CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046783	Vibrio parahaemolyticus strain 2013V-1181 chromosome 1, complete sequence	0 crisprs	cas3,cas5f,cas7f,cas6f,csx1,DinG,DEDDh,csa3	0	0	5	0
NZ_CP046784	Vibrio parahaemolyticus strain 2013V-1181 chromosome 2, complete sequence	2 crisprs	csa3,cas3,cas5f,cas7f,cas6f,DEDDh,WYL	0	0	148	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

121318 : 128020

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005483011.1\|121318_122458_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.3e-62	41.7
WP_017448803.1\|122475_123726_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.1e-98	47.9
WP_005482986.1\|123853_124303_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_021449698.1\|124310_125435_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.4e-48	36.0
WP_005483039.1\|125447_126101_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_021449697.1\|126270_127380_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.5e-63	39.6
WP_005440184.1\|127549_128020_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_2

875319 : 889330

Vibrio_phage(30.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031776436.1\|875319_875508_-	hypothetical protein	F6LQB8	Bdellovibrio_phage	2.3e-09	54.7
WP_021453095.1\|875826_876354_-	siphovirus Gp157 family protein	NA	NA	NA	NA
WP_031776437.1\|876346_879511_-	hypothetical protein	I3PUZ3	Vibrio_phage	8.7e-24	33.6
WP_127463331.1\|879523_879703_-	hypothetical protein	NA	NA	NA	NA
WP_049874960.1\|880493_881210_-	helix-turn-helix domain-containing protein	G9L676	Escherichia_phage	1.4e-22	37.2
WP_031776438.1\|881261_881513_+	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	2.9e-07	41.9
WP_005495415.1\|881532_881997_+	hypothetical protein	K7PJS5	Enterobacterial_phage	3.0e-18	48.0
WP_005495414.1\|881993_882212_+	hypothetical protein	NA	NA	NA	NA
WP_021486513.1\|882277_883231_+	helix-turn-helix domain-containing protein	A0A1V0E831	Vibrio_phage	3.8e-39	35.3
WP_005495410.1\|883227_883608_+	hypothetical protein	NA	NA	NA	NA
WP_025501179.1\|883600_884251_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	4.1e-21	36.5
WP_005495404.1\|884419_884821_+	NinG recombination protein/bacteriophage lambda NinG family protein	A0A2I7S3K0	Vibrio_phage	3.7e-20	45.0
WP_005495402.1\|884857_885265_+	APSE-2 prophage; Q protein	NA	NA	NA	NA
WP_005483162.1\|885487_885691_-	hypothetical protein	NA	NA	NA	NA
WP_005483265.1\|886597_886810_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.9e-16	61.2
WP_005495398.1\|887104_889330_+	ribonuclease R	Q0GXV6	Lactococcus_phage	8.2e-61	31.7

DBSCAN-SWA_3

1492786 : 1515681

Vibrio_phage(82.35%)

portal,capsid,terminase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083146447.1\|1492786_1493293_-	hypothetical protein	M4MCN4	Vibrio_phage	9.4e-13	41.4
WP_021454682.1\|1493312_1493990_-	hypothetical protein	M4M9K5	Vibrio_phage	1.8e-27	37.8
WP_127891400.1\|1493982_1494336_-	hypothetical protein	NA	NA	NA	NA
WP_083146445.1\|1494461_1496879_-	hypothetical protein	M4M9M2	Vibrio_phage	1.6e-30	36.0
WP_083146444.1\|1496879_1498490_-	hypothetical protein	M4MHD1	Vibrio_phage	4.9e-132	45.8
WP_020840883.1\|1498489_1498714_-	hypothetical protein	NA	NA	NA	NA
WP_062906964.1\|1498835_1499696_-	DUF4376 domain-containing protein	A0A2I7RB39	Vibrio_phage	3.5e-28	43.7
WP_083146442.1\|1499692_1504117_-	hypothetical protein	M4M9Z4	Vibrio_phage	4.2e-149	35.7
WP_021454698.1\|1504136_1504808_-	hypothetical protein	A0A1B1ITG1	uncultured_Mediterranean_phage	5.7e-34	35.9
WP_020840887.1\|1504816_1505395_-	hypothetical protein	A0A1B1ITE9	uncultured_Mediterranean_phage	4.2e-09	28.9
WP_020840888.1\|1505394_1505859_-	hypothetical protein	M4MB04	Vibrio_phage	3.0e-18	36.8
WP_025622915.1\|1505972_1506419_-	hypothetical protein	NA	NA	NA	NA
WP_025507229.1\|1506478_1507702_-\|capsid	N4-gp56 family major capsid protein	M4M9G4	Vibrio_phage	1.0e-169	74.6
WP_127891399.1\|1507716_1508829_-	hypothetical protein	M4M9I4	Vibrio_phage	2.2e-46	40.1
WP_020840892.1\|1509036_1509522_-	hypothetical protein	M4MH86	Vibrio_phage	1.3e-35	46.0
WP_021485000.1\|1509548_1509866_-	phage family protein	G4WAN4	Salmonella_phage	2.2e-12	39.0
WP_020840894.1\|1509870_1510383_-	hypothetical protein	NA	NA	NA	NA
WP_083146441.1\|1510402_1512508_-\|portal	portal protein	M4MB09	Vibrio_phage	1.2e-260	70.0
WP_029784034.1\|1512519_1514250_-\|terminase	terminase	M4MCI5	Vibrio_phage	2.9e-186	55.7
WP_021822543.1\|1514302_1515220_-	hypothetical protein	M4M9G7	Vibrio_phage	2.5e-08	21.1
WP_042771382.1\|1515258_1515681_-	hypothetical protein	M4M9H1	Vibrio_phage	2.8e-39	58.4

DBSCAN-SWA_4

1523497 : 1536441

Vibrio_phage(50.0%)

integrase

attL 1525687:1525701|attR 1536055:1536069

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020840924.1\|1523497_1524307_-	hypothetical protein	A0A2R2ZGJ9	Clostridioides_phage	2.7e-22	38.0
WP_020840925.1\|1524350_1524542_-	hypothetical protein	NA	NA	NA	NA
WP_021454738.1\|1524544_1524694_-	hypothetical protein	NA	NA	NA	NA
WP_020840927.1\|1524701_1525007_-	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	7.3e-13	45.1
WP_021453894.1\|1525003_1525405_-	hypothetical protein	NA	NA	NA	NA
WP_021454725.1\|1525467_1525833_-	hypothetical protein	NA	NA	NA	NA
1525687:1525701	attL	NA	NA	NA	NA
WP_158115554.1\|1525829_1526315_-	hypothetical protein	A0A2I7RBP2	Vibrio_phage	1.6e-17	36.8
WP_033908282.1\|1526259_1527219_-	hypothetical protein	A0A1C9LVZ5	Vibrio_phage	3.3e-11	34.7
WP_020840932.1\|1527293_1527608_-	hypothetical protein	NA	NA	NA	NA
WP_089184194.1\|1527896_1528535_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_033908287.1\|1528879_1529287_+	hypothetical protein	R9TMP0	Vibrio_phage	1.8e-22	46.9
WP_083146436.1\|1529300_1530125_+	DUF2303 family protein	R9TRN9	Vibrio_phage	1.8e-58	42.2
WP_029809449.1\|1530190_1531315_+	hypothetical protein	NA	NA	NA	NA
WP_050550019.1\|1531311_1531938_+	hypothetical protein	A0A2I7RS54	Vibrio_phage	3.1e-58	60.0
WP_025630572.1\|1531922_1532132_+	hypothetical protein	NA	NA	NA	NA
WP_021822123.1\|1532556_1532769_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	5.6e-20	69.1
WP_033908285.1\|1533163_1534324_-\|integrase	site-specific integrase	B6ET93	Enterobacteria_phage	8.1e-44	30.3
WP_021448885.1\|1534815_1536441_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.9e-21	26.7
1536055:1536069	attR	NA	NA	NA	NA

DBSCAN-SWA_5

2234386 : 2251781

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455546.1\|2234386_2236969_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9
WP_021450023.1\|2237111_2237579_-	recombination regulator RecX	NA	NA	NA	NA
WP_021450024.1\|2237702_2238746_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_021450025.1\|2238945_2239428_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	2.9e-27	48.7
WP_005478546.1\|2239512_2242074_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-33	23.7
WP_021450027.1\|2243223_2244147_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005455562.1\|2244161_2244788_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_021450028.1\|2244787_2245564_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	6.6e-66	52.4
WP_021450029.1\|2245563_2246607_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|2246653_2247130_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_017449147.1\|2247147_2247852_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	1.0e-04	22.9
WP_005455577.1\|2247853_2248135_-	cell division protein FtsB	NA	NA	NA	NA
WP_005455579.1\|2248760_2250062_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_005455581.1\|2250140_2251781_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046784

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046784_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046784_1

568099-568226

Orphan

Consensus_repeat	Method
CCTTCTGGGGCATTACCTTGTGCCAAAGTCGGCTC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046784_1

>merge|NZ_CP046784|1|568099-568226|CRISPRCasFinder
CCTTCTGGGGCATTACCTTGTGCCAAAGTCGGCTCATCCGTAGACCCACTCACACTTGGTTTCTGCTCTGGCGTTGCCACACCGGAATCAATACCTTCTGGGGCATTACCTTGTGTCAAAGTCGGCTC

>NZ_CP046784|1|1|568099-568226|CRISPRCasFinder
CCTTCTGGGGCATTACCTTGTGCCAAAGTCGGCTC	ATCCGTAGACCCACTCACACTTGGTTTCTGCTCTGGCGTTGCCACACCGGAATCAATA
CCTTCTGGGGCATTACCTTGTGTCAAAGTCGGCTC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046784.1\|WP_021484590.1\|571902_572187_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499593.1\|575628_576753_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499540.1\|560199_561048_-\|OmpA-family-protein	unknown	unknown	gnl\|CDD\|143586
NZ_CP046784.1\|WP_005499543.1\|562083_563970_-\|type-III-secretion-protein	unknown	unknown	gnl\|CDD\|376386
NZ_CP046784.1\|WP_005499594.1\|576774_577263_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|276809
NZ_CP046784.1\|WP_005484480.1\|557951_558167_-\|FliM/FliN-family-flagellar-motor-switch-protein	unknown	unknown	gnl\|CDD\|376445
NZ_CP046784.1\|WP_072829044.1\|556588_556684_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499538.1\|559817_560210_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499579.1\|572188_572755_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_021448321.1\|573130_573697_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005484494.1\|577295_577754_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499534.1\|558169_558820_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499541.1\|561031_562072_-\|EscU/YscU/HrcU-family-type-III-secretion-system-export-apparatus-switch-protein	unknown	unknown	gnl\|CDD\|376521
NZ_CP046784.1\|WP_005499586.1\|573747_574479_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_023650119.1\|577755_578295_-\|secretory-of-YscJ/FliF-family-protein	unknown	unknown	gnl\|CDD\|274190
NZ_CP046784.1\|WP_021450638.1\|557174_557708_-\|transcriptional-regulator	unknown	unknown	gnl\|CDD\|226233
NZ_CP046784.1\|WP_005499536.1\|558832_559831_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005499582.1\|572763_573168_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_025548353.1\|574492_575539_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|227900
NZ_CP046784.1\|WP_021448323.1\|563966_564467_-\|hypothetical-protein	unknown	unknown	unknown

Protein	Function_ID	Function_description	E-value
NZ_CP046784.1\|WP_005499541.1\|561031_562072_-\|EscU/YscU/HrcU-family-type-III-secretion-system-export-apparatus-switch-protein	gnl\|CDD\|376521	pfam01312, Bac_export_2, FlhB HrpN YscU SpaS Family. This family includes the following members: FlhB, HrpN, YscU, SpaS, HrcU SsaU and YopU. All of these proteins export peptides using the type III secretion system. The peptides exported are quite diverse.	2.20016e-70
NZ_CP046784.1\|WP_005499540.1\|560199_561048_-\|OmpA-family-protein	gnl\|CDD\|143586	cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA. OmpA-like domains (named after the C-terminal domain of Escherichia coli OmpA protein) have been shown to non-covalently associate with peptidoglycan, a network of glycan chains composed of disaccharides, which are crosslinked via short peptide bridges. Well-studied members of this family include the Escherichia coli outer membrane protein OmpA, the Escherichia coli lipoprotein PAL, Neisseria meningitdis RmpM, which interact with the outer membrane, as well as the Escherichia coli motor protein MotB, and the Vibrio flagellar motor proteins PomB and MotY, which interact with the inner membrane.	5.85479e-16
NZ_CP046784.1\|WP_021450638.1\|557174_557708_-\|transcriptional-regulator	gnl\|CDD\|226233	COG3710, CadC, DNA-binding winged-HTH domains [Transcription].	1.01245e-19
NZ_CP046784.1\|WP_005499543.1\|562083_563970_-\|type-III-secretion-protein	gnl\|CDD\|376386	pfam00771, FHIPEP, FHIPEP family.	9.2628e-116
NZ_CP046784.1\|WP_005499594.1\|576774_577263_-\|hypothetical-protein	gnl\|CDD\|276809	sd00006, TPR, Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.	0.0020258
NZ_CP046784.1\|WP_005484480.1\|557951_558167_-\|FliM/FliN-family-flagellar-motor-switch-protein	gnl\|CDD\|376445	pfam01052, FliMN_C, Type III flagellar switch regulator (C-ring) FliN C-term. This family includes the C-terminal region of flagellar motor switch proteins FliN and FliM. It is associated with family FliM, pfam02154 and family FliN_N pfam16973.	1.18231e-10
NZ_CP046784.1\|WP_025548353.1\|574492_575539_-\|hypothetical-protein	gnl\|CDD\|227900	COG5613, COG5613, Uncharacterized conserved protein [Function unknown].	0.000637117
NZ_CP046784.1\|WP_023650119.1\|577755_578295_-\|secretory-of-YscJ/FliF-family-protein	gnl\|CDD\|274190	TIGR02544, YOP_proteins_translocation_lipoprotein, type III secretion apparatus lipoprotein, YscJ/HrcJ family. All members of this protein family are predicted lipoproteins with a conserved Cys near the N-terminus for cleavage and modification, and are part of known or predicted type III secretion systems. Members are found in both plant and animal pathogens, including the obligately intracellular chlamydial species and (non-pathogenic) root nodule bacteria. The most closely related proteins outside this family are examples of the flagellar M-ring protein FliF. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis].	1.36828e-07

>NZ_CP046784.1|WP_021448323.1|563966_564467_-|hypothetical-protein
MYQESRALLMAMEDKVTEYQRLLENQILELIEEKERELNESISKEYKKIADEWVDQQMDWFFSAEQILSEKLIGIERMVSEIKNELKTQIALAVSSRLTKLSQSENLINHLIDVLHAELEDEAKTLKIQRQEMADGVALTIENSDSVVSINTQKIVEELRGVLESI
>NZ_CP046784.1|WP_005499543.1|562083_563970_-|type-III-secretion-protein
MISKLRNSTLLFNPSSVMIAFLLPTIILVTLPGVVIDFFLLISFVSSALLLIIMLENDQPLKVTFLPTMVLLLTTFRLLLSIATTRNIIANEDVGRVIETIGEFVMGGNLISGLLIFVIITIVQFLVVTKGGERVAEVGARFSLDALPGKQMTIDGDLKSGLISGEQAQKLRADLGTENKLFGSLDGAMKFVKGDAIAGILISLVNLFGGIYVGINQFDLSLSESVKRFSVLTIGDGLVSQIPSLLLSMACGVYLTRIKGSEDESSSFMSQMMAQIRTFWKSLLVVGVVIMLIGLLNPTLMYVCLPLAVLCVVMALLLWKKNGNNSVAVKFEPEGSGVFESLKFVFRDGQYQSLIKKRLKAVEERVWGQALGEPAVLVDPDLDVDIAVYISGIQTYQFSQNSAEGIVEILNDDTFNLHDDLSSNLDEIISYFIQTRLIEKYNLQHSCNIVAELASQSEIMKSEIDSAVGLNRVHDVLKQMIRSPEFYLDRVSFFESLIYWSRVEHDPRNWLTRIRHQARYEITARLLNSDGKVHVMLLSPELTEEISGYVAGEFEDFERLIEIQKALKSEIKRLLLSHKNRPVLVVNDNELNVVKTFVQQVMSTLIVCSHSDIVDNNCISSSEVINIQ
>NZ_CP046784.1|WP_005499541.1|561031_562072_-|EscU/YscU/HrcU-family-type-III-secretion-system-export-apparatus-switch-protein
MESTEPKKYPPTEKKLRDLKKKGQFPKTELAEPTLELFVFCIIIVITLHSLFEYTNEWISSAIQSDINVGIDNMFSILGYTIGFLAFFKIVMAVFEWVMINKSVISTEALGFKIDKINPVNGAKNIFGVEAISRSSRKVLELLFLLFLLKYVFDVLGAELYKLNEINNYPYFIYYLLYSIGAVSLFYLVYGVCVGSIDYLAEKYHFHQKNRMTFTEMKNELKETEGSPEIKYERRRRMREVMESPVTKGRKPTFAVANPTHILVPISYEPKIEKIPVVLKISTESLALSERKRLEEQGIPIIENIPLARSLYRNMKSGEDFLPKEFYRDVAVIISTLNRQKNVKKK
>NZ_CP046784.1|WP_005499540.1|560199_561048_-|OmpA-family-protein
MLRKNKFVFIGFASLLTACSGPIREDNLILDIDWEPDIYNMVVTHVSDPNNFRFIVHQAPRYIENSPHEQACLEIDQPLEPNRYYLANLNTYGLTEVWTCEGEYWLYSNLVDPHKSLGTGLNVWDPRNYRSNGKHSSGNGDRNSTNGQGYPLFGNSGIDGLDAYLIGEGNLRLVFENLFPVNEYELTQASKETLLQLIQKLKNLPVKELVIYGIADSSGSYAKNRVLADRRALAVRDFLVEEGLRNVSIAIRGTVENGLETAEQRVKQRRFSIDVRLKSNGK
>NZ_CP046784.1|WP_005499538.1|559817_560210_-|hypothetical-protein
MANRKFQLLMSEFAQLTNGKSINLNADQSLACHYSGMDCYVEDGARIGLHGQILVIVPIVKKLAARQQVRLNSSFDLTRDGYVAEVKSYGCCFVRHLVAPEHPQVLLKFLSETVSVVNKLKSEITKNVAS
>NZ_CP046784.1|WP_005499536.1|558832_559831_-|hypothetical-protein
MWLAEFVEGPLKGVAFPFEPTLVFSGNEQSDNDKTVPIPEYLQSDESFELTLENGSPVLKQTSKTLSLVQNRVFQYKGVSLFVYRKGERNPNLRRYYFKRYRSVLLVTLLAHVSVAIVGYGINNFHQGEEFGDRISAIGSGYISEGVLYVTGKEDVKNLPSSWKNFIKPLASDKYEQVSQFNVAVVSEYSGKPLDMKIVRKDGYDEIRVDTKEDDNHFMALLGRHGISFYRDENDNWYVSDPTKVSELLKGAGLSHMLASVKSRADNAIIIPDDQFPYSIFYSSHSGRYLFDESKRYWEGSEVPKLGVIKSIAQDKVVFFDGEHTRVYLIDV
>NZ_CP046784.1|WP_005499534.1|558169_558820_-|hypothetical-protein
MMNSSISGFSVPSDVPLTQRNEVVAEQLTQQSPIIQRAASSVPYSDVRASVKDPLDLIDELLSRYLDQQTVRAKTMADTIETWSNAIAEINRIWGLVMQDNMNHTNPNDNNTRTPLGDSVSGKHLEDIDRIIREELKDDRGIAAITGLDLAASKTHRVSYTDLQSLNATMTAYCDTIQVDIDTEQQKFKNVMTEITSAQEEIRDVRRVIVTLSQGG
>NZ_CP046784.1|WP_005484480.1|557951_558167_-|FliM/FliN-family-flagellar-motor-switch-protein
MKIAIDVVIAHCSMTLEELLHLQKGNMIKIDDFVQSEVMLKSGNELIATGTLIKIDDQYGVSIDNVNQVKS
>NZ_CP046784.1|WP_021450638.1|557174_557708_-|transcriptional-regulator
MLRNYLLGNQVIFDTLKREVISPEQIISLGGRESAILKLLCENANVVISKEDIQDKVWGKVLVSETSLTKAISNLRKSLQMLEGVMCEIKTIPKEGYMLILEDENLGLMVTEDAPPLEVKRIESKDVAMIKQPISHSKPMVQREPANMVDPKWYIIGVFSAALLSSMISTTLVTLIK
>NZ_CP046784.1|WP_072829044.1|556588_556684_-|hypothetical-protein
MLRNSEFTTNRSQNSEQNSSVIPAIDQAIRH
>NZ_CP046784.1|WP_021484590.1|571902_572187_-|hypothetical-protein
MEYIEKFLLQLEKNEEYVFESCLDDFIIPICPFFQLVHVINLNETLQKLKTIEESCFGLLVRDGGYVSLAISEQNFRQEEVRRNILQLLEIMRF
>NZ_CP046784.1|WP_005499579.1|572188_572755_-|hypothetical-protein
MVDKLCVIEQKNITKAVFNKVAPIVGKVFDNDEIKLDFGELIFHLPKSESLIAMNLVNFGIEAKVYLCEQEALRLLGVEVKYLDEKYISYLITQNLSRIGLHFDKLVSWDEVENVSLIHSMLSFGEQKIDAIVDIESLKAEQAYMAMKENNISRHLNVKTELSLFETYLDSSEISSLTNDDVVLVYPK
>NZ_CP046784.1|WP_005499582.1|572763_573168_-|hypothetical-protein
MQKKIAHLKIKNKPLDPYEILKNKSNRISWNGLSDSEKFVDKENLMDWFVLLRDYSEDTVKAVVIDGLLENQFHKVTFILQLAMTPDFQSLGSKQVYELLYDFVSRTPKSVLAWIDEKDYQMSRDVLALLSRNR
>NZ_CP046784.1|WP_021448321.1|573130_573697_-|hypothetical-protein
MRPVSFVTPLRAERISEVSSSRSIREEEKPKRVRDVKDSERQEKKRHRVFRIKKAPMTPQQQRQFAKQLNSYQLRAMRDWYSFSESLDIESLNDAQKWVLHAVNQSQHLYPKTLRREIRAYLNGVSLDQFASLEEAPDGATIQQLLAYEDYLEGILAMLVLCRRYDEREKKRKLRQNAEENCSSENKE
>NZ_CP046784.1|WP_005499586.1|573747_574479_-|hypothetical-protein
MKPISINAAASANVSAQEATNHNAPVSVDVQQWQQFDSSLEKASQGGVSMSELLALLSQIISSAKELRSQVMQSRIDEAKATTDLAIVLADDRRSDAQMKFGISLASSVMNMALTTASSVRIGQTKTLKDKHLSSMSGNGDMKVSDLSMKDLNKFTAQLQQARTAKYNTVSQSGNMANSMVGNANDIINAEEVKHQEEGTASKQLKEKVDAHLDQFIQELTTEAVKLNEILDLMARASLVTNR
>NZ_CP046784.1|WP_025548353.1|574492_575539_-|hypothetical-protein
MRSSLVSNLEPVALWSQANEEIEKAQNKPQEFAESGAVVPGQPLPGSSVSLNDLWRVIKDSMKDVAEAVSGTGQENVATKKGLIQIQKDSQIEMLNERASQLEEQKKAEQKQGIWGKIAMALSFVAAIIMAPFNPVMAAVMIGGLIASLVIPKIADEIMKAAGVDEKTRGFVKLGLDLAIGIGSAILSFNPANIASSAGKAIAGGAAKVGAFVSKTMNAAKALKSFSSISSKAGSIVNKMKKTIEPLLNKIQDFAKGGQMATSRISQASSVASNITSTVSMGYGVKSADVAKDLEIAQAKQDELQTRIDQVLMMLEQALRSVSHAFESLFKTNEDQREFTKAMSSIHM
>NZ_CP046784.1|WP_005499593.1|575628_576753_-|hypothetical-protein
MKVNSSISSSGAAPLTGTESQTGNQGVVESVTNLEQALSLLESDSLNVADLKTLSDTVNNQRSALNLMSSRNAEADIANSLNGAIDQYAKELELIQGWTNGGKDMFNAANQVMFNTIISSGNVSGIYLEDIFQIAIIDFMANHSNIDPTVFEAMRHFLESTGTGSHGVHEAWGGSMFSQKTDLVWDYMKNNASANSLSQEILNYLDTTAGGKQALQSQYSTQFDSSEGYAFNTGFDKNNGLSPMLRLTLMSNYLKDNPDIKQAEMEIFLKGSFGEIESFVQTTTKESLEDLLAKDSAWRVVSNGAGKNIIDYIGVGLDSTFFVNLYQKFPPRVLSDEDTTNINRIGDTVKMIQQTLKYWIQIMRDERMAVARNI
>NZ_CP046784.1|WP_005499594.1|576774_577263_-|hypothetical-protein
MAETLNISSDLEEDFFELLEGRLYSERLKEIRKKENISVETLMAIYALGEEFYNRFLMKEAEVIFTAYMALCPHDHRGPGSLASIYLEQGKFNKALEMLNIVKVYPTADFDETILNIALCHYKLKEHNNAAVMLILVKRDNLNEYYSKRYDYLKRQLNPYLQ
>NZ_CP046784.1|WP_005484494.1|577295_577754_-|hypothetical-protein
MKKYNRVYQRVLHYYLSKAQLAEEEFLVLTTLTEEEIESFFLDRIKTVRKVIYLLGQIVEYQKSKMDIDYLSWVGMQALIPRELCLISDSIGLHTQIDVTDKNSLGLGLLSSIDRRKAIVWGLRLKHSAPEQKLTVDSGARLRYLINRISQS
>NZ_CP046784.1|WP_023650119.1|577755_578295_-|secretory-of-YscJ/FliF-family-protein
MIRRIWFYLVISLMLAGCGTQGQSKIATFESADLANKVVVMLNKHQIPSTLSVQKEWYSVSVDESNEMKARELLTTFNFYFEKEDLNDLLESKFASLSKLEQVKSNFLQSREISNKLSVMPNIFRVSVVVTGSQKKRISVLILSLSELDSENKANIEQFLKGTLESEDKLTVSYFVQAS

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Crispr_ID: NZ_CP046784_2

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046784_2

1090655-1090752

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP046784_2

>merge|NZ_CP046784|2|1090655-1090752|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCACAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP046784|2|2|1090655-1090752|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATCCAGAAAAACAAGATCACAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046784.1\|WP_031776341.1\|1091631_1092156_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP046784.1\|WP_005482833.1\|1082142_1082604_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP046784.1\|WP_005464972.1\|1086278_1087148_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP046784.1\|WP_005497702.1\|1089813_1090611_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP046784.1\|WP_005460779.1\|1092524_1093160_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP046784.1\|WP_005464959.1\|1081051_1082143_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP046784.1\|WP_005482867.1\|1087861_1089730_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP046784.1\|WP_006740949.1\|1085391_1086198_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP046784.1\|WP_031776342.1\|1095997_1097737_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP046784.1\|WP_021450388.1\|1093237_1094149_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP046784.1\|WP_005482845.1\|1097866_1098544_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP046784.1\|WP_005467181.1\|1092163_1092484_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP046784.1\|WP_021450393.1\|1079727_1080531_+\|Cof-type-HAD-IIB-family-hydrolase	unknown	unknown	gnl\|CDD\|369792
NZ_CP046784.1\|WP_021450390.1\|1083048_1083888_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP046784.1\|WP_005482916.1\|1090851_1091613_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP046784.1\|WP_005482884.1\|1094247_1095177_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP046784.1\|WP_005460834.1\|1095188_1095812_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP046784.1\|WP_021450386.1\|1098559_1100788_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046784.1\|WP_005487087.1\|1087148_1087859_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP046784.1\|WP_005464962.1\|1083949_1085098_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260

Protein	Function_ID	Function_description	E-value
NZ_CP046784.1\|WP_031776341.1\|1091631_1092156_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	2.12554e-49
NZ_CP046784.1\|WP_005482833.1\|1082142_1082604_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP046784.1\|WP_005464972.1\|1086278_1087148_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP046784.1\|WP_005497702.1\|1089813_1090611_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP046784.1\|WP_005460779.1\|1092524_1093160_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.15977e-144
NZ_CP046784.1\|WP_005464959.1\|1081051_1082143_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.06677e-44
NZ_CP046784.1\|WP_005482867.1\|1087861_1089730_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.84814e-139
NZ_CP046784.1\|WP_006740949.1\|1085391_1086198_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.88138e-97
NZ_CP046784.1\|WP_031776342.1\|1095997_1097737_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	1.14935e-110
NZ_CP046784.1\|WP_021450388.1\|1093237_1094149_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	3.22521e-18
NZ_CP046784.1\|WP_005482845.1\|1097866_1098544_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP046784.1\|WP_005467181.1\|1092163_1092484_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP046784.1\|WP_021450393.1\|1079727_1080531_+\|Cof-type-HAD-IIB-family-hydrolase	gnl\|CDD\|369792	pfam08282, Hydrolase_3, haloacid dehalogenase-like hydrolase. This family contains haloacid dehalogenase-like hydrolase enzymes.	2.14169e-72
NZ_CP046784.1\|WP_021450390.1\|1083048_1083888_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	2.44738e-143
NZ_CP046784.1\|WP_005482916.1\|1090851_1091613_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0
NZ_CP046784.1\|WP_005482884.1\|1094247_1095177_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP046784.1\|WP_005460834.1\|1095188_1095812_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP046784.1\|WP_005487087.1\|1087148_1087859_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	1.10229e-38
NZ_CP046784.1\|WP_005464962.1\|1083949_1085098_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0

>NZ_CP046784.1|WP_005497702.1|1089813_1090611_-|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP046784.1|WP_005482867.1|1087861_1089730_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP046784.1|WP_005487087.1|1087148_1087859_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVIDDWPMVLKDYLQRPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQVEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP046784.1|WP_005464972.1|1086278_1087148_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP046784.1|WP_006740949.1|1085391_1086198_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSQGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP046784.1|WP_005464962.1|1083949_1085098_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP046784.1|WP_021450390.1|1083048_1083888_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIESNFPVTDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELFKKEKSPLPILVDQGDADGFLSEQLKPEALLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP046784.1|WP_005482833.1|1082142_1082604_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP046784.1|WP_005464959.1|1081051_1082143_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYTFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP046784.1|WP_021450393.1|1079727_1080531_+|Cof-type-HAD-IIB-family-hydrolase
MSQVSIKFIASDMDGTLLDQYGRLDPEFFDLFLQLEEQGILFSAASGRQYYSLRDTFAPIKDRVLYVAENGTLVMYQDKELYSCTIPKAEVAEIVQAAREIDGANIVLCGKRSAYIETHDQQSLEEFQKYYHRCETVADLLEVEDEFIKVAICHFDGSEELLFPTMNAKFGATHKVVVSAKIWLDVMNAEASKGAAIKHLQETMNFTPAETMTFGDYLNDLEMLQVSEHSYAVANAHEEIKKIARYSAPSNQEAGVLKVIKEKVLAK
>NZ_CP046784.1|WP_005482916.1|1090851_1091613_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTAALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP046784.1|WP_031776341.1|1091631_1092156_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVINLLTIYRLHRQQSESMINQSSY
>NZ_CP046784.1|WP_005467181.1|1092163_1092484_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP046784.1|WP_005460779.1|1092524_1093160_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANAAILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP046784.1|WP_021450388.1|1093237_1094149_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHLVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFEITHPEMVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSLVFWQALRQHEIATEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLAEKARR
>NZ_CP046784.1|WP_005482884.1|1094247_1095177_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP046784.1|WP_005460834.1|1095188_1095812_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP046784.1|WP_031776342.1|1095997_1097737_-|transporter
MTLLDSMIVMIYLLFIGIAAWLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVIVTLIAVSGGAWTVSVTNVIQLVLLIAITLVIGYTALQHFDSPSEVFAYTTPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATNRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVNLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSSPLTPRESKDLSVVATLAVHLLVTGGFFLFTRVFYAKESPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP046784.1|WP_005482845.1|1097866_1098544_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP046784.1|WP_021450386.1|1098559_1100788_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQVTVNGDAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNDKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDLATAVELLPAGGTIILKDGDYQGMEIPLTASGSADKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYSGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALVENGTTYTSDGKAVDSKMLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 2023

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005498778.1\|808_2023_-	glucose-1-phosphate adenylyltransferase	A0A1D7XFC1	Escherichia_phage	1.4e-09	26.1

DBSCAN-SWA_2

5801 : 6275

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454218.1\|5801_6275_-	hypothetical protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	40.4

DBSCAN-SWA_3

10281 : 14218

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031776556.1\|10281_11712_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	67.3
WP_005498789.1\|12100_12205_+	hypothetical protein	NA	NA	NA	NA
WP_021448502.1\|12289_12886_+	DUF479 domain-containing protein	NA	NA	NA	NA
WP_011106367.1\|12952_14218_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.6e-53	33.9

DBSCAN-SWA_4

25459 : 26479

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448507.1\|25459_26479_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	4.0e-39	40.2

DBSCAN-SWA_5

38043 : 38883

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448513.1\|38043_38883_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	2.5e-10	37.9

DBSCAN-SWA_6

45447 : 46140

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448516.1\|45447_46140_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	5.7e-21	30.7

DBSCAN-SWA_7

53084 : 56114

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448521.1\|53084_55043_+	diguanylate cyclase	G3MA91	Bacillus_virus	8.9e-27	40.1
WP_021448522.1\|55097_56114_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	8.0e-80	45.9

DBSCAN-SWA_8

68080 : 68551

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448530.1\|68080_68551_-	phage protein	A0A2I7RXE2	Vibrio_phage	9.6e-20	44.6

DBSCAN-SWA_9

75222 : 78775

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025527353.1\|75222_77079_-	hypothetical protein	A0A2I7RNF8	Vibrio_phage	9.1e-114	43.2
WP_021450893.1\|77075_77426_-	zinc ribbon domain-containing protein	NA	NA	NA	NA
WP_021450892.1\|77439_77754_-	hypothetical protein	NA	NA	NA	NA
WP_021450891.1\|77756_78017_-	hypothetical protein	NA	NA	NA	NA
WP_021450890.1\|78013_78205_-	hypothetical protein	NA	NA	NA	NA
WP_021450889.1\|78349_78613_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_079765146.1\|78631_78775_-	hypothetical protein	Q9MCC3	Vibrio_phage	1.9e-11	76.7

DBSCAN-SWA_10

84421 : 85084

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450885.1\|84421_85084_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.9e-26	34.1

DBSCAN-SWA_11

91004 : 96071

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_011106381.1\|91004_92249_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.6e-13	29.0
WP_005498888.1\|92324_93314_-	Solitary outer membrane autotransporter beta-barrel domain	NA	NA	NA	NA
WP_005460932.1\|93310_94282_-	diguanylate cyclase	W8CYM9	Bacillus_phage	1.9e-09	32.2
WP_021450882.1\|94451_94889_+	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_021450881.1\|94964_96071_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	1.4e-21	33.5

DBSCAN-SWA_12

104943 : 113244

Vibrio_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005394529.1\|104943_105414_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	2.1e-51	62.9
WP_021450874.1\|105498_107619_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	2.5e-269	65.0
WP_079751459.1\|107913_108795_+	endonuclease/exonuclease/phosphatase family protein	NA	NA	NA	NA
WP_021450872.1\|108883_109939_-	efflux RND transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_021450871.1\|109935_113244_-	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.0e-38	21.3

DBSCAN-SWA_13

128599 : 129862

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480279.1\|128599_129862_+	hydroxymethylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	3.6e-05	38.6

DBSCAN-SWA_14

134554 : 134989

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005486290.1\|134554_134989_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	4.0e-12	40.7

DBSCAN-SWA_15

169630 : 171262

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020837920.1\|169630_171262_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.7e-26	33.3

DBSCAN-SWA_16

179087 : 181534

Aphanizomenon_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480265.1\|179087_180749_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	3.2e-33	29.1
WP_079765168.1\|180964_181534_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	9.2e-09	31.4

DBSCAN-SWA_17

187969 : 189629

Morganella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450835.1\|187969_188491_-	lipocalin-like domain protein	A0A1W6JNX6	Morganella_phage	2.7e-39	46.2
WP_021450834.1\|188546_189074_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_021450833.1\|189104_189629_-	AAA family ATPase	A0A097BYE2	Leuconostoc_phage	3.9e-14	39.2

DBSCAN-SWA_18

193549 : 201072

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005488655.1\|193549_194683_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	1.3e-09	27.2
WP_021450829.1\|194779_195622_-	hypothetical protein	NA	NA	NA	NA
WP_005499010.1\|195622_195913_-	type VI secretion protein	NA	NA	NA	NA
WP_021450828.1\|195926_197762_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	9.8e-28	24.6
WP_005375967.1\|197819_198299_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_021450827.1\|198504_201072_-	type VI secretion system ATPase TssH	A0A0A8J958	Klebsiella_phage	3.1e-88	30.5

DBSCAN-SWA_19

219511 : 221656

Orpheovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765151.1\|219511_221656_+	serine/threonine protein kinase	A0A2I2L4T9	Orpheovirus	3.0e-12	31.9

DBSCAN-SWA_20

230818 : 231655

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450807.1\|230818_231655_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.7e-30	37.6

DBSCAN-SWA_21

243605 : 245519

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499080.1\|243605_245519_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.0e-24	37.4

DBSCAN-SWA_22

252237 : 252906

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463721.1\|252237_252906_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.2e-26	34.4

DBSCAN-SWA_23

266658 : 272901

Lactobacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450788.1\|266658_267492_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	9.1e-05	28.4
WP_021450785.1\|268250_268919_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_021450784.1\|268915_269605_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_005483358.1\|269606_270350_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_021450783.1\|270438_271167_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	5.3e-25	34.8
WP_021450781.1\|271515_272901_-	FAD-binding oxidoreductase	S4VXI2	Pandoravirus	1.7e-35	26.9

DBSCAN-SWA_24

281402 : 283138

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450775.1\|281402_282161_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-06	27.0
WP_015313074.1\|282235_283138_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	1.6e-23	28.3

DBSCAN-SWA_25

290976 : 305224

Pike_perch_iridovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450768.1\|290976_292581_+	carboxyl transferase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	66.7
WP_021450767.1\|292618_293464_+	enoyl-CoA hydratase	NA	NA	NA	NA
WP_021450766.1\|293460_294363_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	2.0e-45	37.4
WP_021450765.1\|294398_294950_-	hypothetical protein	NA	NA	NA	NA
WP_021450764.1\|294982_295861_-	DMT family transporter	NA	NA	NA	NA
WP_021450763.1\|296146_297460_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.3e-18	39.9
WP_005483382.1\|297739_298933_-	acetate kinase	NA	NA	NA	NA
WP_005483343.1\|298965_299091_+	hypothetical protein	NA	NA	NA	NA
WP_017448090.1\|299230_300832_+	bifunctional diguanylate cyclase/phosphodiesterase	G3MA91	Bacillus_virus	3.5e-13	32.0
WP_005483383.1\|300906_302838_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	1.4e-53	30.6
WP_021450762.1\|303217_305224_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	1.9e-32	24.7

DBSCAN-SWA_26

314726 : 317984

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_074530807.1\|314726_316283_-	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.0e-33	44.6
WP_021450758.1\|316529_317984_+	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	8.1e-09	24.4

DBSCAN-SWA_27

324789 : 326082

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450753.1\|324789_326082_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	9.3e-49	30.8

DBSCAN-SWA_28

331387 : 339463

Chrysochromulina_ericina_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450750.1\|331387_332638_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	9.3e-46	30.9
WP_005375557.1\|332907_333123_-	hypothetical protein	NA	NA	NA	NA
WP_079751470.1\|333296_333605_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_074544639.1\|333646_334015_-	HopJ type III effector protein	NA	NA	NA	NA
WP_100550153.1\|334159_334255_-	hypothetical protein	NA	NA	NA	NA
WP_079765170.1\|334232_335972_+	alkaline phosphatase	E3SII1	Synechococcus_phage	1.2e-06	34.4
WP_005482617.1\|336148_336487_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_021450746.1\|336476_337271_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_005487810.1\|337492_339463_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.9e-17	25.8

DBSCAN-SWA_29

349939 : 354704

Clostridium_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005461991.1\|349939_350419_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	1.8e-18	34.8
WP_079765159.1\|350635_352678_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-14	28.1
WP_021450735.1\|352780_353998_-	hypothetical protein	NA	NA	NA	NA
WP_021450734.1\|353990_354704_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.3e-39	45.7

DBSCAN-SWA_30

358061 : 362222

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031781524.1\|358061_359504_-	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.7e-14	31.4
WP_011106292.1\|359656_359875_-	hypothetical protein	NA	NA	NA	NA
WP_021450729.1\|359979_361323_+	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	2.3e-13	52.6
WP_021450728.1\|361351_361645_-	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_005375625.1\|362012_362222_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1

DBSCAN-SWA_31

371039 : 375862

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450720.1\|371039_372677_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.4e-11	36.4
WP_079765161.1\|372673_373837_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_021450718.1\|374167_375862_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.8e-92	36.8

DBSCAN-SWA_32

384072 : 384687

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005461975.1\|384072_384687_+	glutaredoxin	A0A0K1YA09	Cronobacter_phage	1.7e-08	42.3

DBSCAN-SWA_33

388035 : 391192

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005461969.1\|388035_389856_+	phosphodiesterase	A0A127AWB9	Bacillus_phage	4.7e-06	28.2
WP_011106286.1\|389908_391192_-	peptidoglycan DD-metalloendopeptidase family protein	V5R8R0	Arthrobacter_phage	2.3e-15	48.9

DBSCAN-SWA_34

395611 : 397483

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450712.1\|395611_397483_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	9.1e-13	39.6

DBSCAN-SWA_35

415120 : 418924

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312995.1\|415120_416752_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-35	53.8
WP_005462020.1\|417045_417993_+	HlyD family efflux transporter periplasmic adaptor subunit	NA	NA	NA	NA
WP_021450699.1\|417997_418924_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.9e-22	33.6

DBSCAN-SWA_36

435588 : 437810

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005459715.1\|435588_436440_+	carbenicillin-hydrolyzing class A beta-lactamase CARB-18	A0A077SL40	Escherichia_phage	8.3e-54	44.4
WP_021450690.1\|436742_437810_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	2.0e-17	30.7

DBSCAN-SWA_37

446975 : 450913

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450686.1\|446975_449135_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	1.4e-68	34.7
WP_021450685.1\|449341_450913_-	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	1.3e-28	29.6

DBSCAN-SWA_38

464291 : 464762

Lake_Baikal_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005457571.1\|464291_464762_+	DNA starvation/stationary phase protection protein	A0A2H4N7L5	Lake_Baikal_phage	1.7e-21	37.4

DBSCAN-SWA_39

470032 : 471937

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033903624.1\|470032_471937_-	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.3e-42	31.0

DBSCAN-SWA_40

482981 : 483896

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450673.1\|482981_483896_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	2.1e-23	25.4

DBSCAN-SWA_41

491162 : 491945

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450666.1\|491162_491945_+	heme ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	6.9e-15	30.1

DBSCAN-SWA_42

497926 : 498757

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450663.1\|497926_498757_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	6.4e-59	48.2

DBSCAN-SWA_43

510457 : 511378

Vibrio_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448349.1\|510457_511378_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	2.3e-158	88.5

DBSCAN-SWA_44

519665 : 520586

Vibrio_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450655.1\|519665_520586_+\|transposase	IS5-like element ISVpa3 family transposase	A0A1V0E8E1	Vibrio_phage	1.8e-163	91.5

DBSCAN-SWA_45

530778 : 536407

Organic_Lake_phycodnavirus(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499477.1\|530778_531471_+	ABC transporter ATP-binding protein	F2Y1V6	Organic_Lake_phycodnavirus	9.8e-05	24.3
WP_005499478.1\|531467_532094_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.8e-05	27.3
WP_005499480.1\|532240_533089_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_005499483.1\|533525_534095_+	TDH-related hemolysin TRH1	NA	NA	NA	NA
WP_021450650.1\|534419_535280_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	3.9e-144	83.3
WP_100198882.1\|535504_536407_-	OspB protein	A0A0P0ZCT1	Stx2-converting_phage	1.2e-29	35.3

DBSCAN-SWA_46

552389 : 553856

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025626359.1\|552389_553856_-	secretin	R9TEZ5	Vibrio_phage	7.6e-15	26.0

DBSCAN-SWA_47

590039 : 590930

Vibrio_phage(100.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450097.1\|590039_590930_+\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	6.4e-150	85.6

DBSCAN-SWA_48

600885 : 606162

Vibrio_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499650.1\|600885_601929_+	type I-F CRISPR-associated protein Csy3	A0A2I7RCY7	Vibrio_phage	1.2e-19	26.5
WP_005499652.1\|601932_602529_+	type I-F CRISPR-associated endoribonuclease Cas6/Csy4	NA	NA	NA	NA
WP_005499654.1\|602951_603158_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021448308.1\|603268_603802_+	hypothetical protein	NA	NA	NA	NA
WP_021450104.1\|603801_605175_+	DEAD/DEAH box helicase	I4AZM6	Saccharomonospora_phage	9.6e-36	29.0
WP_021448307.1\|605184_606162_-\|transposase	IS481 family transposase	S5WIU1	Leptospira_phage	4.6e-08	28.6

DBSCAN-SWA_49

615642 : 616761

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463102.1\|615642_616761_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	5.3e-24	32.4

DBSCAN-SWA_50

632449 : 634879

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450117.1\|632449_633889_+	catalase	A0A2K9L0T1	Tupanvirus	2.8e-102	47.5
WP_005463052.1\|634000_634879_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	5.6e-29	32.4

DBSCAN-SWA_51

650101 : 656991

Bacillus_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450125.1\|650101_650800_-	response regulator transcription factor	W8CYM9	Bacillus_phage	8.6e-25	31.7
WP_079765138.1\|650796_651843_-	DUF4118 domain-containing protein	W8CYF6	Bacillus_phage	1.7e-16	27.0
WP_005499711.1\|652090_653917_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	2.8e-30	26.6
WP_021450614.1\|654062_656153_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_005478119.1\|656205_656991_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-13	27.7

DBSCAN-SWA_52

678820 : 685396

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765136.1\|678820_680551_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-19	24.5
WP_021450607.1\|680600_681191_-	calcium-binding protein	NA	NA	NA	NA
WP_031776427.1\|681398_682055_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021450605.1\|682283_682955_-	LuxR family transcriptional regulator	NA	NA	NA	NA
WP_005462979.1\|683222_683423_-	chromosome segregation ATPase	NA	NA	NA	NA
WP_005478023.1\|683479_685396_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	63.4

DBSCAN-SWA_53

692618 : 700601

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765192.1\|692618_694751_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-11	33.0
WP_021450600.1\|695076_695826_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.3e-14	28.6
WP_005478161.1\|695886_696750_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_005462956.1\|696772_697705_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_005462954.1\|697804_698626_-	phosphate ABC transporter substrate-binding protein	M1U9L0	Synechococcus_phage	2.1e-06	27.6
WP_021450598.1\|698957_700601_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-11	61.2

DBSCAN-SWA_54

707185 : 714881

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450593.1\|707185_709186_-	S9 family peptidase	F2Y2S5	Organic_Lake_phycodnavirus	2.0e-10	30.3
WP_029946731.1\|709531_710878_-	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	7.4e-41	29.9
WP_005462467.1\|711429_711684_+	hypothetical protein	NA	NA	NA	NA
WP_005462944.1\|711710_712637_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_021450590.1\|712643_714059_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	1.1e-58	30.7
WP_021450589.1\|714068_714881_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	4.7e-22	32.0

DBSCAN-SWA_55

720099 : 726071

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478159.1\|720099_721683_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.5e-16	39.5
WP_005478107.1\|721928_722309_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005478401.1\|722308_723439_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|723776_724325_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_021450587.1\|724331_726071_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.2e-19	34.6

DBSCAN-SWA_56

729226 : 729997

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450583.1\|729226_729997_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	7.3e-09	28.1

DBSCAN-SWA_57

733200 : 734829

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447262.1\|733200_734829_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.4e-20	38.8

DBSCAN-SWA_58

738198 : 739830

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450580.1\|738198_739830_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-19	33.5

DBSCAN-SWA_59

754818 : 757209

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005478141.1\|754818_755850_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_005478319.1\|756015_757209_-	glycine C-acetyltransferase	D2TEZ5	Emiliania_huxleyi_virus	9.5e-40	28.8

DBSCAN-SWA_60

762690 : 765393

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005462859.1\|762690_763206_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	5.5e-45	59.6
WP_021450569.1\|763233_764607_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_079765190.1\|764631_765393_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.9e-27	30.5

DBSCAN-SWA_61

775165 : 776203

Neodiprion_lecontei_nucleopolyhedrovirus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450558.1\|775165_776203_+\|protease	serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	2.7e-14	28.7

DBSCAN-SWA_62

801875 : 802307

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072828669.1\|801875_802307_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	9.7e-27	49.2

DBSCAN-SWA_63

806725 : 813583

Providencia_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450548.1\|806725_809149_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	2.0e-07	49.1
WP_021450547.1\|809151_810081_-	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.9e-11	26.6
WP_021450546.1\|810295_810970_+	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	2.3e-27	31.8
WP_005484189.1\|811312_811825_+	DUF2799 and DUF1090 domain-containing protein	NA	NA	NA	NA
WP_021450545.1\|811835_812291_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_011106537.1\|812476_813583_-	hypothetical protein	A0A1S5SAB0	Streptococcus_phage	1.2e-68	42.1

DBSCAN-SWA_64

834558 : 835716

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499918.1\|834558_835716_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.2e-77	43.1

DBSCAN-SWA_65

839723 : 841187

Apis_mellifera_filamentous_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450529.1\|839723_841187_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	2.5e-13	31.2

DBSCAN-SWA_66

854322 : 854697

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005458336.1\|854322_854697_-	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.1e-25	53.5

DBSCAN-SWA_67

866648 : 869102

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450513.1\|866648_869102_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	1.8e-16	43.8

DBSCAN-SWA_68

875995 : 876292

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005480175.1\|875995_876292_+	PTS transporter subunit EIIB	A0A2I7SAJ6	Vibrio_phage	1.6e-09	54.1

DBSCAN-SWA_69

892276 : 893893

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450503.1\|892276_893893_-	endonuclease I family protein	A0A2P0VMP9	Tetraselmis_virus	8.7e-12	31.2

DBSCAN-SWA_70

902304 : 913096

Salmonella_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450498.1\|902304_903513_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.8e-25	24.4
WP_021450497.1\|903594_905322_-	hypothetical protein	NA	NA	NA	NA
WP_005455166.1\|905795_906749_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	7.9e-13	41.2
WP_017447171.1\|906652_907105_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_021450496.1\|907162_909910_-	peptidase M16	L7RBE7	Acanthamoeba_polyphaga_moumouvirus	1.8e-17	33.8
WP_021450495.1\|910326_912213_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.7e-22	44.8
WP_021450494.1\|912331_913096_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	3.7e-13	29.0

DBSCAN-SWA_71

926715 : 939555

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450484.1\|926715_927918_+	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	1.0e-12	23.7
WP_021450483.1\|927991_929236_-	carbohydrate ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_021822097.1\|929238_930669_-	HAMP domain-containing histidine kinase	W8CYF6	Bacillus_phage	1.2e-07	21.4
WP_021450481.1\|930658_931366_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.3e-33	37.5
WP_011106551.1\|931468_931558_-	hypothetical protein	NA	NA	NA	NA
WP_017447155.1\|931631_933074_+	PTS transporter subunit EIIC	A0A2I7SAJ6	Vibrio_phage	5.6e-10	42.4
WP_021450479.1\|933169_933616_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_021450478.1\|933843_935835_+	U32 family peptidase	Q6DW11	Phage_TP	1.4e-19	27.4
WP_021450477.1\|935864_937514_-	dolichyl-phosphate-mannose-mannosyltransferase	NA	NA	NA	NA
WP_021450476.1\|937510_938227_-	class I SAM-dependent methyltransferase	NA	NA	NA	NA
WP_025498781.1\|938243_938618_-	GtrA family protein	NA	NA	NA	NA
WP_021450474.1\|938604_939555_-	glycosyltransferase family 2 protein	A8CG95	Salmonella_phage	7.1e-46	33.8

DBSCAN-SWA_72

944691 : 946260

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450470.1\|944691_946260_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	5.6e-40	32.4

DBSCAN-SWA_73

949617 : 953310

Salmonella_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450468.1\|949617_950103_+	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	1.5e-07	27.9
WP_021450467.1\|950304_951000_+	hypothetical protein	NA	NA	NA	NA
WP_021450466.1\|951100_951259_-	hypothetical protein	NA	NA	NA	NA
WP_017447138.1\|951270_952356_+	chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.1e-13	47.2
WP_025500885.1\|952377_953310_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.7e-12	24.7

DBSCAN-SWA_74

957555 : 958794

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450459.1\|957555_958794_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	9.9e-48	31.6

DBSCAN-SWA_75

963183 : 968535

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450454.1\|963183_965034_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	1.6e-30	23.7
WP_021450452.1\|965630_966338_+	hypothetical protein	NA	NA	NA	NA
WP_005465952.1\|966418_966895_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005466428.1\|967217_967385_+	hypothetical protein	NA	NA	NA	NA
WP_011106558.1\|967392_967641_-	hypothetical protein	NA	NA	NA	NA
WP_025509611.1\|968001_968535_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	1.1e-06	31.0

DBSCAN-SWA_76

975939 : 978310

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031776230.1\|975939_976752_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.8e-05	35.4
WP_079765183.1\|976753_976873_-	hypothetical protein	NA	NA	NA	NA
WP_025501738.1\|977590_978310_+	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	1.2e-34	41.1

DBSCAN-SWA_77

981324 : 982548

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450444.1\|981324_982548_+	sigma-54-dependent Fis family transcriptional regulator	Q8QKV7	Ectocarpus_siliculosus_virus	2.1e-05	28.1

DBSCAN-SWA_78

986844 : 988959

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450443.1\|986844_988959_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	9.0e-33	26.5

DBSCAN-SWA_79

1013626 : 1021793

Burkholderia_virus(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015313728.1\|1013626_1014538_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.3e-09	24.4
WP_021450425.1\|1014626_1015286_+	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	1.9e-26	40.4
WP_021450424.1\|1015342_1017022_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_079765180.1\|1017447_1019499_-\|tRNA	tRNA(Met) cytidine acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	7.7e-13	30.4
WP_015313732.1\|1019593_1020568_-	ParB/RepB/Spo0J family partition protein	O64340	Escherichia_phage	5.1e-23	40.0
WP_005500197.1\|1020575_1021793_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	3.8e-36	29.2

DBSCAN-SWA_80

1025771 : 1032249

Planktothrix_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450420.1\|1025771_1026704_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.8e-14	33.2
WP_079752404.1\|1026700_1027594_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.7e-17	30.5
WP_021450418.1\|1027917_1028115_+	hypothetical protein	NA	NA	NA	NA
WP_005477438.1\|1028359_1029421_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	6.5e-40	44.5
WP_011106202.1\|1029389_1029485_+	hypothetical protein	NA	NA	NA	NA
WP_021450417.1\|1029526_1030282_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005490914.1\|1030350_1032249_+	response regulator	A0A1V0SGX0	Hokovirus	4.2e-58	34.7

DBSCAN-SWA_81

1035704 : 1036403

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450414.1\|1035704_1036403_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.7e-41	42.5

DBSCAN-SWA_82

1039798 : 1044714

Enterobacteria_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450410.1\|1039798_1040830_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.2e-22	33.3
WP_021450409.1\|1040831_1041623_+	response regulator transcription factor	A0A2R2ZGH8	Clostridioides_phage	4.6e-06	19.7
WP_021450408.1\|1041700_1042336_+	hypothetical protein	NA	NA	NA	NA
WP_005481711.1\|1042439_1042934_-	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.0e-11	31.4
WP_017447085.1\|1043052_1044714_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.8e-16	34.2

DBSCAN-SWA_83

1049705 : 1050563

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497657.1\|1049705_1050563_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	9.6e-18	29.6

DBSCAN-SWA_84

1060130 : 1060613

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464913.1\|1060130_1060613_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	8.9e-29	47.7

DBSCAN-SWA_85

1067669 : 1073327

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005468573.1\|1067669_1070216_-	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	3.8e-147	47.9
WP_020841634.1\|1070585_1071089_-	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_005464991.1\|1071413_1071698_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_005464981.1\|1071868_1072150_+	hypothetical protein	NA	NA	NA	NA
WP_005464995.1\|1072169_1073327_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-11	27.4

DBSCAN-SWA_86

1077751 : 1091613

Diadromus_pulchellus_ascovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450395.1\|1077751_1078618_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	7.9e-20	27.2
WP_021450394.1\|1078744_1079632_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021450393.1\|1079727_1080531_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_005464959.1\|1081051_1082143_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	6.5e-11	30.6
WP_005482833.1\|1082142_1082604_-	oxidoreductase	NA	NA	NA	NA
WP_021450390.1\|1083048_1083888_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_005464962.1\|1083949_1085098_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	4.0e-35	29.2
WP_006740949.1\|1085391_1086198_+	arylamine N-acetyltransferase	NA	NA	NA	NA
WP_005464972.1\|1086278_1087148_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005487087.1\|1087148_1087859_-	DNA polymerase III subunit epsilon	A0A1P8VVD4	Rathayibacter_phage	9.1e-06	25.9
WP_005482867.1\|1087861_1089730_-	CBS domain-containing protein	NA	NA	NA	NA
WP_005497702.1\|1089813_1090611_-	DNA-binding transcriptional regulator KdgR	NA	NA	NA	NA
WP_005482916.1\|1090851_1091613_+	2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD	A0A0N9R355	Chrysochromulina_ericina_virus	1.4e-12	25.5

DBSCAN-SWA_87

1106477 : 1107656

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450382.1\|1106477_1107656_+	chitin-binding domain protein	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	6.8e-30	36.9

DBSCAN-SWA_88

1119110 : 1126003

Infectious_spleen_and_kidney_necrosis_virus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450374.1\|1119110_1119623_-	macro domain-containing protein	A0A140G0J9	Infectious_spleen_and_kidney_necrosis_virus	3.0e-27	52.5
WP_021450373.1\|1119682_1120108_-	glyoxalase/Bleomycin resistance /Dioxygenase superfamily protein	NA	NA	NA	NA
WP_006740976.1\|1120262_1121105_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021450372.1\|1121256_1122564_-	DUF1254 domain-containing protein	M1H738	Paramecium_bursaria_Chlorella_virus	8.8e-31	27.2
WP_074534539.1\|1122678_1123620_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_021450371.1\|1123692_1124178_-	VOC family protein	NA	NA	NA	NA
WP_021450370.1\|1124316_1124634_-	DUF4144 domain-containing protein	NA	NA	NA	NA
WP_021450369.1\|1124730_1125441_-	HAD family hydrolase	NA	NA	NA	NA
WP_021450368.1\|1125466_1126003_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	2.6e-21	34.7

DBSCAN-SWA_89

1131677 : 1134367

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450364.1\|1131677_1132814_+	glycerate kinase	W6LM47	Streptococcus_phage	1.3e-41	37.4
WP_079765178.1\|1132909_1134367_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	1.5e-23	26.4

DBSCAN-SWA_90

1138119 : 1143211

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450358.1\|1138119_1138851_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-26	32.1
WP_031776348.1\|1138860_1139376_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_015312793.1\|1139646_1140741_+	cytochrome c-type protein TorY	NA	NA	NA	NA
WP_021450356.1\|1140763_1143211_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	2.3e-80	31.0

DBSCAN-SWA_91

1148124 : 1148883

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450350.1\|1148124_1148883_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.9e-26	38.6

DBSCAN-SWA_92

1161312 : 1167168

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312805.1\|1161312_1162308_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	1.6e-69	42.7
WP_079765110.1\|1162522_1163020_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_021450342.1\|1163050_1163761_-	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	1.7e-15	26.1
WP_021450341.1\|1164017_1164971_+	malate dehydrogenase	NA	NA	NA	NA
WP_005459337.1\|1165129_1165795_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.6e-26	34.8
WP_079765111.1\|1165791_1167168_+	sensor histidine kinase	W8CYF6	Bacillus_phage	3.6e-14	24.7

DBSCAN-SWA_93

1178512 : 1187479

Staphylococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450332.1\|1178512_1179247_+	metal ABC transporter ATP-binding protein	A0A2H4PQG7	Staphylococcus_phage	7.5e-11	23.4
WP_005479618.1\|1179246_1180122_+	metal ABC transporter permease	NA	NA	NA	NA
WP_021450331.1\|1180157_1181027_+	periplasmic solute-binding family protein	NA	NA	NA	NA
WP_021450330.1\|1181242_1182241_+	porin	Q1MVN1	Enterobacteria_phage	1.1e-09	23.6
WP_031776248.1\|1182449_1184615_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	1.7e-34	27.2
WP_005459347.1\|1184941_1186147_-	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_005393578.1\|1186558_1187479_-	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8

DBSCAN-SWA_94

1192364 : 1193255

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005484243.1\|1192364_1193255_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	1.4e-06	38.4

DBSCAN-SWA_95

1219276 : 1231220

Pacmanvirus(14.29%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312834.1\|1219276_1219882_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A1X6WG33	Pacmanvirus	2.7e-19	34.6
WP_005479983.1\|1220019_1221375_+	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	2.1e-14	34.8
WP_021450312.1\|1221466_1223464_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.9e-17	22.5
WP_005479975.1\|1223861_1225418_-	DUF3612 domain-containing protein	NA	NA	NA	NA
WP_079765114.1\|1225586_1226171_+	malate synthase	NA	NA	NA	NA
WP_021450310.1\|1226296_1227310_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.1e-16	35.9
WP_021450309.1\|1227630_1228968_+	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	6.1e-27	37.4
WP_021450308.1\|1228968_1230513_+	cryptochrome/photolyase family protein	E3T4R9	Cafeteria_roenbergensis_virus	4.5e-50	32.2
WP_005480002.1\|1230512_1231220_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	5.6e-32	37.3

DBSCAN-SWA_96

1240620 : 1241307

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374113.1\|1240620_1241307_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	2.1e-15	31.2

DBSCAN-SWA_97

1248191 : 1251333

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450302.1\|1248191_1249367_+	efflux RND transporter periplasmic adaptor subunit	A0A140XAI1	Dickeya_phage	1.3e-17	44.7
WP_031781483.1\|1249368_1251333_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	2.0e-39	40.3

DBSCAN-SWA_98

1254577 : 1256611

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464000.1\|1254577_1256611_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	6.4e-28	30.9

DBSCAN-SWA_99

1265796 : 1266915

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450293.1\|1265796_1266915_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.4e-31	37.3

DBSCAN-SWA_100

1276012 : 1276990

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_015312861.1\|1276012_1276990_+	OmpA family protein	G3M9Z0	Bacillus_virus	8.7e-07	26.0

DBSCAN-SWA_101

1286139 : 1287905

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450283.1\|1286139_1286658_+	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	4.6e-31	46.2
WP_005481481.1\|1287158_1287905_-	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	1.8e-12	36.8

DBSCAN-SWA_102

1307119 : 1315103

Hokovirus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450274.1\|1307119_1308799_+	LruC domain-containing protein	A0A1V0SGG5	Hokovirus	3.7e-13	25.8
WP_020834911.1\|1308809_1309274_+	hypothetical protein	NA	NA	NA	NA
WP_005481539.1\|1309428_1309779_-	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	2.0e-06	30.8
WP_005373989.1\|1310038_1310329_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_005463958.1\|1310362_1311961_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	9.7e-181	66.2
WP_005464025.1\|1312066_1312276_+	hypothetical protein	NA	NA	NA	NA
WP_021450273.1\|1312430_1313402_+	leukocidin/Hemolysin toxin family protein	NA	NA	NA	NA
WP_021450272.1\|1313491_1314103_-	LysE family translocator	NA	NA	NA	NA
WP_021450271.1\|1314212_1315103_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	3.7e-12	24.2

DBSCAN-SWA_103

1340068 : 1340656

Streptococcus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025630760.1\|1340068_1340656_-	hypothetical protein	A0A191KBR1	Streptococcus_virus	2.2e-05	28.1

DBSCAN-SWA_104

1344436 : 1345747

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450251.1\|1344436_1345747_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	1.6e-40	30.9

DBSCAN-SWA_105

1349193 : 1350078

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005464181.1\|1349193_1350078_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.6e-13	35.8

DBSCAN-SWA_106

1356920 : 1358945

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021450247.1\|1356920_1358945_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	4.1e-35	23.3

DBSCAN-SWA_107

1370454 : 1373613

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449360.1\|1370454_1373613_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	3.3e-47	20.6

DBSCAN-SWA_108

1379161 : 1380181

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449365.1\|1379161_1380181_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.6e-35	38.6

DBSCAN-SWA_109

1384808 : 1386428

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447951.1\|1384808_1386428_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	7.4e-11	23.8

DBSCAN-SWA_110

1390691 : 1391708

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449374.1\|1390691_1391708_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	2.5e-17	29.2

DBSCAN-SWA_111

1400908 : 1410519

Yersinia_phage(33.33%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449379.1\|1400908_1402168_-\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	2.2e-87	43.9
WP_021449380.1\|1402249_1403056_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005464130.1\|1403280_1404060_-	hypothetical protein	NA	NA	NA	NA
WP_011106262.1\|1404016_1404127_+	hypothetical protein	NA	NA	NA	NA
WP_005464140.1\|1404279_1406667_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	5.5e-172	38.0
WP_005464081.1\|1406865_1407702_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_021449382.1\|1407783_1408848_-	L-asparaginase 2	NA	NA	NA	NA
WP_005464135.1\|1409262_1410519_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	4.5e-48	31.7

DBSCAN-SWA_112

1414474 : 1416852

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449386.1\|1414474_1415236_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.9e-10	27.4
WP_021449387.1\|1415276_1415789_+	hypothetical protein	NA	NA	NA	NA
WP_021449388.1\|1415793_1416852_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	9.7e-12	25.8

DBSCAN-SWA_113

1423889 : 1425443

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449392.1\|1423889_1425443_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	2.2e-52	35.7

DBSCAN-SWA_114

1448016 : 1454374

Stx2-converting_phage(25.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449409.1\|1448016_1449186_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	4.4e-82	45.6
WP_011106461.1\|1449274_1449547_+	hypothetical protein	NA	NA	NA	NA
WP_005499396.1\|1449473_1449878_+	cell division protein DamX	NA	NA	NA	NA
WP_021449410.1\|1450113_1451406_+\|protease	serine protease	V5LS29	Emiliania_huxleyi_virus	2.6e-11	22.7
WP_005477269.1\|1451450_1451924_-	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	43.1
WP_021449411.1\|1452018_1453032_-	adenosine deaminase	NA	NA	NA	NA
WP_108702468.1\|1453249_1453360_-	hypothetical protein	NA	NA	NA	NA
WP_005463370.1\|1453519_1453660_-	hypothetical protein	NA	NA	NA	NA
WP_069526577.1\|1453710_1453920_-	hypothetical protein	NA	NA	NA	NA
WP_005463371.1\|1454161_1454374_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	6.2e-19	62.9

DBSCAN-SWA_115

1465471 : 1468368

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449419.1\|1465471_1466758_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	2.4e-20	25.9
WP_005463399.1\|1466758_1467472_-	response regulator	W8CYM9	Bacillus_phage	2.7e-34	35.0
WP_021449420.1\|1467648_1468368_-	SDR family oxidoreductase	W8CYX9	Bacillus_phage	8.4e-07	30.8

DBSCAN-SWA_116

1471703 : 1476851

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449424.1\|1471703_1472360_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	2.2e-38	38.9
WP_017447347.1\|1472718_1473336_-	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase	A0A2I7SAF7	Vibrio_phage	7.6e-17	32.7
WP_021449425.1\|1473453_1475307_-	MFS transporter	NA	NA	NA	NA
WP_011106452.1\|1475305_1475413_+	hypothetical protein	NA	NA	NA	NA
WP_021449426.1\|1475453_1476212_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_021449427.1\|1476212_1476851_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.7e-11	34.9

DBSCAN-SWA_117

1482390 : 1483713

Micromonas_sp._RCC1109_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449430.1\|1482390_1483713_-	AarF/ABC1/UbiB kinase family protein	E5EQ95	Micromonas_sp._RCC1109_virus	5.4e-20	27.0

DBSCAN-SWA_118

1492311 : 1494960

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765132.1\|1492311_1494960_+	response regulator	A0A1V0SGX0	Hokovirus	4.3e-48	27.3

DBSCAN-SWA_119

1499209 : 1503555

Invertebrate_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449441.1\|1499209_1499530_+	hypothetical protein	W8W2G4	Invertebrate_iridovirus	1.8e-09	44.4
WP_005463467.1\|1499881_1500979_+	autoinducer 2-binding periplasmic protein LuxP	NA	NA	NA	NA
WP_005477121.1\|1500978_1503555_+	response regulator	A0A1V0SGX0	Hokovirus	6.4e-49	33.3

DBSCAN-SWA_120

1508713 : 1509337

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449444.1\|1508713_1509337_+	class I SAM-dependent methyltransferase	A0A1B1IT46	uncultured_Mediterranean_phage	2.9e-08	27.1

DBSCAN-SWA_121

1513718 : 1517066

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463489.1\|1513718_1514621_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.7
WP_021449447.1\|1514682_1514949_-	hypothetical protein	NA	NA	NA	NA
WP_031853410.1\|1514965_1515586_-	LysE family translocator	NA	NA	NA	NA
WP_005477336.1\|1516325_1517066_+	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	1.0e-07	27.7

DBSCAN-SWA_122

1530919 : 1532916

Xanthomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005485131.1\|1530919_1531384_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.6e-25	42.4
WP_005485167.1\|1531788_1532916_+	multidrug efflux RND transporter periplasmic adaptor subunit VmeY	S5VL44	Leptospira_phage	3.7e-09	25.9

DBSCAN-SWA_123

1536188 : 1553318

uncultured_Caudovirales_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449455.1\|1536188_1537958_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.9e-29	29.7
WP_005463517.1\|1538059_1538473_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_021449456.1\|1538549_1539152_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_005463527.1\|1539284_1540274_-	OmpA family protein	NA	NA	NA	NA
WP_005463529.1\|1540735_1541788_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	1.5e-81	50.5
WP_079765134.1\|1541936_1543115_+	MFS transporter	NA	NA	NA	NA
WP_011106437.1\|1543168_1543264_-	hypothetical protein	NA	NA	NA	NA
WP_021449458.1\|1543333_1544902_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	4.5e-29	46.9
WP_021449459.1\|1545027_1547019_-	transketolase	NA	NA	NA	NA
WP_005463537.1\|1547142_1548093_-	transaldolase	A0A127KNC6	Cyanophage	2.5e-11	31.7
WP_021449460.1\|1548336_1548489_-	hypothetical protein	NA	NA	NA	NA
WP_005463541.1\|1548559_1549561_+	sugar-binding transcriptional regulator	NA	NA	NA	NA
WP_021449461.1\|1549692_1550985_+	glycoside hydrolase family 18 protein	A0A1B1V5N4	Malacosoma_sp._alphabaculovirus	1.4e-68	36.3
WP_021447946.1\|1551026_1553318_-	EAL domain-containing protein	A0A127AWB9	Bacillus_phage	1.1e-12	30.8

DBSCAN-SWA_124

1557407 : 1560344

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020841906.1\|1557407_1558157_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	9.3e-09	35.2
WP_021449465.1\|1558166_1559402_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005477356.1\|1559690_1560344_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	7.5e-55	54.3

DBSCAN-SWA_125

1565759 : 1567171

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449468.1\|1565759_1566167_-	hypothetical protein	A0A1C6ZDG7	Pseudomonas_phage	4.7e-07	42.9
WP_005487989.1\|1566262_1567171_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	4.3e-08	28.8

DBSCAN-SWA_126

1571035 : 1574168

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005463577.1\|1571035_1572082_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	7.9e-99	54.5
WP_021449470.1\|1572134_1574168_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	1.4e-22	24.9

DBSCAN-SWA_127

1577947 : 1578766

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_072828613.1\|1577947_1578766_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.3e-13	24.6

DBSCAN-SWA_128

1584048 : 1584870

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005499214.1\|1584048_1584870_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.3e-15	27.7

DBSCAN-SWA_129

1598882 : 1607028

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449486.1\|1598882_1601501_+	response regulator	A0A1V0SGX0	Hokovirus	5.3e-43	26.4
WP_079765034.1\|1601595_1602525_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	6.3e-47	39.5
WP_079765035.1\|1602478_1604578_-	acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha	NA	NA	NA	NA
WP_079765036.1\|1604531_1605335_-	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_021449490.1\|1605420_1607028_-	carboxyl transferase	A0A1B2ITV7	Pike_perch_iridovirus	7.3e-19	66.7

DBSCAN-SWA_130

1614907 : 1628977

Escherichia_phage(20.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449497.1\|1614907_1615804_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	2.0e-26	29.2
WP_005488040.1\|1615813_1616572_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_005477089.1\|1616686_1616809_-	hypothetical protein	NA	NA	NA	NA
WP_021449498.1\|1617027_1619076_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.8e-20	43.8
WP_005463648.1\|1619668_1620268_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_021449499.1\|1620286_1621747_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_021449500.1\|1621767_1623513_+\|holin	choline dehydrogenase	A0A1V0SI18	Klosneuvirus	3.0e-42	27.2
WP_021449501.1\|1623561_1624500_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005487988.1\|1624554_1625397_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_021449502.1\|1625399_1626584_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-24	33.2
WP_079765059.1\|1626698_1627433_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_021449504.1\|1627635_1628064_+	globin	NA	NA	NA	NA
WP_005463674.1\|1628191_1628977_-	slipin family protein	A0A2K9L3L2	Tupanvirus	3.7e-24	29.4

DBSCAN-SWA_131

1634868 : 1637226

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031781571.1\|1634868_1637226_+	response regulator	A0A1V0SGX0	Hokovirus	1.3e-59	38.0

DBSCAN-SWA_132

1649360 : 1661622

Enterobacteria_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449517.1\|1649360_1650866_+	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	1.7e-17	27.2
WP_005463702.1\|1650862_1651846_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_005463703.1\|1651931_1652810_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	1.9e-05	23.8
WP_017447445.1\|1653038_1653956_+	ribokinase	NA	NA	NA	NA
WP_021449518.1\|1653990_1655001_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.6e-32	28.8
WP_021449519.1\|1655153_1655372_+	hypothetical protein	NA	NA	NA	NA
WP_005499105.1\|1655532_1656264_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	6.3e-26	34.9
WP_021449521.1\|1656275_1657007_+	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	7.2e-06	32.1
WP_005455737.1\|1657210_1657891_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_005487329.1\|1658054_1658963_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_021449522.1\|1658985_1659921_+	ABC transporter permease	A0A2H4IY97	uncultured_Caudovirales_phage	9.0e-70	43.2
WP_005482136.1\|1659913_1660864_+	iron(III) ABC transporter permease	NA	NA	NA	NA
WP_021449523.1\|1660866_1661622_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.7e-13	26.2

DBSCAN-SWA_133

1665779 : 1666031

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454365.1\|1665779_1666031_-	membrane protein	A0A248SJ16	Salicola_phage	2.7e-05	38.9

DBSCAN-SWA_134

1688387 : 1695114

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021449531.1\|1688387_1690457_+	DNA helicase IV	A7KV33	Bacillus_phage	3.8e-20	25.6
WP_005454351.1\|1690535_1690991_-	methylglyoxal synthase	NA	NA	NA	NA
WP_015313111.1\|1691054_1692059_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_020835123.1\|1692147_1695114_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	2.4e-52	33.6

DBSCAN-SWA_135

1698481 : 1701885

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033908249.1\|1698481_1700029_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	7.0e-136	50.8
WP_015313115.1\|1700337_1701885_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.8e-166	58.1

DBSCAN-SWA_136

1705345 : 1709357

Tetraselmis_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454209.1\|1705345_1706872_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	3.1e-136	53.3
WP_031776293.1\|1706986_1708288_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_005396657.1\|1708373_1709357_+	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	8.7e-07	24.6

DBSCAN-SWA_137

1715059 : 1717473

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454234.1\|1715059_1715485_+	riboflavin-specific deaminase	A0A1V0SE20	Indivirus	4.4e-24	50.4
WP_011106326.1\|1715634_1716564_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005454287.1\|1716573_1717473_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	1.1e-11	23.8

DBSCAN-SWA_138

1728464 : 1736021

Lactococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765044.1\|1728464_1729067_-	LemA family protein	A0A1X9IGG1	Lactococcus_phage	2.3e-18	35.8
WP_005454288.1\|1729284_1730652_-	anaerobic C4-dicarboxylate transporter DcuC	NA	NA	NA	NA
WP_021450905.1\|1731005_1732130_-	fatty acid desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.1e-32	33.1
WP_005486527.1\|1732401_1732950_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_021450906.1\|1733035_1733653_-	HAD family phosphatase	NA	NA	NA	NA
WP_021450907.1\|1733972_1736021_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	6.1e-10	33.9

DBSCAN-SWA_139

1746928 : 1747837

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005454057.1\|1746928_1747837_+	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.4e-06	36.8

DBSCAN-SWA_140

1764702 : 1771487

Hokovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448435.1\|1764702_1768368_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	3.2e-30	35.8
WP_021448436.1\|1768351_1769518_+	EAL domain-containing protein	NA	NA	NA	NA
WP_005481323.1\|1769510_1770107_+	response regulator transcription factor	NA	NA	NA	NA
WP_005486479.1\|1770116_1771487_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.4e-09	29.1

DBSCAN-SWA_141

1775995 : 1776970

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005481272.1\|1775995_1776970_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	4.6e-133	75.4

DBSCAN-SWA_142

1799588 : 1801439

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448453.1\|1799588_1801439_-	acyltransferase	B5WZU0	Pseudomonas_phage	1.0e-64	31.8

DBSCAN-SWA_143

1807305 : 1810540

Ochrobactrum_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079765051.1\|1807305_1807917_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	4.0e-10	38.4
WP_079765052.1\|1808021_1809476_+	N-acylglucosamine 2-epimerase	NA	NA	NA	NA
WP_005395194.1\|1809576_1809828_+	DUF2999 family protein	NA	NA	NA	NA
WP_021448462.1\|1810033_1810540_+	peptide deformylase	E3SLL2	Synechococcus_phage	9.0e-16	41.8

DBSCAN-SWA_144

1815475 : 1818054

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448468.1\|1815475_1817236_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	3.1e-63	31.7
WP_074534249.1\|1817409_1818054_-	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	3.1e-21	38.0

DBSCAN-SWA_145

1823453 : 1825962

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448476.1\|1823453_1824851_+	His-Xaa-Ser system radical SAM maturase HxsB	S5VT21	Leptospira_phage	1.2e-54	30.1
WP_011106270.1\|1824816_1825962_+	His-Xaa-Ser system radical SAM maturase HxsC	S5WIP3	Leptospira_phage	1.3e-46	34.4

DBSCAN-SWA_146

1833416 : 1838137

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021448481.1\|1833416_1836281_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	2.5e-272	52.3
WP_005454126.1\|1836409_1836790_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005478453.1\|1836841_1838137_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.0e-103	52.3

DBSCAN-SWA_147

1843609 : 1846669

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017447598.1\|1843609_1846669_+	multidrug efflux RND transporter permease subunit VmeV	S5VTK5	Leptospira_phage	9.6e-52	21.9

DBSCAN-SWA_148

1858201 : 1858936

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020835258.1\|1858201_1858936_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-28	36.3

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046783

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046784

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection