CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP046806	Vibrio alginolyticus strain 2439-01 chromosome 1, complete sequence	1 crisprs	DEDDh,PrimPol,WYL,csa3,cas3,DinG,csx1	2	1	3
NZ_CP046805	Vibrio alginolyticus strain 2439-01 chromosome 2, complete sequence	0 crisprs	csa3,WYL,DEDDh,cas3	0	0	156
NZ_CP046807	Vibrio alginolyticus strain 2439-01 plasmid unnamed1, complete sequence	0 crisprs	RT,c2c9_V-U4	0	0	12

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046806_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046806_1

1729305-1729551

Orphan

Consensus_repeat	Method
TAATGCCTCCTTAGCTCAGTCGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP046806_1

>merge|NZ_CP046806|1|1729305-1729551|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTTTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAATTCCTCCTTAGCTCAGTCGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP046806|1|1|1729305-1729551|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAG	GTCACCAGTTCGATTCCGGTAGTCGGCACCATTTTTT
TGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGT	GTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAA
TTCCTCCTTAGCTCAGTCGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046806.1\|WP_042521298.1\|1721248_1721851_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP046806.1\|WP_158156872.1\|1726126_1727203_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP046806.1\|WP_005384506.1\|1725203_1725923_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP046806.1\|WP_005381002.1\|1727222_1727495_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP046806.1\|WP_065274864.1\|1724157_1725186_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP046806.1\|WP_005381007.1\|1723138_1724059_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NZ_CP046806.1\|WP_005381010.1\|1720698_1721130_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP046806.1\|WP_158156876.1\|1729860_1731486_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP046806.1\|WP_054579416.1\|1743112_1743868_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007
NZ_CP046806.1\|WP_020480920.1\|1747006_1747312_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP046806.1\|WP_064354314.1\|1732474_1733908_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP046806.1\|WP_158156870.1\|1721869_1723048_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP046806.1\|WP_005381048.1\|1743886_1745209_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP046806.1\|WP_031777269.1\|1745221_1745533_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|224364
NZ_CP046806.1\|WP_158156878.1\|1742009_1743008_-\|substrate-binding-domain-containing-protein	unknown	unknown	gnl\|CDD\|380494
NZ_CP046806.1\|WP_158156874.1\|1727572_1728712_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NZ_CP046806.1\|WP_158156880.1\|1747559_1748843_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200570
NZ_CP046806.1\|WP_005393980.1\|1720279_1720570_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NZ_CP046806.1\|WP_005385544.1\|1745584_1746928_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP046806.1\|WP_005381029.1\|1740625_1741879_-\|HD-GYP-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116

Protein	Function_ID	Function_description	E-value
NZ_CP046806.1\|WP_042521298.1\|1721248_1721851_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	7.07922e-123
NZ_CP046806.1\|WP_158156872.1\|1726126_1727203_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP046806.1\|WP_005384506.1\|1725203_1725923_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.04237e-109
NZ_CP046806.1\|WP_005381002.1\|1727222_1727495_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.80095e-59
NZ_CP046806.1\|WP_065274864.1\|1724157_1725186_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	2.25681e-08
NZ_CP046806.1\|WP_005381007.1\|1723138_1724059_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP046806.1\|WP_005381010.1\|1720698_1721130_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	4.01664e-66
NZ_CP046806.1\|WP_158156876.1\|1729860_1731486_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	5.23941e-62
NZ_CP046806.1\|WP_054579416.1\|1743112_1743868_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	1.04194e-124
NZ_CP046806.1\|WP_020480920.1\|1747006_1747312_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	8.28164e-46
NZ_CP046806.1\|WP_064354314.1\|1732474_1733908_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP046806.1\|WP_158156870.1\|1721869_1723048_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP046806.1\|WP_005381048.1\|1743886_1745209_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP046806.1\|WP_031777269.1\|1745221_1745533_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|224364	COG1447, CelC, Phosphotransferase system cellobiose-specific component IIA [Carbohydrate transport and metabolism].	6.82212e-37
NZ_CP046806.1\|WP_158156878.1\|1742009_1743008_-\|substrate-binding-domain-containing-protein	gnl\|CDD\|380494	cd06270, PBP1_GalS-like, ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type 1 periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar binding of ABC-type transport systems.	3.93699e-112
NZ_CP046806.1\|WP_158156874.1\|1727572_1728712_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	2.23307e-145
NZ_CP046806.1\|WP_158156880.1\|1747559_1748843_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200570	cd10946, CE4_Mll8295_like, Putative catalytic NodB homology domain of uncharacterized Mll8295 protein encoded from Rhizobium loti and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase Mll8295 encoded from Rhizobium loti. Although its biological function still remains unknown, Mll8295 shows high sequence homology to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both Mll8295 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	3.65259e-70
NZ_CP046806.1\|WP_005393980.1\|1720279_1720570_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	3.96324e-59
NZ_CP046806.1\|WP_005385544.1\|1745584_1746928_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	3.32614e-153
NZ_CP046806.1\|WP_005381029.1\|1740625_1741879_-\|HD-GYP-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	2.25733e-72

>NZ_CP046806.1|WP_158156874.1|1727572_1728712_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIAAALLMAGCSREFVEKIYDVNYEPTNRFANNLAELPGQFEKDTAALGALINSFSGNIQKRWGKKEIKYAGKSNYVKYIDNYLSRAEVDFRKGVITIETVSPTEPQKHLKDAIVTTLLTPDDPAHVDLFSSKGITLEGQPFLYKQVVDQDNKPIQWSWRANRFAEYLIANKIKTKNVDFKKAYYVEIPMVEDHFSTRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKKRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLREVRHPTSLEYSMISAYNGGTGGVLNTFHRSDRKRAMQDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSKQTL
>NZ_CP046806.1|WP_005381002.1|1727222_1727495_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIEGYTPPSE
>NZ_CP046806.1|WP_158156872.1|1726126_1727203_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVVDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGIGRSTAAAILSSVYKQPHAILDGNVKRTLSRCFAVAGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVMLHHNTENGHEVWLEQRPQTGIWGGLFCFPQTEHVDAESDIELLLDQRGIQASNIKQKQTLITFRHTFSHYHLDITPILFDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NZ_CP046806.1|WP_005384506.1|1725203_1725923_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDFKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLSTLQLFFPDPWHKKRHHKRRIVQLGFAEMVREKLIPNEGIFHMATDWENYAEHMIEVMNQAPGFENIAKDGDFVPRPDDRPLTKFEARGHRLGHGVWDIKYKRIA
>NZ_CP046806.1|WP_065274864.1|1724157_1725186_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASQGVDVTEIGSKDVGLPAALVFSCQEALTDEQARRIAASSIYYALFEVREDGLLRPVQAPVFNTFPESMSQILRYTGKTNEQFTRLMVNIGISASNTGSEQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINAKWVQEIQTFIVKFMKNGRFKHKVSKEKRTAGGKKVADGFVVEAAANKEDYNQGHLQFMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAVKP
>NZ_CP046806.1|WP_005381007.1|1723138_1724059_-|glutaminase-B
MKPTVEILTDILAEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNEGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWSRVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQTRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTISVWSPELDPSGNSLAGTKALELLSERIGRSIF
>NZ_CP046806.1|WP_158156870.1|1721869_1723048_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRISIGVQSFEQQKLECLGRIHGQDEAVNAAQLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHQKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPISTIQETINWAIEMGYLSETPTHWQITEKGKLFLNDLLEAFMAEESEE
>NZ_CP046806.1|WP_042521298.1|1721248_1721851_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQENLEKLLAAMEGVPEAERTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPVFFVPEDNCASAELEPARKKQLSHRGKALKSLFAQLSEQVSQ
>NZ_CP046806.1|WP_005381010.1|1720698_1721130_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSFADQFKNMKDIEVHYVAFNSTFLTPKVARSYDIKRNGYLAVVNISVLDRASLGKPALEAKIAGRAKNLIGQTQTLTFREVKEGNAIYYLAELPITHEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>NZ_CP046806.1|WP_005393980.1|1720279_1720570_+|YggU-family-protein
MSAAVWQDGEDIILKLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKIAKGLVHIEKGELGRHKQIRIESPTQIPTEIKAIL
>NZ_CP046806.1|WP_158156876.1|1729860_1731486_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAIEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMMFIAAPLDPQLHGTSFHDFRDGIGNSVGQLILDVLGHKTGQIVEYTWSQKQADGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWSTAQWQLVLCLIIAGSILSGLIISIRKMLHLLGGEPNDVRKAVQAVAQGDIQTSFDTVAPRGSIYRAVQDMSQSLATMVTNLEKSMHALRAELSAVEARSNTIADLTVSQQQSTAMIATAMTEMASSANHVANSASDTANNTDEADKQSQHTQKLIHNTVENIQGLASQLNTASKAVADLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQYMISNLQEGSRNAIHTMEICAETSESTVTESKNASEALQQIVTALESITTMSQQIATAAAEQTQVSDDIALRINLIDESGGQLNSVVTESQSSTQSLASLANELEGWVNKFSVKH
>NZ_CP046806.1|WP_064354314.1|1732474_1733908_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MQQIKNETLKSVFKQWSSEEGIVVINPATEQELIRLKPSTLDELDDLIGQCKTEQVRWAKLSAKERSRRLRGWYQLLLDNAEDIATIITLEQGKPLAESKGEVMYGASFVEWFSEEAKRAYGEVIPAPTTDRRLSAIRQPVGVCAAITPWNFPIAMITRKAAPALAAGCGMLIKPSELTPLTAIAVVELAYQAGIPKELLSVMVSEQAAEFGQVLSTDPRIQKISFTGSTRVGKILMKQASDSVKAVSMELGGNAPFIVFEDADLDAAAEGLVASKFRNAGQTCVCTNRLYVHKNVKQAFIDKVLSKLSKLKLGNGLEKGVTLGPVITMASKHRLEAVIDQAVQEGASIANSPQRRPGRFMEPVLLDSVTQNMSIVQQELFGPVLPIVTFENDDQVLEMANDTEYGLACYFYTNSLKRIVTFSEGLEYGMVGVNEGIISTEVAPFGGVKESGVGREGAKQGLDEYLETKYICLGGLS
>NZ_CP046806.1|WP_005381029.1|1740625_1741879_-|HD-GYP-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQEQVEMIRHLGVKFVYFNPEQSDAVPLPVDQRQADRVTNEASLDHETQKMWQEKQNRIEKLSAYRRRVIQCEKEFERSLARMRSVMTKIRNRPTAAVDEAKLLIEDIVEKLMCDDNVTLHLMNGKNEFEDIYFHSLNVAVISMMIGRAKGYSAAQLKELSFSALFHDIGKIKIPTAILRKQLPLTEPETNYLKLHTKYGVDLASQIEAFPEVARIVIAQHHELRDGSGYPKGLKGDEINEFAQIIAVANAFDNLCHTPIVSDQKIPYTALSHLYKNCKHLYKEENLNILIKFMGVFPPGTVVQLSNNMVGLVISVNASHLLFPNVLVYDPSVPRTQAPIIDLASKDIKIVNAIHPSKLPDKVKEYLNPRSRISYFFDSDE
>NZ_CP046806.1|WP_158156878.1|1742009_1743008_-|substrate-binding-domain-containing-protein
MARIKDVAELAGVNRSTVSRIINGEGKFREETRKKVEQAMAQLNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDIHKKFLITAQGHHSAQGEKEAIQRFNDLRCDGYVLHSRYLSDDDLRELAKQPTPFVLLDRYVEGIEERCVIFNHHHASRIAVEHLLAGGHRKIACIAGPSQRHNSVLRKLGYIDAMKDAGIDIDESWCEEGNYGRQSGYDAMAAILQRHPDVTAVFSCSEEMTVGAMQYLHEHSISVPEQISLTSFDSVDLCESLYPTVSAVHFPISDMARVAVQTLMGLVKDQEVIDKPVFEAKLKIRKADRSLK
>NZ_CP046806.1|WP_054579416.1|1743112_1743868_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTRGVNSGIVKAHQQGVVHSTTMMVGMDAEQHALELARHNPDLKIGVHLRFTAGVPITKHPNLTNGRAHFINYDELWSKQDFETQVIYDEAKAQVEHFLSLGLELSHLDSHHHAHTHPQILPVIKEVANEYRVPLRGTGLCQESMTIRYIFTDEFYDQKVSLDGLMAHLLSLKADYDLVEVMCHPAEADQALILKSGYALQRELELQVLTSPILKEQLAHHGITVTDYSELVSTNQMVGV
>NZ_CP046806.1|WP_005381048.1|1743886_1745209_-|6-phospho-beta-glucosidase
MSREAIKLAIIGGGSSYTPELVEGVIKRLEYLPVKKIHFVDIESGAEKLEIIKGLAQRMVDKAGAKIEIKAGFDRRAAIKDADFVMTQFRVGGLAARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELAPNAWMLNFTNPAGLVSEAVSKYTKVKSIGLCNVPVSMEMMIAEMMECEPKELQLEFAGLNHLVWVHKAWLNGEDITQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTDAMLAEEKQSADEKGTRAEQVMETENALFKLYQDPTLDHKPKELEERGGAYYSDASLNLVDSIYNNRNSIHVVNVLNNGAINGLPDDAVIECSAVIGSWGAKPLAVGELSNNIKGLLHQVKAYEQLTIEAAVEGNYDKALMALTNNPLVPDIGRAKSILDDILAVNAPYLPQFKLTTL
>NZ_CP046806.1|WP_031777269.1|1745221_1745533_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREQDFEAADEKLSQARECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKKISNK
>NZ_CP046806.1|WP_005385544.1|1745584_1746928_-|PTS-sugar-transporter-subunit-IIC
MDSMKLYDAIIGAVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFTFGRIWLDFATTHFDTIMMPYNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMSFLLIAAPAKDGALSMSHMGGTGIFTAVMCAFFSVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAIFITLYPLSLFVQTQYDMLIPDAVMAIFKPLISASNSLPAIIGALLLCQLLWFAGIHGAAIVVGLLSPIFLTNIGANIEAFVAGEPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSVHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPTLFIPFVFAPVINATIAYFAVHVGFVGMGVATTPWTTPALIGASWGSGWTFAPVLLVIGLLILDLIIYFPFFKMFEKQMLEQELPTTKETKGDTQPSGEGVTA
>NZ_CP046806.1|WP_020480920.1|1747006_1747312_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAENKGIECKIDAMSVNAFEDVIKEYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISPQHYGMMKGEEVLEQALELIN
>NZ_CP046806.1|WP_158156880.1|1747559_1748843_+|polysaccharide-deacetylase-family-protein
MKFNKLAIAALVSAALSQHSFAQTDSKGTIYLTFDDGPINASIDVIQVLNQEDIKATFYFNAWHLDGIGDENEDRSLEALKLALDTGHIVANHSYDHMVHNCVDEFGPNSAAECNATGDHQLNSYQDPVYDASMFTENLSVLAKYLPNITSYPNYKATEFARLPYTNGWRVTKDFKADGLCATSDNLKPWEPGYVCDTSNPSNSVKAAIEVQNILANNGYQTHGWDVDWAPENWGIEMPANSLTEAEAFLGYVDSALNTCAPTTINPINSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATQNLPKLAKFIQLAKQAGYDFDTMDNYTPNWQVGHNYDAGDYVLHLGTVYQAVTNHTAQQDWAPSPTSSLWTNADPATNWTQNVSYKQGDVVTYQGLRYLVDVPHVSQADWTPNTQNTLFTTL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP046806.1	1731890-1731926	0	1.0
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP046806.1	1732103-1732139	1	0.973
NZ_CP046806_1	1.2\|1729434\|75\|NZ_CP046806\|PILER-CR	1729434-1729508	75	NZ_CP046806.1	1729080-1729154	16	0.787

1. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to position: 1731890-1731926, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattt	Protospacer
*************************************

2. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to position: 1732103-1732139, mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.**

3. spacer 1.2|1729434|75|NZ_CP046806|PILER-CR matches to position: 1729080-1729154, mismatch: 16, identity: 0.787

cgtgtcggtggttcgattccgcctcgaggcaccatatctggtgcacttgcttcataagca	CRISPR spacer
cgtgtcggtggttcgattccgcctcgaggcaccatatttggtgcacttgcttcataagca	Protospacer
*************************************.**********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296535	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1200	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3106	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52078-52114	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52084-52120	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52089-52125	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52088-52124	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	LN997803	Escherichia coli phage phi467	15126-15162	1	0.973
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103857	2	0.946
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85817-85853	2	0.946
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1963	3	0.919
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35428-35464	3	0.919
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13645-13681	3	0.919
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	MH494197	Escherichia phage CMSTMSU, complete genome	196772-196808	3	0.919
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	KY653118	Morganella phage IME1369_01, complete genome	698-734	3	0.919
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76647	4	0.892
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17153	4	0.892
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NC_027364	Escherichia phage PBECO 4, complete genome	207832-207868	4	0.892
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23560	4	0.892
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52945-52981	5	0.865
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	MH383160	Escherichia phage UB, complete genome	272124-272160	5	0.865
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77929-77965	5	0.865
NZ_CP046806_1	1.1\|1729351\|37\|NZ_CP046806\|PILER-CR	1729351-1729387	37	KM507819	Escherichia phage 121Q, complete genome	77938-77974	6	0.838

1. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** *

2. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** *

3. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** *

4. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.**

5. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.**

6. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.**

7. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.**

8. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 1, identity: 0.973

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** *

9. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatca	Protospacer
***********************************.

10. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaat	Protospacer
**********************************  *

11. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaa	Protospacer
**********************************

12. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatc	Protospacer
*************************.******** *.

13. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * *.

14. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * *.

15. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatat	Protospacer
****************.********.********* *

16. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  *

17. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  *

18. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  *

19. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatat	Protospacer
.*****.******************.********* *

20. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  *

21. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  *

22. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  *

23. spacer 1.1|1729351|37|NZ_CP046806|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattt	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaat	Protospacer
 * ***********.***************** *  *

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

606457 : 629777

Vibrio_phage(64.29%)

capsid,portal,protease,head

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158156404.1\|606457_606925_-	hypothetical protein	V9LYW9	Vibrio_phage	4.8e-56	61.2
WP_158156406.1\|606958_607414_+	hypothetical protein	NA	NA	NA	NA
WP_158156408.1\|607410_607617_+	hypothetical protein	NA	NA	NA	NA
WP_158156410.1\|607650_608049_+	HNH endonuclease	G3EN93	Psychrobacter_phage	7.9e-07	31.0
WP_158156412.1\|608505_608829_+	hypothetical protein	NA	NA	NA	NA
WP_158156414.1\|608837_610544_+	hypothetical protein	A0A1W6JP18	Morganella_phage	2.7e-104	37.8
WP_158156417.1\|610558_611794_+\|portal	phage portal protein	A0A2H4JFJ9	uncultured_Caudovirales_phage	5.1e-28	27.2
WP_158156419.1\|611783_612512_+\|head,protease	HK97 family phage prohead protease	A0A286S1N1	Klebsiella_phage	1.2e-32	41.4
WP_158156421.1\|612664_613768_+\|capsid	phage major capsid protein	I7HDH9	Xanthomonas_virus	4.7e-33	31.1
WP_158156423.1\|613841_614033_+	hypothetical protein	NA	NA	NA	NA
WP_158156425.1\|614032_614362_+	hypothetical protein	NA	NA	NA	NA
WP_158156427.1\|614371_614707_+\|head	phage head closure protein	NA	NA	NA	NA
WP_158156429.1\|614709_615282_+	hypothetical protein	NA	NA	NA	NA
WP_158156431.1\|615295_615676_+	hypothetical protein	NA	NA	NA	NA
WP_158156433.1\|615679_616129_+	hypothetical protein	M4MA02	Vibrio_phage	4.1e-28	48.2
WP_158156435.1\|616196_616499_+	hypothetical protein	NA	NA	NA	NA
WP_158156437.1\|616531_616954_+	hypothetical protein	A0A2I7S7P9	Vibrio_phage	4.6e-21	41.4
WP_158156439.1\|616963_619219_+	hypothetical protein	A0A2I7S7Q1	Vibrio_phage	7.6e-06	21.8
WP_158156441.1\|619430_619997_+	hypothetical protein	A0A2I7S7Q2	Vibrio_phage	2.7e-45	44.7
WP_158156443.1\|619996_620533_+	hypothetical protein	A0A2I7S7U0	Vibrio_phage	6.8e-46	53.8
WP_158156445.1\|620532_620922_+	hypothetical protein	A0A2I7S7P4	Vibrio_phage	5.5e-13	33.6
WP_158156447.1\|620921_625256_+	hypothetical protein	M4MHT9	Vibrio_phage	1.4e-181	44.0
WP_158156449.1\|625322_625724_+	hypothetical protein	NA	NA	NA	NA
WP_158156451.1\|625733_629777_+	hypothetical protein	A0A222YTL6	Vibrio_phage	0.0e+00	76.0

DBSCAN-SWA_2

1648886 : 1664341

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053306770.1\|1648886_1651469_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.2e-79	38.3
WP_005383799.1\|1651611_1652079_-	recombination regulator RecX	NA	NA	NA	NA
WP_158156857.1\|1651970_1652150_-	hypothetical protein	NA	NA	NA	NA
WP_005380874.1\|1652206_1653250_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	61.0
WP_005383794.1\|1653450_1653933_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-26	48.1
WP_025768847.1\|1654017_1656579_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	7.8e-31	23.5
WP_005380887.1\|1656661_1657648_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_017633546.1\|1657728_1658652_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005380892.1\|1658665_1659292_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-37	54.5
WP_005380894.1\|1659291_1660068_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-66	49.4
WP_017821624.1\|1660067_1661111_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|1661156_1661633_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_017821625.1\|1661647_1662355_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	9.1e-06	23.6
WP_005380907.1\|1662356_1662638_-	cell division protein FtsB	NA	NA	NA	NA
WP_005383785.1\|1663039_1664341_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.1e-137	60.6

DBSCAN-SWA_3

2948300 : 2955083

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383771.1\|2948300_2949440_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.5e-63	42.0
WP_130545216.1\|2949457_2950708_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	8.6e-100	48.7
WP_005381578.1\|2950913_2951363_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_158157276.1\|2951370_2952498_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	7.1e-45	34.5
WP_005383626.1\|2952506_2953160_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.1e-32	37.0
WP_005381573.1\|2953333_2954443_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-65	39.8
WP_005381572.1\|2954612_2955083_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	48.7

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046805

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3426

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005388042.1\|572_1544_-	diguanylate cyclase	W8CYM9	Bacillus_phage	2.4e-09	32.2
WP_005376232.1\|1805_2243_+	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_005388041.1\|2319_3426_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	4.6e-20	31.0

DBSCAN-SWA_2

12270 : 14946

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634628.1\|12270_12741_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	1.2e-51	62.9
WP_158155107.1\|12825_14946_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.0e-270	65.4

DBSCAN-SWA_3

24097 : 24892

Stenotrophomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155119.1\|24097_24892_+	serine/threonine protein phosphatase	A0A142EZR4	Stenotrophomonas_phage	5.1e-13	25.8

DBSCAN-SWA_4

47053 : 47476

Siphoviridae_environmental_samples(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155145.1\|47053_47476_-	AAA family ATPase	A0A2R3UAQ8	Siphoviridae_environmental_samples	2.6e-24	44.3

DBSCAN-SWA_5

50773 : 51730

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155149.1\|50773_51730_-	diguanylate cyclase	G3MA91	Bacillus_virus	2.2e-15	34.3

DBSCAN-SWA_6

78553 : 79816

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155171.1\|78553_79816_+	3-hydroxy-3-methylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	8.1e-05	38.6

DBSCAN-SWA_7

84470 : 84905

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376074.1\|84470_84905_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	1.4e-12	39.6

DBSCAN-SWA_8

99567 : 106599

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031777243.1\|99567_100527_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.5e-14	31.0
WP_158155185.1\|100754_101741_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017820191.1\|101742_103080_+	diguanylate cyclase	G3MA91	Bacillus_virus	4.1e-15	26.9
WP_025767734.1\|103315_104308_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_158155187.1\|104811_105741_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_005375991.1\|105810_106599_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	5.0e-05	28.7

DBSCAN-SWA_9

109623 : 111255

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375988.1\|109623_111255_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-18	31.0

DBSCAN-SWA_10

119260 : 121707

Aphanizomenon_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155193.1\|119260_120922_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	2.4e-33	29.3
WP_017820203.1\|121191_121707_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	2.7e-07	28.6

DBSCAN-SWA_11

126191 : 126725

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767720.1\|126191_126725_-	lipocalin	A0A1W6JNX6	Morganella_phage	2.5e-40	46.8

DBSCAN-SWA_12

130538 : 138313

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375971.1\|130538_131672_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	1.5e-10	28.4
WP_158155199.1\|132030_132870_-	NAD/NADP transhydrogenase subunit beta	NA	NA	NA	NA
WP_005375969.1\|132870_133161_-	type VI secretion protein	NA	NA	NA	NA
WP_158155201.1\|133172_135008_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	7.1e-26	24.8
WP_005375967.1\|135057_135537_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_158155203.1\|135745_138313_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	6.5e-86	31.1

DBSCAN-SWA_13

156730 : 158884

Powai_lake_megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155213.1\|156730_158884_+	protein kinase	A0A167RIZ6	Powai_lake_megavirus	4.0e-20	28.3

DBSCAN-SWA_14

166988 : 167825

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155221.1\|166988_167825_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	9.0e-29	37.1

DBSCAN-SWA_15

179820 : 181734

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155231.1\|179820_181734_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	3.5e-20	31.8

DBSCAN-SWA_16

187008 : 187677

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017820242.1\|187008_187677_-	response regulator transcription factor	W8CYM9	Bacillus_phage	4.0e-27	33.9

DBSCAN-SWA_17

192634 : 193390

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634222.1\|192634_193390_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-18	29.9

DBSCAN-SWA_18

206698 : 208264

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821221.1\|206698_208264_-	alginate lyase	Q8QKV2	Ectocarpus_siliculosus_virus	4.9e-20	41.0

DBSCAN-SWA_19

218379 : 221564

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155254.1\|218379_219096_+	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	8.0e-10	27.1
WP_158155256.1\|219782_221564_+	transporter	A0A219Y9P9	Aeromonas_phage	5.3e-10	23.2

DBSCAN-SWA_20

232474 : 236941

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054576774.1\|232474_233305_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	1.8e-05	26.8
WP_158155264.1\|233314_233887_-	protocatechuate 3,4-dioxygenase	NA	NA	NA	NA
WP_005388569.1\|234024_234693_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_042521067.1\|234689_235379_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_047100941.1\|235380_236124_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_158155267.1\|236212_236941_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	6.9e-25	34.4

DBSCAN-SWA_21

243905 : 245507

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155275.1\|243905_245507_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.5e-11	23.9

DBSCAN-SWA_22

257011 : 258786

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375778.1\|257011_257770_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.5e-06	27.1
WP_005375775.1\|257880_258786_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	9.5e-24	27.9

DBSCAN-SWA_23

266583 : 272595

Pike_perch_iridovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275375.1\|266583_268188_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	65.3
WP_065275376.1\|268217_269057_+	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_065275377.1\|269056_269965_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	7.7e-50	40.0
WP_158155289.1\|270011_270890_-	EamA family transporter	NA	NA	NA	NA
WP_053303727.1\|271281_272595_-	PAS domain S-box protein	A0A2H4J162	uncultured_Caudovirales_phage	1.1e-12	51.1

DBSCAN-SWA_24

278820 : 280092

Pontimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155291.1\|278820_280092_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	2.7e-16	37.5

DBSCAN-SWA_25

294935 : 299284

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375680.1\|294935_296867_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	29.8
WP_017635749.1\|297280_299284_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	4.7e-31	24.5

DBSCAN-SWA_26

302967 : 306258

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102970228.1\|302967_304524_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.4e-27	30.2
WP_047101539.1\|304803_306258_+	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	1.6e-09	23.8

DBSCAN-SWA_27

313044 : 314337

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005386186.1\|313044_314337_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.4e-50	31.3

DBSCAN-SWA_28

317503 : 317716

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375644.1\|317503_317716_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.4e-17	61.4

DBSCAN-SWA_29

322558 : 333515

Chrysochromulina_ericina_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155310.1\|322558_323809_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.5e-48	32.3
WP_158155312.1\|324359_326267_+	AAA family ATPase	A0A2H4J1E0	uncultured_Caudovirales_phage	2.6e-23	31.4
WP_033906842.1\|326818_327064_-	hypothetical protein	NA	NA	NA	NA
WP_005375557.1\|327104_327320_-	hypothetical protein	NA	NA	NA	NA
WP_080276966.1\|327464_327773_+	DUF1289 domain-containing protein	NA	NA	NA	NA
WP_033906840.1\|327811_328156_-	HopJ type III effector protein	NA	NA	NA	NA
WP_053303749.1\|328355_330125_+	hypothetical protein	E3SII1	Synechococcus_phage	3.5e-06	33.3
WP_005375563.1\|330196_330535_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_005375564.1\|330524_331319_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_053350624.1\|331541_333515_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.8e-18	26.5

DBSCAN-SWA_30

341919 : 344700

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005388254.1\|341919_342399_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	6.3e-19	35.0
WP_158155316.1\|342699_344700_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.0e-23	26.7

DBSCAN-SWA_31

365357 : 367589

Feldmannia_species_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155320.1\|365357_367589_+	response regulator	B5LWN0	Feldmannia_species_virus	3.3e-09	32.3

DBSCAN-SWA_32

373205 : 376982

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155327.1\|373205_374096_-	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	1.2e-23	32.4
WP_017635871.1\|374429_375872_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	9.8e-15	28.5
WP_017635870.1\|376110_376407_-	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_005375625.1\|376772_376982_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1

DBSCAN-SWA_33

385915 : 390732

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821601.1\|385915_387547_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.3e-11	36.4
WP_005385208.1\|387543_388707_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_085569296.1\|389037_390732_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	2.1e-93	36.6

DBSCAN-SWA_34

398959 : 399574

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635855.1\|398959_399574_+	glutaredoxin	A0A0K1YA09	Cronobacter_phage	2.0e-09	45.1

DBSCAN-SWA_35

402863 : 406074

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375494.1\|402863_404684_+	phosphodiesterase	A0A127AWB9	Bacillus_phage	2.1e-06	28.8
WP_025768471.1\|404790_406074_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2L1IVP0	Streptomyces_phage	1.0e-15	43.9

DBSCAN-SWA_36

410512 : 412384

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155337.1\|410512_412384_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	5.0e-27	40.5

DBSCAN-SWA_37

417950 : 418826

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635840.1\|417950_418826_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.2e-07	27.0

DBSCAN-SWA_38

429467 : 430394

Brazilian_cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906808.1\|429467_430394_+	ABC transporter ATP-binding protein	A0A2R8FG22	Brazilian_cedratvirus	4.8e-23	32.4

DBSCAN-SWA_39

444736 : 447971

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375420.1\|444736_445588_+	carbenicillin-hydrolyzing class A beta-lactamase CARB-42	Q1MVP3	Enterobacteria_phage	1.1e-50	43.3
WP_053303796.1\|445870_446920_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.9e-16	30.2
WP_005375418.1\|447032_447185_-	hypothetical protein	NA	NA	NA	NA
WP_005375417.1\|447431_447971_+	spermidine N1-acetyltransferase	G3MB37	Bacillus_virus	7.6e-05	25.0

DBSCAN-SWA_40

455896 : 459834

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_115386751.1\|455896_458056_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	1.1e-67	34.5
WP_158155351.1\|458262_459834_-	ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	8.4e-28	28.9

DBSCAN-SWA_41

473671 : 475231

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635256.1\|473671_475231_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.2e-27	36.9

DBSCAN-SWA_42

480821 : 484704

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031777205.1\|480821_481454_-	aldolase	A0A077SK32	Escherichia_phage	1.0e-69	62.6
WP_031780938.1\|481480_482737_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.6e-130	56.0
WP_054574451.1\|482762_483671_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.4e-99	66.7
WP_005375354.1\|483945_484704_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-56	47.4

DBSCAN-SWA_43

488144 : 494144

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155367.1\|488144_488993_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.0e-17	33.8
WP_158155369.1\|489949_491254_-	MATE family efflux transporter	NA	NA	NA	NA
WP_158155371.1\|491930_494144_+	site-specific DNA-methyltransferase	A0A2H4IZ75	uncultured_Caudovirales_phage	6.1e-24	29.4

DBSCAN-SWA_44

503593 : 504976

Escherichia_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155396.1\|503593_504244_-	AAA family ATPase	A0A0A7HDE7	Escherichia_phage	8.9e-08	25.7
WP_158155398.1\|504424_504976_-	recombinase family protein	M9Q1K0	Clostridium_phage	1.0e-28	50.4

DBSCAN-SWA_45

509484 : 510399

Bacillus_thuringiensis_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005385059.1\|509484_510399_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.2e-23	26.1

DBSCAN-SWA_46

517566 : 518349

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053303821.1\|517566_518349_+	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.4e-15	31.1

DBSCAN-SWA_47

524429 : 525260

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375299.1\|524429_525260_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	1.3e-59	48.5

DBSCAN-SWA_48

538495 : 539614

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375271.1\|538495_539614_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	2.0e-23	32.4

DBSCAN-SWA_49

555185 : 557698

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821260.1\|555185_556625_+	catalase	A0A2K9L0T1	Tupanvirus	4.7e-102	47.2
WP_005375233.1\|556819_557698_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	3.1e-27	32.6

DBSCAN-SWA_50

565495 : 575629

Bacillus_phage(60.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155428.1\|565495_566305_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.3e-27	42.5
WP_158155430.1\|566552_567917_-	Ktr system potassium transporter B	NA	NA	NA	NA
WP_005375180.1\|567918_568572_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_086047254.1\|568723_569422_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-24	30.8
WP_158155432.1\|569418_570465_-	DUF4118 domain-containing protein	W8CYF6	Bacillus_phage	5.4e-15	26.7
WP_158155434.1\|570690_572544_-	ATP-binding cassette domain-containing protein	W8CYL7	Bacillus_phage	4.8e-30	26.6
WP_158155436.1\|572689_574792_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_017635311.1\|574843_575629_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-14	28.2

DBSCAN-SWA_51

580867 : 582586

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906740.1\|580867_582586_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	1.2e-19	24.2

DBSCAN-SWA_52

585591 : 587508

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768546.1\|585591_587508_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	52.9

DBSCAN-SWA_53

594758 : 602739

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275462.1\|594758_596885_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-10	33.0
WP_005375156.1\|597213_597963_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-14	28.6
WP_005383923.1\|598023_598887_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_005375154.1\|598909_599842_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_158155446.1\|599942_600764_-	phosphate ABC transporter substrate-binding protein PstS family protein	E3SLK5	Synechococcus_phage	7.3e-07	28.5
WP_158155448.1\|601095_602739_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-10	58.0

DBSCAN-SWA_54

609305 : 616974

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155456.1\|609305_611303_-	prolyl oligopeptidase family serine peptidase	F2Y2S5	Organic_Lake_phycodnavirus	1.6e-10	30.3
WP_017820508.1\|611627_612971_-	DEAD/DEAH box helicase	E3T5E1	Cafeteria_roenbergensis_virus	5.7e-41	31.2
WP_005375145.1\|613521_613776_+	membrane protein	NA	NA	NA	NA
WP_005383933.1\|613802_614729_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_158155458.1\|614735_616151_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	2.0e-60	31.3
WP_158155460.1\|616173_616974_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	1.6e-19	30.3

DBSCAN-SWA_55

622197 : 632618

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375136.1\|622197_623781_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.0e-17	40.7
WP_005478107.1\|624025_624406_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_025553722.1\|624405_625536_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|625871_626420_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_158155464.1\|626426_628166_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	3.2e-20	35.1
WP_005383942.1\|628162_629002_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_025768568.1\|629124_629406_-	hypothetical protein	A0A2H4IYD3	uncultured_Caudovirales_phage	8.2e-19	61.6
WP_005375129.1\|629612_630794_-	MFS transporter	NA	NA	NA	NA
WP_047104522.1\|630993_631848_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_042521643.1\|631847_632618_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	9.6e-09	28.1

DBSCAN-SWA_56

637163 : 638792

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375120.1\|637163_638792_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-31	46.8

DBSCAN-SWA_57

642216 : 646124

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155466.1\|642216_643848_+	dipeptide ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.3e-19	32.1
WP_158155469.1\|644090_646124_-	prolyl oligopeptidase family serine peptidase	A0A1V0SHT0	Klosneuvirus	7.0e-67	31.7

DBSCAN-SWA_58

658868 : 661138

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383983.1\|658868_659900_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_005375095.1\|659944_661138_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	5.0e-41	30.0

DBSCAN-SWA_59

666623 : 669418

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_104976434.1\|666623_667139_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	4.7e-44	52.7
WP_085569382.1\|667166_668540_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_158155476.1\|668656_669418_-	response regulator	W8CYM9	Bacillus_phage	3.9e-31	32.8

DBSCAN-SWA_60

679258 : 680317

Emiliania_huxleyi_virus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155482.1\|679258_680317_+\|protease	trypsin-like serine protease	V5LS29	Emiliania_huxleyi_virus	5.5e-15	26.0

DBSCAN-SWA_61

704578 : 710936

Lactococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005386881.1\|704578_704956_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.9e-26	48.4
WP_005374999.1\|705068_705284_-	TIGR02450 family Trp-rich protein	NA	NA	NA	NA
WP_005374998.1\|705422_705896_-	HPP family protein	NA	NA	NA	NA
WP_025768600.1\|705994_706540_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_025768601.1\|706624_709063_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	4.0e-08	40.8
WP_158155494.1\|709065_710007_-	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	5.1e-12	24.1
WP_068336989.1\|710261_710936_+	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	6.8e-27	31.8

DBSCAN-SWA_62

716856 : 718047

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374959.1\|716856_718047_+	MFS transporter	S4TR35	Salmonella_phage	1.1e-11	23.6

DBSCAN-SWA_63

738456 : 739614

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005462693.1\|738456_739614_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-77	43.1

DBSCAN-SWA_64

743047 : 747045

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155513.1\|743047_744529_+	deoxyribodipyrimidine photolyase	A0A1V0S949	Catovirus	3.6e-28	25.2
WP_005384595.1\|744609_745110_+	fasciclin domain-containing protein	NA	NA	NA	NA
WP_132936260.1\|745581_747045_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.5e-13	31.5

DBSCAN-SWA_65

773815 : 776269

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053307964.1\|773815_776269_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.0e-16	44.8

DBSCAN-SWA_66

782490 : 782799

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374825.1\|782490_782799_+	PTS transporter subunit EIIB	A0A2I7SAJ6	Vibrio_phage	3.4e-10	41.7

DBSCAN-SWA_67

792923 : 794540

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155531.1\|792923_794540_-	endonuclease I	A0A2P0VMP9	Tetraselmis_virus	3.0e-12	30.9

DBSCAN-SWA_68

810920 : 811655

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768659.1\|810920_811655_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-15	30.9

DBSCAN-SWA_69

822733 : 835979

Enterobacteria_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017820101.1\|822733_823741_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.6e-19	27.9
WP_047102429.1\|823887_824532_+	recombinase family protein	NA	NA	NA	NA
WP_017820099.1\|824528_825713_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.8e-22	28.4
WP_158155547.1\|825790_826435_+	hypothetical protein	NA	NA	NA	NA
WP_053308092.1\|826516_828253_-	hypothetical protein	NA	NA	NA	NA
WP_053307982.1\|828698_829652_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	3.6e-13	42.2
WP_080276973.1\|829555_830008_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_151515257.1\|830095_832846_-	insulinase family protein	A0A2P1EL85	Moumouvirus	3.1e-17	30.0
WP_025768674.1\|833210_835097_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-22	44.8
WP_005383457.1\|835214_835979_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	2.8e-13	28.9

DBSCAN-SWA_70

849603 : 854841

Bovine_gammaherpesvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054576551.1\|849603_850806_+	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	5.0e-12	23.8
WP_025551121.1\|850888_851335_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_158155557.1\|851562_853554_+	U32 family peptidase	Q6DW11	Phage_TP	3.1e-19	27.4
WP_005374689.1\|853658_853904_+	DUF3297 family protein	NA	NA	NA	NA
WP_158155559.1\|854130_854841_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	1.5e-21	28.9

DBSCAN-SWA_71

865905 : 867474

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374617.1\|865905_867474_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	4.3e-40	32.4

DBSCAN-SWA_72

871491 : 871977

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383526.1\|871491_871977_+	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	1.1e-07	26.1

DBSCAN-SWA_73

875678 : 883750

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155580.1\|875678_876917_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	8.3e-47	31.6
WP_005383547.1\|877182_878184_-	amidinotransferase	NA	NA	NA	NA
WP_005374597.1\|878588_880439_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.0e-33	25.4
WP_005383549.1\|881030_881738_+	hypothetical protein	NA	NA	NA	NA
WP_005374595.1\|881840_882317_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005374593.1\|882609_882858_-	hypothetical protein	NA	NA	NA	NA
WP_005383553.1\|883216_883750_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	4.0e-06	31.4

DBSCAN-SWA_74

891227 : 893732

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017820064.1\|891227_892040_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.4e-05	35.4
WP_017820063.1\|893012_893732_+	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	8.6e-36	41.6

DBSCAN-SWA_75

901944 : 904059

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374556.1\|901944_904059_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.0e-33	26.6

DBSCAN-SWA_76

913904 : 921884

Burkholderia_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_132936208.1\|913904_914816_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	5.1e-09	29.6
WP_158155598.1\|914904_915564_+	antibiotic acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	2.5e-26	39.8
WP_158156067.1\|915620_917300_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_158155600.1\|917551_919579_-	GNAT family N-acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	3.5e-10	28.9
WP_042522297.1\|919684_920659_-	ParB/RepB/Spo0J family partition protein	Q6UAV8	Klebsiella_phage	3.3e-22	30.3
WP_005374503.1\|920666_921884_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	4.5e-37	29.8

DBSCAN-SWA_77

925848 : 932282

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821873.1\|925848_926781_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.1e-14	31.8
WP_054729748.1\|926783_927632_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	7.3e-18	31.1
WP_005374493.1\|927993_928191_+	hypothetical protein	NA	NA	NA	NA
WP_005374492.1\|928429_929491_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.9e-39	44.0
WP_005374490.1\|929559_930315_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017633805.1\|930383_932282_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	8.5e-59	38.0

DBSCAN-SWA_78

935671 : 936370

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155602.1\|935671_936370_+	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	6.6e-41	42.2

DBSCAN-SWA_79

939796 : 944044

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155611.1\|939796_940819_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	9.4e-20	30.5
WP_158155613.1\|940834_941626_+	response regulator	NA	NA	NA	NA
WP_053350113.1\|941766_942261_-	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.3e-11	31.4
WP_025768726.1\|942382_944044_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-17	65.4

DBSCAN-SWA_80

948452 : 949310

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374445.1\|948452_949310_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.1e-16	28.3

DBSCAN-SWA_81

958716 : 959199

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374431.1\|958716_959199_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.0e-29	47.0

DBSCAN-SWA_82

966304 : 971903

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155619.1\|966304_968851_-	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	1.0e-147	48.0
WP_053304032.1\|969220_969724_-	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_005383244.1\|970052_970337_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_005374405.1\|970469_970751_+	hypothetical protein	NA	NA	NA	NA
WP_025768745.1\|970754_971903_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	8.9e-19	31.0

DBSCAN-SWA_83

976259 : 983613

Diadromus_pulchellus_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053320008.1\|976259_977126_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	1.4e-19	27.2
WP_020841638.1\|977252_978140_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_025516303.1\|978234_979038_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_011106212.1\|979145_979550_-	hypothetical protein	NA	NA	NA	NA
WP_005383270.1\|979559_980657_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	8.5e-11	34.4
WP_005374384.1\|980662_981118_-	hypothetical protein	NA	NA	NA	NA
WP_005374382.1\|981562_982402_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_017633834.1\|982464_983613_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	8.9e-35	28.9

DBSCAN-SWA_84

988072 : 989251

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155627.1\|988072_989251_+	Spindolin	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	2.1e-31	38.1

DBSCAN-SWA_85

998181 : 998718

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155635.1\|998181_998718_-	DUF924 family protein	A0A1V0SIY0	Klosneuvirus	1.2e-21	35.5

DBSCAN-SWA_86

1004422 : 1007113

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_086047579.1\|1004422_1005559_+	glycerate kinase	W6LM47	Streptococcus_phage	3.1e-40	37.3
WP_086047578.1\|1005655_1007113_-	PLP-dependent aminotransferase family protein	A0A1X9I5H2	Streptococcus_phage	8.9e-24	26.9

DBSCAN-SWA_87

1010762 : 1015854

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821007.1\|1010762_1011494_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-26	31.3
WP_025768771.1\|1011503_1012019_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_005374302.1\|1012289_1013384_+	cytochrome c	NA	NA	NA	NA
WP_104976335.1\|1013406_1015854_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	8.7e-80	30.8

DBSCAN-SWA_88

1020856 : 1021612

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054575239.1\|1020856_1021612_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.2e-26	39.9

DBSCAN-SWA_89

1035839 : 1040574

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350830.1\|1035839_1036835_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	4.0e-68	42.4
WP_017819702.1\|1037077_1037560_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_158155647.1\|1037595_1038306_-	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	1.2e-18	29.0
WP_005386018.1\|1038535_1039201_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.0e-26	35.2
WP_158155649.1\|1039200_1040574_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.4e-15	24.8

DBSCAN-SWA_90

1051858 : 1060793

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155659.1\|1051858_1052587_+	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	4.8e-10	28.7
WP_158155661.1\|1052586_1053462_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_158155663.1\|1053484_1054354_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017635534.1\|1054569_1055565_+	porin	Q1MVN1	Enterobacteria_phage	5.5e-09	23.5
WP_158155665.1\|1055780_1057946_-	prolyl oligopeptidase family serine peptidase	F2Y2Z7	Organic_Lake_phycodnavirus	3.7e-34	26.9
WP_005374234.1\|1058257_1059463_-	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_005374233.1\|1059872_1060793_-	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8

DBSCAN-SWA_91

1067727 : 1068627

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635526.1\|1067727_1068627_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.7e-07	42.5

DBSCAN-SWA_92

1074238 : 1076299

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155675.1\|1074238_1076299_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.8e-07	23.3

DBSCAN-SWA_93

1095702 : 1105550

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054728611.1\|1095702_1096308_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A0B5J690	Pandoravirus	1.2e-19	35.2
WP_021035911.1\|1096440_1097796_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.1e-15	32.1
WP_080773721.1\|1098183_1099740_-	DUF3612 domain-containing protein	NA	NA	NA	NA
WP_132936957.1\|1099908_1100493_+	hypothetical protein	NA	NA	NA	NA
WP_047102820.1\|1100583_1101597_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-16	36.6
WP_132936958.1\|1101946_1103299_+	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	1.2e-30	38.0
WP_005374147.1\|1103298_1104843_+	deoxyribodipyrimidine photo-lyase	A0A1V0SE91	Indivirus	1.5e-53	31.9
WP_158155689.1\|1104842_1105550_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	1.3e-28	35.2

DBSCAN-SWA_94

1110664 : 1111351

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497912.1\|1110664_1111351_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	2.1e-15	31.2

DBSCAN-SWA_95

1118234 : 1121376

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349367.1\|1118234_1119410_+	efflux RND transporter periplasmic adaptor subunit	A0A140XAI1	Dickeya_phage	1.3e-17	44.7
WP_158155697.1\|1119411_1121376_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	2.3e-38	40.3

DBSCAN-SWA_96

1125994 : 1128025

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155703.1\|1125994_1128025_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.1e-27	30.9

DBSCAN-SWA_97

1133947 : 1135054

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155712.1\|1133947_1135054_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.9e-30	36.3

DBSCAN-SWA_98

1144117 : 1146168

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054579230.1\|1144117_1145098_+	outer membrane beta-barrel protein	G3M9Z0	Bacillus_virus	2.3e-07	26.0
WP_158155716.1\|1145298_1146168_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	9.4e-13	25.4

DBSCAN-SWA_99

1151501 : 1153202

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374021.1\|1151501_1152020_+	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	2.1e-31	46.2
WP_054579235.1\|1152455_1153202_-	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	3.1e-12	42.1

DBSCAN-SWA_100

1172382 : 1176980

Micromonas_pusilla_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054865459.1\|1172382_1172733_-	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	5.3e-07	29.7
WP_005373989.1\|1173000_1173291_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_158155724.1\|1173324_1174923_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	4.8e-180	66.0
WP_005373984.1\|1175028_1175238_+	hypothetical protein	NA	NA	NA	NA
WP_017819776.1\|1175368_1175980_-	LysE family translocator	NA	NA	NA	NA
WP_017819777.1\|1176089_1176980_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	8.2e-12	23.9

DBSCAN-SWA_101

1189128 : 1190439

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064369687.1\|1189128_1190439_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	5.2e-39	30.4

DBSCAN-SWA_102

1193840 : 1194725

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387224.1\|1193840_1194725_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.6e-14	35.8

DBSCAN-SWA_103

1199216 : 1200446

Planktothrix_phage(100.0%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155738.1\|1199216_1200446_-\|holin	betaine/proline/choline family ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	7.5e-24	38.8

DBSCAN-SWA_104

1204089 : 1206114

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387204.1\|1204089_1206114_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	7.0e-35	23.0

DBSCAN-SWA_105

1217311 : 1220470

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155752.1\|1217311_1220470_+	acriflavin resistance protein	S5VTK5	Leptospira_phage	9.6e-47	20.5

DBSCAN-SWA_106

1223821 : 1230765

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155754.1\|1223821_1226923_-	MMPL family transporter	S5VTK5	Leptospira_phage	2.2e-64	23.9
WP_158155756.1\|1226919_1228248_-	HlyD family secretion protein	NA	NA	NA	NA
WP_021707693.1\|1228234_1228891_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_154204205.1\|1229083_1229743_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_005373862.1\|1229745_1230765_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-35	38.6

DBSCAN-SWA_107

1235345 : 1236968

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387086.1\|1235345_1236968_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.3e-10	22.9

DBSCAN-SWA_108

1241805 : 1255594

Yersinia_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155760.1\|1241805_1243065_-\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	4.2e-86	43.5
WP_021707696.1\|1243146_1243953_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005373824.1\|1244146_1244926_-	hypothetical protein	NA	NA	NA	NA
WP_086013800.1\|1245096_1247487_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.1e-171	37.8
WP_005373820.1\|1247720_1248557_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_115386508.1\|1248633_1249698_-	L-asparaginase 2	NA	NA	NA	NA
WP_158155762.1\|1250068_1251325_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	1.5e-48	31.9
WP_062731066.1\|1251430_1252300_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_062731091.1\|1252319_1252712_+	ribosome recycling factor	NA	NA	NA	NA
WP_062731065.1\|1252789_1253404_+	LysE family translocator	NA	NA	NA	NA
WP_017633576.1\|1253496_1254018_-	DUF2058 domain-containing protein	NA	NA	NA	NA
WP_054576152.1\|1254190_1255594_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	3.7e-19	26.1

DBSCAN-SWA_109

1260436 : 1265422

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155766.1\|1260436_1261870_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	3.5e-12	24.0
WP_158155768.1\|1261890_1262913_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_054574554.1\|1263044_1263806_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	1.5e-09	27.0
WP_158155770.1\|1263846_1264359_+	2,4'-dihydroxyacetophenone dioxygenase	NA	NA	NA	NA
WP_065275159.1\|1264363_1265422_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	1.3e-11	25.8

DBSCAN-SWA_110

1272470 : 1274039

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064369387.1\|1272470_1274039_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.4e-53	35.7

DBSCAN-SWA_111

1286669 : 1288274

Tupanvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155786.1\|1286669_1288274_-	S8 family serine peptidase	A0A2K9L5T6	Tupanvirus	8.9e-33	41.9

DBSCAN-SWA_112

1299131 : 1311579

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155796.1\|1299131_1300118_-	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	5.5e-25	30.2
WP_158155798.1\|1300353_1301793_+	PTS transporter subunit EIIC	NA	NA	NA	NA
WP_158155800.1\|1301958_1302882_+	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_005373707.1\|1302913_1304368_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.7e-19	23.8
WP_005373705.1\|1304805_1305663_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_031778835.1\|1306846_1308016_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	7.8e-87	46.7
WP_005373701.1\|1308227_1308635_+	cell division protein DamX	NA	NA	NA	NA
WP_005373699.1\|1308685_1309159_-	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	43.1
WP_005373696.1\|1309285_1310302_-	adenosine deaminase	NA	NA	NA	NA
WP_005373694.1\|1310728_1310869_-	hypothetical protein	NA	NA	NA	NA
WP_005373692.1\|1310919_1311129_-	hypothetical protein	NA	NA	NA	NA
WP_005373691.1\|1311369_1311579_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-18	65.2

DBSCAN-SWA_113

1319490 : 1321502

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373675.1\|1319490_1320789_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.7e-21	29.0
WP_005373673.1\|1320788_1321502_-	response regulator	W8CYM9	Bacillus_phage	7.9e-34	34.4

DBSCAN-SWA_114

1324927 : 1330074

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373655.1\|1324927_1325584_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-37	38.4
WP_005385580.1\|1325942_1326560_-	cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase	A0A2I7SAF7	Vibrio_phage	3.4e-17	33.5
WP_158155805.1\|1326676_1328530_-	MFS transporter	NA	NA	NA	NA
WP_157621961.1\|1328528_1328636_+	hypothetical protein	NA	NA	NA	NA
WP_005373649.1\|1328676_1329435_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_017819864.1\|1329435_1330074_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.5e-12	34.9

DBSCAN-SWA_115

1335104 : 1336427

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155809.1\|1335104_1336427_-	AarF/ABC1/UbiB kinase family protein	G9E5W0	Micromonas_pusilla_virus	1.1e-20	28.9

DBSCAN-SWA_116

1342582 : 1343905

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373622.1\|1342582_1343905_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	1.1e-07	22.6

DBSCAN-SWA_117

1352466 : 1355103

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155823.1\|1352466_1355103_+	response regulator	A0A1V0SGX0	Hokovirus	1.0e-49	30.7

DBSCAN-SWA_118

1358208 : 1362530

Invertebrate_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373593.1\|1358208_1358526_+	hypothetical protein	W8W2G4	Invertebrate_iridovirus	1.1e-11	48.6
WP_005385634.1\|1358856_1359954_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_158155831.1\|1359953_1362530_+	response regulator	A0A1V0SGX0	Hokovirus	2.0e-50	34.6

DBSCAN-SWA_119

1367721 : 1368345

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155834.1\|1367721_1368345_+	methyltransferase domain-containing protein	A0A1B1IT46	uncultured_Mediterranean_phage	1.1e-07	32.4

DBSCAN-SWA_120

1372845 : 1376189

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373567.1\|1372845_1373748_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.4
WP_158155839.1\|1373806_1374073_-	hypothetical protein	NA	NA	NA	NA
WP_158155841.1\|1374088_1374709_-	LysE family transporter	NA	NA	NA	NA
WP_005373555.1\|1375448_1376189_+	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	7.8e-08	27.7

DBSCAN-SWA_121

1389903 : 1390368

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373515.1\|1389903_1390368_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.2e-24	41.7

DBSCAN-SWA_122

1395165 : 1407028

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767924.1\|1395165_1396935_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-24	29.6
WP_017635196.1\|1397035_1397449_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_017819896.1\|1397525_1398128_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_005373499.1\|1398216_1399209_-	OmpA family protein	NA	NA	NA	NA
WP_158155843.1\|1399668_1400721_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	2.0e-81	50.5
WP_155489962.1\|1400868_1402047_+	MFS transporter	NA	NA	NA	NA
WP_053304522.1\|1402256_1403819_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.4e-29	43.4
WP_053304521.1\|1403960_1405952_-	transketolase	NA	NA	NA	NA
WP_005373488.1\|1406077_1407028_-	transaldolase	M4SIN4	Cyanophage	1.1e-11	28.2

DBSCAN-SWA_123

1412416 : 1415352

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635207.1\|1412416_1413166_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	2.3e-07	33.6
WP_033906385.1\|1413175_1414411_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005373478.1\|1414698_1415352_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	3.4e-55	54.3

DBSCAN-SWA_124

1419070 : 1420488

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387686.1\|1419070_1419484_-	helix-turn-helix transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	3.1e-06	41.3
WP_065275196.1\|1419579_1420488_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	7.3e-08	28.8

DBSCAN-SWA_125

1424361 : 1425405

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373458.1\|1424361_1425405_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.0e-98	53.8

DBSCAN-SWA_126

1431198 : 1433944

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155853.1\|1431198_1432002_+	ATP-binding cassette domain-containing protein	F2Y2R6	Organic_Lake_phycodnavirus	2.4e-15	29.5
WP_158155855.1\|1432001_1432862_+	ferric iron reductase FhuF-like transporter family protein	NA	NA	NA	NA
WP_053349235.1\|1432969_1433944_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	2.0e-19	35.0

DBSCAN-SWA_127

1456049 : 1461854

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158156075.1\|1456049_1458728_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	1.8e-91	31.4
WP_005373415.1\|1459184_1459703_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_053307560.1\|1459775_1461854_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	3.6e-34	26.5

DBSCAN-SWA_128

1465906 : 1467907

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155863.1\|1465906_1467907_+	protein kinase	A0A1B1IUU3	uncultured_Mediterranean_phage	5.7e-13	30.2

DBSCAN-SWA_129

1493462 : 1495226

Burkholderia_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155879.1\|1493462_1494371_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.4e-11	29.9
WP_005373333.1\|1494506_1495226_+	SDR family oxidoreductase	W8CYX9	Bacillus_phage	1.9e-06	33.3

DBSCAN-SWA_130

1506593 : 1508624

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155885.1\|1506593_1508624_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	2.0e-21	24.6

DBSCAN-SWA_131

1512422 : 1513223

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373297.1\|1512422_1513223_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-13	25.0

DBSCAN-SWA_132

1518517 : 1525833

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373283.1\|1518517_1519339_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-14	28.1
WP_158155892.1\|1519348_1520551_+	AMP-binding protein	NA	NA	NA	NA
WP_047101308.1\|1520687_1521284_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_158155894.1\|1521580_1522339_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	5.7e-14	28.6
WP_005373275.1\|1522335_1524039_-	acetolactate synthase AlsS	M4QSI1	Ostreococcus_lucimarinus_virus	6.3e-21	22.9
WP_005373273.1\|1524068_1524854_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_005373271.1\|1524951_1525833_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.0e-06	38.5

DBSCAN-SWA_133

1533793 : 1539213

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155903.1\|1533793_1534696_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	3.2e-48	39.5
WP_158156077.1\|1534676_1536764_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_158155905.1\|1536717_1537521_-	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_158155907.1\|1537605_1539213_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.6e-19	66.7

DBSCAN-SWA_134

1547115 : 1566378

Escherichia_phage(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155917.1\|1547115_1548012_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	4.1e-27	28.9
WP_033906450.1\|1548021_1548780_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_158156079.1\|1549242_1551264_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.8e-18	40.3
WP_017820329.1\|1551869_1552469_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_158155919.1\|1552487_1553948_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_158155921.1\|1554129_1555845_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	8.0e-56	30.3
WP_005382646.1\|1555881_1556820_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005392552.1\|1556895_1557738_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_017633664.1\|1557740_1558919_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-25	33.2
WP_155486724.1\|1559015_1559750_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_104976160.1\|1559915_1560350_+	globin	NA	NA	NA	NA
WP_005373196.1\|1560391_1561174_-	slipin family protein	A0A2K9L3L2	Tupanvirus	2.8e-24	29.9
WP_158155923.1\|1561184_1562561_-	nodulation protein NfeD	NA	NA	NA	NA
WP_005373180.1\|1563059_1564028_+	c-type cytochrome	NA	NA	NA	NA
WP_158155925.1\|1564020_1566378_+	response regulator	A0A1V0SGX0	Hokovirus	1.4e-55	35.4

DBSCAN-SWA_135

1579645 : 1591828

Enterobacteria_phage(28.57%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054574641.1\|1579645_1581151_+	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	1.2e-18	27.8
WP_005382618.1\|1581147_1582131_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_005373143.1\|1582218_1583097_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	7.3e-05	23.1
WP_158155929.1\|1583333_1584251_+	ribokinase	NA	NA	NA	NA
WP_158155931.1\|1584286_1585309_+	substrate-binding domain-containing protein	C6ZCU4	Enterobacteria_phage	6.3e-32	29.3
WP_025767870.1\|1585808_1586540_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	2.6e-24	33.6
WP_017635382.1\|1586550_1587282_+	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	3.6e-05	31.3
WP_158155933.1\|1587416_1588097_+	cyclic nucleotide-binding domain-containing protein	NA	NA	NA	NA
WP_005376635.1\|1588260_1589169_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158155936.1\|1589191_1590127_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	4.5e-69	42.9
WP_005376631.1\|1590119_1591070_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_158155938.1\|1591072_1591828_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-14	26.6

DBSCAN-SWA_136

1595837 : 1596089

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376619.1\|1595837_1596089_-	membrane protein	A0A248SJ16	Salicola_phage	2.1e-05	38.9

DBSCAN-SWA_137

1619035 : 1625759

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_138940154.1\|1619035_1621105_+	DNA helicase IV	A7KV33	Bacillus_phage	1.3e-20	25.9
WP_005376571.1\|1621182_1621638_-	methylglyoxal synthase	NA	NA	NA	NA
WP_158155946.1\|1621702_1622707_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_005376567.1\|1622795_1625759_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	3.3e-49	33.6

DBSCAN-SWA_138

1629147 : 1635832

Tetraselmis_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376560.1\|1629147_1630695_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	4.2e-165	57.4
WP_031777146.1\|1630829_1631699_-	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017635363.1\|1631828_1633355_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	2.0e-135	52.9
WP_115386602.1\|1633461_1634763_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_005376549.1\|1634848_1635832_+	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	1.5e-06	24.3

DBSCAN-SWA_139

1641519 : 1643934

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376542.1\|1641519_1641945_+	riboflavin-specific deaminase	A0A1V0SE20	Indivirus	2.0e-24	50.4
WP_017635357.1\|1642093_1643023_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017635356.1\|1643031_1643934_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	3.7e-12	30.3

DBSCAN-SWA_140

1650854 : 1655916

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821552.1\|1650854_1651979_-	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.2e-31	31.8
WP_005376525.1\|1652250_1652799_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025767847.1\|1652889_1653507_-	HAD family phosphatase	NA	NA	NA	NA
WP_025767846.1\|1653870_1655916_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.0e-09	31.6

DBSCAN-SWA_141

1658930 : 1669035

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155958.1\|1658930_1662596_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	8.5e-31	36.2
WP_064354730.1\|1662579_1663746_+	EAL domain-containing protein	NA	NA	NA	NA
WP_017635347.1\|1663738_1664335_+	response regulator transcription factor	NA	NA	NA	NA
WP_053349159.1\|1664344_1665715_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.1e-10	30.3
WP_158155960.1\|1665872_1666760_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_104976136.1\|1666761_1667382_-	response regulator transcription factor	NA	NA	NA	NA
WP_025998672.1\|1668054_1669035_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	4.6e-133	74.1

DBSCAN-SWA_142

1684989 : 1686840

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155970.1\|1684989_1686840_-	acyltransferase family protein	B5WZU0	Pseudomonas_phage	1.4e-58	29.4

DBSCAN-SWA_143

1692751 : 1693339

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158156083.1\|1692751_1693339_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	1.7e-10	38.4

DBSCAN-SWA_144

1697712 : 1698219

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635324.1\|1697712_1698219_+	peptide deformylase	E3SLL2	Synechococcus_phage	9.0e-16	41.8

DBSCAN-SWA_145

1703357 : 1705909

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767818.1\|1703357_1705118_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.8e-63	31.6
WP_148299856.1\|1705264_1705909_-	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	6.3e-22	38.0

DBSCAN-SWA_146

1710509 : 1711706

Prochlorococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158155990.1\|1710509_1711706_-	lipase family protein	Q58MF5	Prochlorococcus_phage	2.1e-10	34.4

DBSCAN-SWA_147

1718713 : 1723434

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042520777.1\|1718713_1721578_-	aminomethyl-transferring glycine dehydrogenase	E3SN07	Prochlorococcus_phage	1.9e-272	52.2
WP_005376432.1\|1721704_1722085_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005376430.1\|1722138_1723434_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.9e-104	52.6

DBSCAN-SWA_148

1728909 : 1731969

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005386052.1\|1728909_1731969_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	4.7e-51	22.1

DBSCAN-SWA_149

1743538 : 1744273

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158156003.1\|1743538_1744273_-	ATP-binding cassette domain-containing protein	G9BWD6	Planktothrix_phage	8.8e-28	35.8

DBSCAN-SWA_150

1747914 : 1752391

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158156005.1\|1747914_1751076_+	chitinase	A0A2K9KZQ8	Tupanvirus	3.9e-24	25.9
WP_025767797.1\|1751173_1752391_-	glucose-1-phosphate adenylyltransferase	I7I009	Enterobacteria_phage	4.0e-09	25.0

DBSCAN-SWA_151

1756451 : 1762801

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005397614.1\|1756451_1756922_-	CreA family protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	42.5
WP_158156009.1\|1757067_1757598_+	flavodoxin	NA	NA	NA	NA
WP_158156011.1\|1757772_1758441_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_158156014.1\|1758871_1760302_-	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	61.7
WP_081442502.1\|1760685_1760790_+	hypothetical protein	NA	NA	NA	NA
WP_158156016.1\|1760871_1761474_+	DUF479 domain-containing protein	NA	NA	NA	NA
WP_158156018.1\|1761529_1762801_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-53	33.9

DBSCAN-SWA_152

1774069 : 1775089

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017820941.1\|1774069_1775089_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	3.1e-39	39.8

DBSCAN-SWA_153

1786965 : 1787805

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376329.1\|1786965_1787805_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	1.6e-09	39.4

DBSCAN-SWA_154

1794336 : 1795029

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376323.1\|1794336_1795029_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-21	31.2

DBSCAN-SWA_155

1801995 : 1805025

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_085569032.1\|1801995_1803954_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-27	40.7
WP_085569031.1\|1804008_1805025_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.0e-79	45.6

DBSCAN-SWA_156

1820090 : 1820753

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376251.1\|1820090_1820753_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-27	33.6

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046807

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 12455

Escherichia_phage(50.0%)

tail

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634054.1\|2641_3268_-	hypothetical protein	O21969	Escherichia_phage	6.3e-19	37.3
WP_136976912.1\|3260_3674_-	hypothetical protein	A0A077SK09	Escherichia_phage	9.6e-08	35.8
WP_017634052.1\|3670_3994_-	hypothetical protein	Q37876	Escherichia_phage	4.1e-06	36.4
WP_158157458.1\|4395_7023_-	hypothetical protein	A0A0D4DBD6	Vibrio_phage	2.0e-58	50.0
WP_048626751.1\|7113_8232_-	hypothetical protein	A0A1B0XUH9	Freshwater_phage	1.1e-18	33.1
WP_158157460.1\|8304_9564_-	hypothetical protein	X2L0B8	Vibrio_phage	2.5e-06	34.2
WP_158157462.1\|9563_10025_-	hypothetical protein	NA	NA	NA	NA
WP_158157464.1\|10082_10955_-\|tail	phage tail protein	A0A077SLH5	Escherichia_phage	2.1e-36	40.3
WP_158157466.1\|11054_12455_-	hypothetical protein	A0A1B0VAD6	Salmonella_phage	2.7e-70	34.0

DBSCAN-SWA_2

15603 : 17191

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158157470.1\|15603_16416_-	hypothetical protein	A0A222YZ63	Escherichia_phage	2.1e-46	39.0
WP_054866402.1\|16415_16931_-	hypothetical protein	A0A222YY05	Escherichia_phage	7.8e-31	40.4
WP_079878291.1\|16942_17191_-	hypothetical protein	Q71TN7	Escherichia_phage	2.3e-12	45.7

DBSCAN-SWA_3

25482 : 27471

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_079771639.1\|25482_25638_-	hypothetical protein	R9TPW0	Vibrio_phage	3.7e-21	88.2
WP_031848075.1\|25998_27471_-	group II intron reverse transcriptase/maturase	A0A0U4J920	Pseudomonas_phage	2.0e-127	48.8

DBSCAN-SWA_4

53574 : 66400

Escherichia_phage(54.55%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158157501.1\|53574_54906_+	Fic family protein	A0A1V0E025	Clostridioides_phage	2.8e-24	31.2
WP_042522736.1\|54971_55469_-	hypothetical protein	A0A222YWE4	Escherichia_phage	8.0e-33	44.5
WP_017635635.1\|55482_56091_-	hypothetical protein	Q1MVJ8	Enterobacteria_phage	1.8e-23	34.2
WP_104968932.1\|56100_56769_-	hypothetical protein	A0A222YXT7	Escherichia_phage	4.0e-11	36.5
WP_104968931.1\|56790_58365_-	hypothetical protein	Q71TB2	Escherichia_phage	7.0e-107	41.4
WP_048626780.1\|58357_58789_-	hypothetical protein	NA	NA	NA	NA
WP_048626781.1\|58835_60485_-	hypothetical protein	A0A222YWC7	Escherichia_phage	2.0e-64	32.0
WP_048626782.1\|60767_61118_-	hypothetical protein	NA	NA	NA	NA
WP_048626783.1\|61117_61669_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7RXW8	Vibrio_phage	3.2e-30	45.7
WP_155489464.1\|61902_62064_-	hypothetical protein	NA	NA	NA	NA
WP_158157503.1\|62294_63059_-	hypothetical protein	NA	NA	NA	NA
WP_042522745.1\|63068_63353_-	hypothetical protein	Q1MVI7	Enterobacteria_phage	1.2e-06	34.4
WP_033905460.1\|63359_64130_-	hypothetical protein	A0A222YWF1	Escherichia_phage	1.2e-19	37.7
WP_048626786.1\|64126_65104_-	hypothetical protein	A0A222YXZ0	Escherichia_phage	1.2e-32	28.2
WP_048626787.1\|65096_65858_-	hypothetical protein	NA	NA	NA	NA
WP_048626788.1\|65860_66400_-	hypothetical protein	A0A1C9LW11	Vibrio_phage	3.3e-08	33.3

DBSCAN-SWA_5

72449 : 77085

Bacillus_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053084259.1\|72449_73934_+	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.2e-20	37.4
WP_048626797.1\|74564_75596_-\|transposase	IS110 family transposase	NA	NA	NA	NA
WP_048626798.1\|76872_77085_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	3.3e-20	68.7

DBSCAN-SWA_6

80606 : 81950

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025553174.1\|80606_81950_+	Na+/H+ antiporter NhaA	A0A2H4J5W3	uncultured_Caudovirales_phage	2.1e-56	35.0

DBSCAN-SWA_7

84994 : 85207

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005378997.1\|84994_85207_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.8e-19	65.7

DBSCAN-SWA_8

91890 : 100094

Escherichia_phage(62.5%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158157508.1\|91890_93480_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	1.3e-20	41.3
WP_048626719.1\|93860_95360_+	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_048626720.1\|95440_95953_-	hypothetical protein	A0A222YXU3	Escherichia_phage	2.3e-35	47.4
WP_048626721.1\|95949_97101_-	hypothetical protein	Q71T88	Escherichia_phage	5.2e-75	49.4
WP_024703879.1\|97104_97428_-	hypothetical protein	A0A222YYR0	Escherichia_phage	1.4e-14	40.2
WP_048626722.1\|97420_98053_-	hypothetical protein	A0A222YZ79	Escherichia_phage	4.9e-19	30.6
WP_048626723.1\|98150_98756_-	hypothetical protein	A0A222YXV2	Escherichia_phage	1.1e-31	58.3
WP_104968909.1\|98900_99089_-	hypothetical protein	NA	NA	NA	NA
WP_053084258.1\|99097_99619_-	PadR family transcriptional regulator	K7R9C0	Vibrio_phage	1.4e-11	33.3
WP_048626724.1\|99635_100094_-	hypothetical protein	M4M9K3	Vibrio_phage	8.1e-56	69.7

DBSCAN-SWA_9

104507 : 104717

Lactococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634094.1\|104507_104717_-	cold-shock protein	Q9AZD3	Lactococcus_phage	2.0e-14	62.3

DBSCAN-SWA_10

110744 : 112241

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_048626734.1\|110744_112241_-	hypothetical protein	Q71T61	Escherichia_phage	8.0e-153	57.1

DBSCAN-SWA_11

116669 : 121570

Vibrio_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033905411.1\|116669_117155_-	hypothetical protein	I1VXG0	Halocynthia_phage	4.6e-09	29.8
WP_050550054.1\|117169_117808_-	hypothetical protein	A0A2I7RNS2	Vibrio_phage	1.6e-54	51.2
WP_017634081.1\|117785_118028_-	hypothetical protein	NA	NA	NA	NA
WP_033905412.1\|118020_118317_-	hypothetical protein	NA	NA	NA	NA
WP_033905413.1\|118316_118640_-	hypothetical protein	M4SRV7	Rhodobacter_phage	1.7e-07	40.5
WP_017634078.1\|118618_118888_-	hypothetical protein	NA	NA	NA	NA
WP_017634077.1\|119007_119706_-	hypothetical protein	NA	NA	NA	NA
WP_048626743.1\|119732_120461_-	VRR-NUC domain-containing protein	Q71T85	Escherichia_phage	3.7e-18	40.4
WP_033905414.1\|120775_121075_-	hypothetical protein	NA	NA	NA	NA
WP_033905415.1\|121078_121570_-	single-stranded DNA-binding protein	R9TR60	Vibrio_phage	3.4e-60	72.3

DBSCAN-SWA_12

127651 : 139303

Escherichia_phage(28.57%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042522720.1\|127651_128605_-	hypothetical protein	A0A1B0V7I1	Salmonella_phage	3.9e-60	39.6
WP_053307334.1\|128618_130292_-	hypothetical protein	Q71TR7	Escherichia_phage	5.5e-110	40.0
WP_053307335.1\|130904_131093_+	hypothetical protein	NA	NA	NA	NA
WP_053307336.1\|131086_131413_+	hypothetical protein	NA	NA	NA	NA
WP_158157518.1\|131539_132757_+	hypothetical protein	NA	NA	NA	NA
WP_155484615.1\|132795_132966_+	hypothetical protein	NA	NA	NA	NA
WP_033905390.1\|133048_134227_-\|transposase	IS200/IS605 family element transposase accessory protein TnpB	O80301	Enterobacteria_phage	1.2e-119	65.2
WP_053307377.1\|134285_134702_+\|transposase	IS200/IS605 family transposase	I4AZM1	Saccharomonospora_phage	2.6e-37	55.1
WP_053307338.1\|134825_135026_+	hypothetical protein	NA	NA	NA	NA
WP_017634062.1\|135480_135720_+	hypothetical protein	NA	NA	NA	NA
WP_017634061.1\|135723_136497_+	ParA family protein	F0PIG8	Enterococcus_phage	1.9e-12	26.3
WP_053307339.1\|136493_137411_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	2.5e-08	35.4
WP_053307340.1\|137432_137765_-	hypothetical protein	NA	NA	NA	NA
WP_158157520.1\|137857_139303_-	hypothetical protein	Q71TE6	Escherichia_phage	9.2e-146	59.8

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046806

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046805

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046807

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection