|1134984_1135533_-	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_005478401.1\|1135870_1137001_-	HlyD family secretion protein	NA	NA	NA	NA
WP_005478107.1\|1137000_1137381_-	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_042772352.1\|1137626_1139210_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.0e-17	39.5

DBSCAN-SWA_93

1144428 : 1152102

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111647.1\|1144428_1145241_+	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	4.7e-22	31.5
WP_158111648.1\|1145250_1146666_+	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	9.8e-60	30.7
WP_025499663.1\|1146672_1147599_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_005462467.1\|1147625_1147880_-	hypothetical protein	NA	NA	NA	NA
WP_158111716.1\|1148431_1149778_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	5.7e-41	28.8
WP_140099624.1\|1150101_1152102_+	prolyl oligopeptidase family serine peptidase	F2Y2S5	Organic_Lake_phycodnavirus	7.0e-11	31.1

DBSCAN-SWA_94

1158681 : 1166665

uncultured_Caudovirales_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042779659.1\|1158681_1160325_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.7e-11	62.5
WP_005462954.1\|1160656_1161478_+	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	2.1e-06	27.6
WP_005462956.1\|1161577_1162510_+	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_005478161.1\|1162532_1163396_+	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_020838153.1\|1163456_1164206_+	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-14	28.6
WP_077280610.1\|1164532_1166665_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-11	33.0

DBSCAN-SWA_95

1174055 : 1180628

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485061.1\|1174055_1175972_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	63.4
WP_005499728.1\|1176028_1176229_+	chromosome segregation ATPase	NA	NA	NA	NA
WP_005499727.1\|1176496_1177168_+	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_083110566.1\|1177394_1178051_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005462984.1\|1178257_1178848_+	calcium-binding protein	NA	NA	NA	NA
WP_079722315.1\|1178897_1180628_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.6e-19	24.7

DBSCAN-SWA_96

1202525 : 1209415

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478119.1\|1202525_1203311_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-13	27.7
WP_158111650.1\|1203363_1205454_-	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_031429486.1\|1205599_1207426_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-30	26.6
WP_075110056.1\|1207673_1208720_+	DUF4118 domain-containing protein	W8CYF6	Bacillus_phage	3.8e-16	26.5
WP_025788454.1\|1208716_1209415_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.6e-24	30.4

DBSCAN-SWA_97

1224637 : 1227081

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463052.1\|1224637_1225516_+	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.6e-29	32.4
WP_015313530.1\|1225641_1227081_-	catalase	A0A2K9L0T1	Tupanvirus	2.8e-102	47.5

DBSCAN-SWA_98

1242770 : 1243889

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463102.1\|1242770_1243889_-	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	5.3e-24	32.4

DBSCAN-SWA_99

1259572 : 1261477

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083110578.1\|1259572_1261477_+	ATP-dependent helicase	A0A068EQC7	Bacillus_phage	2.5e-18	20.3

DBSCAN-SWA_100

1265354 : 1271711

Stx2-converting_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083110579.1\|1265354_1266524_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	2.2e-81	43.9
WP_158111654.1\|1266810_1267215_+	cell division protein DamX	NA	NA	NA	NA
WP_158111655.1\|1267450_1268743_+\|protease	trypsin-like serine protease	V5LS29	Emiliania_huxleyi_virus	3.5e-11	22.7
WP_015313462.1\|1268787_1269261_-	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	47.9
WP_140204268.1\|1269355_1270369_-	adenosine deaminase	NA	NA	NA	NA
WP_129152773.1\|1270586_1270697_-	hypothetical protein	NA	NA	NA	NA
WP_005463370.1\|1270856_1270997_-	hypothetical protein	NA	NA	NA	NA
WP_005463371.1\|1271498_1271711_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	6.2e-19	62.9

DBSCAN-SWA_101

1282794 : 1285691

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_023623684.1\|1282794_1284081_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.1e-21	26.2
WP_005463399.1\|1284081_1284795_-	response regulator	W8CYM9	Bacillus_phage	2.7e-34	35.0
WP_021484492.1\|1284971_1285691_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.9e-06	30.0

DBSCAN-SWA_102

1289027 : 1294175

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029806268.1\|1289027_1289684_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.9e-38	38.9
WP_017447347.1\|1290042_1290660_-	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase	A0A2I7SAF7	Vibrio_phage	7.6e-17	32.7
WP_029806267.1\|1290777_1292631_-	MFS transporter	NA	NA	NA	NA
WP_100661846.1\|1292629_1292737_+	hypothetical protein	NA	NA	NA	NA
WP_029806266.1\|1292777_1293536_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021449427.1\|1293536_1294175_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.7e-11	34.9

DBSCAN-SWA_103

1299715 : 1301038

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_029841508.1\|1299715_1301038_-	AarF/ABC1/UbiB kinase family protein	E5EQ95	Micromonas_sp._RCC1109_virus	2.7e-19	27.0

DBSCAN-SWA_104

1309630 : 1312279

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079858354.1\|1309630_1312279_+	response regulator	A0A1V0SGX0	Hokovirus	1.2e-47	27.2

DBSCAN-SWA_105

1316529 : 1320874

Invertebrate_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463466.1\|1316529_1316850_+	hypothetical protein	W8W2G4	Invertebrate_iridovirus	1.8e-09	44.4
WP_005463467.1\|1317200_1318298_+	autoinducer 2-binding periplasmic protein LuxP	NA	NA	NA	NA
WP_005477121.1\|1318297_1320874_+	response regulator	A0A1V0SGX0	Hokovirus	6.4e-49	33.3

DBSCAN-SWA_106

1326032 : 1326656

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111661.1\|1326032_1326656_+	methyltransferase domain-containing protein	A0A1B1IT46	uncultured_Mediterranean_phage	1.7e-08	27.1

DBSCAN-SWA_107

1331037 : 1334385

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463489.1\|1331037_1331940_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.7
WP_158111662.1\|1332001_1332268_-	hypothetical protein	NA	NA	NA	NA
WP_158111663.1\|1332284_1332905_-	LysE family transporter	NA	NA	NA	NA
WP_005477336.1\|1333644_1334385_+	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	1.0e-07	27.7

DBSCAN-SWA_108

1348235 : 1350232

Xanthomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485131.1\|1348235_1348700_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.6e-25	42.4
WP_005485167.1\|1349104_1350232_+	multidrug efflux RND transporter periplasmic adaptor subunit VmeY	S5VL44	Leptospira_phage	3.7e-09	25.9

DBSCAN-SWA_109

1353504 : 1370698

uncultured_Caudovirales_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485152.1\|1353504_1355274_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-29	29.7
WP_083110585.1\|1355375_1355789_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_025522855.1\|1355865_1356468_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_005463527.1\|1356664_1357654_-	OmpA family protein	NA	NA	NA	NA
WP_005463529.1\|1358115_1359168_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	1.5e-81	50.5
WP_077282325.1\|1359316_1360495_+	MFS transporter	NA	NA	NA	NA
WP_011106437.1\|1360548_1360644_-	hypothetical protein	NA	NA	NA	NA
WP_075984706.1\|1360713_1362282_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	4.5e-29	46.9
WP_015313413.1\|1362407_1364399_-	transketolase	NA	NA	NA	NA
WP_005463537.1\|1364522_1365473_-	transaldolase	A0A127KNC6	Cyanophage	2.5e-11	31.7
WP_005463539.1\|1365716_1365869_-	hypothetical protein	NA	NA	NA	NA
WP_005463541.1\|1365939_1366941_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_042772721.1\|1367072_1368365_+	glycoside hydrolase family 18 protein	A0A1B1V5N4	Malacosoma_sp._alphabaculovirus	1.4e-68	36.3
WP_069545770.1\|1368406_1370698_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	5.5e-12	30.2

DBSCAN-SWA_110

1374787 : 1377724

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499253.1\|1374787_1375537_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	9.3e-09	35.2
WP_158111666.1\|1375546_1376782_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005477356.1\|1377070_1377724_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	7.5e-55	54.3

DBSCAN-SWA_111

1383140 : 1384552

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463567.1\|1383140_1383548_-	helix-turn-helix transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	3.1e-06	41.3
WP_005487989.1\|1383643_1384552_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	4.3e-08	28.8

DBSCAN-SWA_112

1388416 : 1391549

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313401.1\|1388416_1389463_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	7.9e-99	54.5
WP_083110587.1\|1389515_1391549_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.1e-23	25.2

DBSCAN-SWA_113

1395330 : 1396149

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079866578.1\|1395330_1396149_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-13	24.6

DBSCAN-SWA_114

1401431 : 1402253

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020838028.1\|1401431_1402253_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	8.6e-16	28.5

DBSCAN-SWA_115

1416272 : 1424421

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111671.1\|1416272_1418894_+	response regulator	A0A1V0SGX0	Hokovirus	1.0e-41	26.3
WP_158111717.1\|1418988_1419918_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.4e-46	39.1
WP_083110594.1\|1419871_1421971_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_083110595.1\|1421924_1422728_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_042772994.1\|1422813_1424421_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.6e-19	66.7

DBSCAN-SWA_116

1432319 : 1446407

Escherichia_phage(20.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083110598.1\|1432319_1433216_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	2.0e-26	29.8
WP_042772992.1\|1433225_1433984_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_005477089.1\|1434098_1434221_-	hypothetical protein	NA	NA	NA	NA
WP_083110599.1\|1434439_1436488_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.9e-20	43.8
WP_005463648.1\|1437079_1437679_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_158111673.1\|1437697_1439158_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_158111674.1\|1439178_1440909_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	1.5e-49	28.8
WP_025507585.1\|1440957_1441896_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005487988.1\|1441950_1442793_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_042772989.1\|1442795_1443980_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.3e-24	33.2
WP_011106424.1\|1444094_1444829_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_069545747.1\|1445065_1445494_+	globin	NA	NA	NA	NA
WP_005499153.1\|1445621_1446407_-	slipin family protein	A0A2K9L3L2	Tupanvirus	4.8e-24	28.8

DBSCAN-SWA_117

1452299 : 1454657

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111676.1\|1452299_1454657_+	response regulator	A0A1V0SGX0	Hokovirus	9.6e-60	38.2

DBSCAN-SWA_118

1458482 : 1459700

Aeromonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025606803.1\|1458482_1459700_+	DUF3596 domain-containing protein	A0A1I9KF78	Aeromonas_phage	1.4e-06	20.8

DBSCAN-SWA_119

1465824 : 1467171

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025509986.1\|1465824_1467171_+	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.8e-07	23.1

DBSCAN-SWA_120

1475746 : 1476625

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025509976.1\|1475746_1476625_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.8e-20	43.5

DBSCAN-SWA_121

1494199 : 1505050

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545742.1\|1494199_1495705_+	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	1.7e-17	27.2
WP_005463702.1\|1495701_1496685_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_025442662.1\|1496770_1497649_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	1.5e-05	24.2
WP_017447445.1\|1497877_1498795_+	ribokinase	NA	NA	NA	NA
WP_069545741.1\|1498829_1499837_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	4.7e-32	28.9
WP_005499106.1\|1500066_1500285_+	hypothetical protein	NA	NA	NA	NA
WP_069545740.1\|1500445_1501177_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	8.2e-26	34.9
WP_042772479.1\|1501188_1501920_+	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	9.4e-06	32.1
WP_024702030.1\|1502642_1502939_-	hypothetical protein	NA	NA	NA	NA
WP_069545739.1\|1503097_1504291_-	hypothetical protein	NA	NA	NA	NA
WP_029854696.1\|1504381_1505050_+	response regulator transcription factor	W8CYM9	Bacillus_phage	5.7e-26	33.9

DBSCAN-SWA_122

1511768 : 1513682

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111678.1\|1511768_1513682_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.5e-23	36.8

DBSCAN-SWA_123

1525629 : 1526466

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772485.1\|1525629_1526466_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-30	37.6

DBSCAN-SWA_124

1535629 : 1537774

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083110615.1\|1535629_1537774_-	serine/threonine protein kinase	A0A2I2L4T9	Orpheovirus	3.0e-12	31.9

DBSCAN-SWA_125

1556213 : 1563736

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111681.1\|1556213_1558781_+	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	1.4e-88	30.6
WP_005375967.1\|1558986_1559466_+	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_069545724.1\|1559523_1561359_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.5e-28	24.6
WP_005499010.1\|1561372_1561663_+	type VI secretion protein	NA	NA	NA	NA
WP_069545723.1\|1561663_1562506_+	transhydrogenase beta subunit	NA	NA	NA	NA
WP_025503595.1\|1562602_1563736_+	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	3.7e-09	26.7

DBSCAN-SWA_126

1567656 : 1569316

Leuconostoc_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025533387.1\|1567656_1568181_+	adenylate kinase	A0A097BYE2	Leuconostoc_phage	6.7e-14	38.1
WP_025540494.1\|1568211_1568739_+	histidine phosphatase family protein	NA	NA	NA	NA
WP_005463837.1\|1568794_1569316_+	hypothetical protein	A0A1W6JNX6	Morganella_phage	3.5e-39	48.8

DBSCAN-SWA_127

1575753 : 1578200

Lactobacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074531328.1\|1575753_1576323_-	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	2.7e-08	30.7
WP_025533838.1\|1576538_1578200_+	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	1.4e-33	29.4

DBSCAN-SWA_128

1586042 : 1587674

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313283.1\|1586042_1587674_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.2e-26	33.3

DBSCAN-SWA_129

1622329 : 1622764

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005486290.1\|1622329_1622764_-	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	4.0e-12	40.7

DBSCAN-SWA_130

1627457 : 1628720

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_069545360.1\|1627457_1628720_-	hydroxymethylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	3.6e-05	38.6

DBSCAN-SWA_131

1644092 : 1652393

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111685.1\|1644092_1647401_+	AcrB/AcrD/AcrF family protein	S5VTK5	Leptospira_phage	4.1e-40	21.5
WP_025506375.1\|1647397_1648453_+	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_158111686.1\|1648541_1649423_-	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_015313257.1\|1649717_1651838_+	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.5e-269	65.1
WP_005394529.1\|1651922_1652393_+	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	2.1e-51	62.9

DBSCAN-SWA_132

1661261 : 1666316

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111689.1\|1661261_1662368_+	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	9.2e-21	32.5
WP_005461031.1\|1662431_1662869_-	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_005460932.1\|1663038_1664010_+	diguanylate cyclase	W8CYM9	Bacillus_phage	1.9e-09	32.2
WP_005498888.1\|1664006_1664996_+	Solitary outer membrane autotransporter beta-barrel domain	NA	NA	NA	NA
WP_114868212.1\|1665071_1666316_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.6e-13	29.0

DBSCAN-SWA_133

1672236 : 1672899

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005479407.1\|1672236_1672899_+	response regulator transcription factor	W8CYM9	Bacillus_phage	3.3e-26	33.6

DBSCAN-SWA_134

1688053 : 1691083

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005498859.1\|1688053_1689070_-	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	8.0e-80	45.9
WP_083110631.1\|1689124_1691083_-	diguanylate cyclase	G3MA91	Bacillus_virus	1.2e-26	39.5

DBSCAN-SWA_135

1698027 : 1698720

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042772869.1\|1698027_1698720_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-21	31.2

DBSCAN-SWA_136

1705308 : 1706148

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447567.1\|1705308_1706148_-	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	8.5e-11	38.8

DBSCAN-SWA_137

1717713 : 1718733

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020842108.1\|1717713_1718733_-	TerC family protein	A0A291LBC5	Escherichia_phage	6.2e-40	40.6

DBSCAN-SWA_138

1729960 : 1733897

Diachasmimorpha_longicaudata_entomopoxvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111691.1\|1729960_1731226_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	8.5e-55	34.7
WP_043045392.1\|1731292_1731889_-	DUF479 domain-containing protein	NA	NA	NA	NA
WP_005498789.1\|1731973_1732078_-	hypothetical protein	NA	NA	NA	NA
WP_025787629.1\|1732466_1733897_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	67.3

DBSCAN-SWA_139

1737903 : 1738377

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454218.1\|1737903_1738377_+	hypothetical protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	40.4

DBSCAN-SWA_140

1742156 : 1746644

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005498778.1\|1742156_1743371_+	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	1.4e-09	26.1
WP_158111693.1\|1743479_1746644_-	chitinase	A0A2K9L3D4	Tupanvirus	3.5e-25	25.5

DBSCAN-SWA_141

1758592 : 1759327

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025502341.1\|1758592_1759327_+	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.7e-28	36.3

DBSCAN-SWA_142

1770886 : 1773946

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447598.1\|1770886_1773946_-	multidrug efflux RND transporter permease subunit VmeV	S5VTK5	Leptospira_phage	9.6e-52	21.9

DBSCAN-SWA_143

1779417 : 1784138

Aeromonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478453.1\|1779417_1780713_+	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.0e-103	52.3
WP_005454126.1\|1780764_1781145_+	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_021448481.1\|1781273_1784138_+	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	2.5e-272	52.3

DBSCAN-SWA_144

1798687 : 1801987

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079722364.1\|1798687_1799332_+	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	2.4e-21	38.0
WP_025606889.1\|1799581_1800109_+	carboxypeptidase regulatory-like domain-containing protein	NA	NA	NA	NA
WP_025579147.1\|1800226_1801987_+	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.4e-63	31.8

DBSCAN-SWA_145

1806932 : 1807439

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_006742287.1\|1806932_1807439_-	peptide deformylase	E3SLL2	Synechococcus_phage	5.3e-16	41.8

DBSCAN-SWA_146

1810705 : 1811242

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025535244.1\|1810705_1811242_-	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	7.1e-11	39.5

DBSCAN-SWA_147

1817212 : 1819063

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158111702.1\|1817212_1819063_+	acyltransferase family protein	B5WZU0	Pseudomonas_phage	1.3e-67	31.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046760

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046759

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection