CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number
NZ_CP046814	Vibrio alginolyticus strain 2010V-1102 chromosome 1, complete sequence	1 crisprs	DEDDh,csa3,cas3,DinG,cas5f,cas7f,cas6f,csx1	2	1	4
NZ_CP046813	Vibrio alginolyticus strain 2010V-1102 chromosome 2, complete sequence	0 crisprs	DEDDh,csa3,cas3,WYL	0	0	154
NZ_CP046812	Vibrio alginolyticus strain 2010V-1102 chromosome 3, complete sequence	0 crisprs	NA	0	0	3

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046814_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046814_1

3166682-3166928

Orphan

Consensus_repeat	Method
TAATGCCTCCTTAGCTCAGTAGGTAGAGCAACGGACTGATAATCCG	PILER-CR

2 spacers

The CRISPR arrays of NZ_CP046814_1

>merge|NZ_CP046814|1|3166682-3166928|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAGGTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTTTGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGTGTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAATTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

>NZ_CP046814|1|1|3166682-3166928|PILER-CR
TGCCGACTTAGCTCAGTAGGTAGAGCAACTGACTTGTAATCAGTAG	GTCACCAGTTCGATTCCGGTAGTCGGCACCATTCTTT
TGCCTCGATAGCTCAGTCGGTAGAGCAGAGGATTGAAAATCCTCGT	GTCGGTGGTTCGATTCCGCCTCGAGGCACCATATCTGGTGCACTTGCTTCATAAGCAAGACACAAAAAAGAATAA
TTCCTCCTTAGCTCAGTTGGTAGAGCGACGGACTGTTAATCCG

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046814.1\|WP_005381007.1\|3160515_3161436_-\|glutaminase-B	unknown	unknown	gnl\|CDD\|234880
NZ_CP046814.1\|WP_017821842.1\|3184961_3186245_+\|polysaccharide-deacetylase-family-protein	unknown	unknown	gnl\|CDD\|200570
NZ_CP046814.1\|WP_158159781.1\|3181288_3182611_-\|6-phospho-beta-glucosidase	unknown	unknown	gnl\|CDD\|133432
NZ_CP046814.1\|WP_053350813.1\|3169851_3171285_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	unknown	unknown	gnl\|CDD\|143421
NZ_CP046814.1\|WP_005381031.1\|3179411_3180410_-\|LacI-family-DNA-binding-transcriptional-regulator	unknown	unknown	gnl\|CDD\|380494
NZ_CP046814.1\|WP_158159779.1\|3167237_3168863_+\|methyl-accepting-chemotaxis-protein	unknown	unknown	gnl\|CDD\|223910
NZ_CP046814.1\|WP_005384509.1\|3161534_3162563_-\|DNA-methylase	unknown	unknown	gnl\|CDD\|223971
NZ_CP046814.1\|WP_005381011.1\|3157656_3157947_+\|YggU-family-protein	unknown	unknown	gnl\|CDD\|179931
NZ_CP046814.1\|WP_005381002.1\|3164599_3164872_+\|oxidative-damage-protection-protein	unknown	unknown	gnl\|CDD\|180059
NZ_CP046814.1\|WP_017635575.1\|3163503_3164580_+\|A/G-specific-adenine-glycosylase	unknown	unknown	gnl\|CDD\|182805
NZ_CP046814.1\|WP_031777269.1\|3182623_3182935_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	unknown	unknown	gnl\|CDD\|224364
NZ_CP046814.1\|WP_005384506.1\|3162580_3163300_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	unknown	unknown	gnl\|CDD\|234649
NZ_CP046814.1\|WP_005381001.1\|3164949_3166089_+\|membrane-bound-lytic-murein-transglycosylase-MltC	unknown	unknown	gnl\|CDD\|183271
NZ_CP046814.1\|WP_042521300.1\|3159246_3160425_+\|radical-SAM-family-heme-chaperone-HemW	unknown	unknown	gnl\|CDD\|235550
NZ_CP046814.1\|WP_020480920.1\|3184408_3184714_-\|PTS-sugar-transporter-subunit-IIB	unknown	unknown	gnl\|CDD\|99906
NZ_CP046814.1\|WP_158159780.1\|3178027_3179281_-\|DUF3391-domain-containing-protein	unknown	unknown	gnl\|CDD\|225116
NZ_CP046814.1\|WP_053350811.1\|3158075_3158507_+\|DUF4426-domain-containing-protein	unknown	unknown	gnl\|CDD\|379616
NZ_CP046814.1\|WP_006743095.1\|3158625_3159228_+\|XTP/dITP-diphosphatase	unknown	unknown	gnl\|CDD\|234648
NZ_CP046814.1\|WP_005385544.1\|3182986_3184330_-\|PTS-sugar-transporter-subunit-IIC	unknown	unknown	gnl\|CDD\|224372
NZ_CP046814.1\|WP_138939840.1\|3180514_3181270_-\|chitin-disaccharide-deacetylase	unknown	unknown	gnl\|CDD\|235007

Protein	Function_ID	Function_description	E-value
NZ_CP046814.1\|WP_005381007.1\|3160515_3161436_-\|glutaminase-B	gnl\|CDD\|234880	PRK00971, PRK00971, glutaminase; Provisional.	0
NZ_CP046814.1\|WP_017821842.1\|3184961_3186245_+\|polysaccharide-deacetylase-family-protein	gnl\|CDD\|200570	cd10946, CE4_Mll8295_like, Putative catalytic NodB homology domain of uncharacterized Mll8295 protein encoded from Rhizobium loti and its bacterial homologs. This family is represented by a putative polysaccharide deacetylase Mll8295 encoded from Rhizobium loti. Although its biological function still remains unknown, Mll8295 shows high sequence homology to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), which is an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Both Mll8295 and SpPgdA belong to the carbohydrate esterase 4 (CE4) superfamily. This family also includes many uncharacterized bacterial polysaccharide deacetylases.	3.64002e-70
NZ_CP046814.1\|WP_158159781.1\|3181288_3182611_-\|6-phospho-beta-glucosidase	gnl\|CDD\|133432	cd05296, GH4_P_beta_glucosidase, Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.	0
NZ_CP046814.1\|WP_053350813.1\|3169851_3171285_-\|NAD-dependent-succinate-semialdehyde-dehydrogenase	gnl\|CDD\|143421	cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like. Succinate-semialdehyde dehydrogenase, mitochondrial (SSADH, GabD, EC=1.2.1.24) catalyzes the NAD+-dependent oxidation of succinate semialdehyde (SSA) to succinate. This group includes the human aldehyde dehydrogenase family 5 member A1 (ALDH5A1) which is a mitochondrial homotetramer that converts SSA to succinate in the last step of 4-aminobutyric acid (GABA) catabolism. This CD also includes the Arabidopsis SSADH gene product ALDH5F1. Mutations in this gene result in the accumulation of H2O2, suggesting a role in plant defense against the environmental stress of elevated reactive oxygen species.	0
NZ_CP046814.1\|WP_005381031.1\|3179411_3180410_-\|LacI-family-DNA-binding-transcriptional-regulator	gnl\|CDD\|380494	cd06270, PBP1_GalS-like, ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism. Transcription of the galactose regulon genes is regulated by Gal iso-repressor (GalS) and Gal repressor (GalR) in different ways, but both repressors recognize the same DNA binding site in the absence of D-galactose. GalS is a dimeric protein like GalR,and its major role is in regulating expression of the high-affinity galactose transporter encoded by the mgl operon, whereas GalR is the exclusive regulator of galactose permease, the low-affinity galactose transporter. GalS and GalR are members of the LacI-GalR family of transcription regulators and both contain the type 1 periplasmic binding protein-like fold. Hence, they are homologous to the periplasmic sugar binding of ABC-type transport systems.	2.30744e-113
NZ_CP046814.1\|WP_158159779.1\|3167237_3168863_+\|methyl-accepting-chemotaxis-protein	gnl\|CDD\|223910	COG0840, Tar, Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms].	8.78206e-62
NZ_CP046814.1\|WP_005384509.1\|3161534_3162563_-\|DNA-methylase	gnl\|CDD\|223971	COG1041, COG1041, Predicted DNA modification methylase [DNA replication, recombination, and repair].	8.36224e-09
NZ_CP046814.1\|WP_005381011.1\|3157656_3157947_+\|YggU-family-protein	gnl\|CDD\|179931	PRK05090, PRK05090, hypothetical protein; Validated.	6.04131e-59
NZ_CP046814.1\|WP_005381002.1\|3164599_3164872_+\|oxidative-damage-protection-protein	gnl\|CDD\|180059	PRK05408, PRK05408, oxidative damage protection protein; Provisional.	2.80095e-59
NZ_CP046814.1\|WP_017635575.1\|3163503_3164580_+\|A/G-specific-adenine-glycosylase	gnl\|CDD\|182805	PRK10880, PRK10880, adenine DNA glycosylase.	0
NZ_CP046814.1\|WP_031777269.1\|3182623_3182935_-\|PTS-lactose/cellobiose-transporter-subunit-IIA	gnl\|CDD\|224364	COG1447, CelC, Phosphotransferase system cellobiose-specific component IIA [Carbohydrate transport and metabolism].	6.82212e-37
NZ_CP046814.1\|WP_005384506.1\|3162580_3163300_-\|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB	gnl\|CDD\|234649	PRK00121, trmB, tRNA (guanine-N(7)-)-methyltransferase; Reviewed.	1.04237e-109
NZ_CP046814.1\|WP_005381001.1\|3164949_3166089_+\|membrane-bound-lytic-murein-transglycosylase-MltC	gnl\|CDD\|183271	PRK11671, mltC, membrane-bound lytic murein transglycosylase MltC.	8.90498e-147
NZ_CP046814.1\|WP_042521300.1\|3159246_3160425_+\|radical-SAM-family-heme-chaperone-HemW	gnl\|CDD\|235550	PRK05660, PRK05660, radical SAM family heme chaperone HemW.	0
NZ_CP046814.1\|WP_020480920.1\|3184408_3184714_-\|PTS-sugar-transporter-subunit-IIB	gnl\|CDD\|99906	cd05564, PTS_IIB_chitobiose_lichenan, PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include chitobiose/lichenan, ascorbate, lactose, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.	8.28164e-46
NZ_CP046814.1\|WP_158159780.1\|3178027_3179281_-\|DUF3391-domain-containing-protein	gnl\|CDD\|225116	COG2206, COG2206, c-di-GMP phosphodiesterase class II (HD-GYP domain) [Signal transduction mechanisms].	2.49376e-72
NZ_CP046814.1\|WP_053350811.1\|3158075_3158507_+\|DUF4426-domain-containing-protein	gnl\|CDD\|379616	pfam14467, DUF4426, Domain of unknown function (DUF4426). Members of this entry are found mostly in g-proteobacteria, especially in Vibrio. Strangely enough, there seems to be one eukaryotic homolog in Nematostella vectensis (NEMVEDRAFT_v1g226006), where the PA0388-like domain is fused with a domain homogous to the Methionine biosynthesis protein MetW (see below). In several Pseudomonas species, but also in Vibrio vulnificus and Azotobacter vinelandii PA0388 homologs are genomic neighbors of Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15) and Methionine biosynthesis protein MetW. On the other hand, in most Vibrio species it appears as a part of a conserved operon involved in possible response to stress.	8.04551e-66
NZ_CP046814.1\|WP_006743095.1\|3158625_3159228_+\|XTP/dITP-diphosphatase	gnl\|CDD\|234648	PRK00120, PRK00120, dITP/XTP pyrophosphatase; Reviewed.	3.48429e-123
NZ_CP046814.1\|WP_005385544.1\|3182986_3184330_-\|PTS-sugar-transporter-subunit-IIC	gnl\|CDD\|224372	COG1455, CelB, Phosphotransferase system cellobiose-specific component IIC [Carbohydrate transport and metabolism].	3.32614e-153
NZ_CP046814.1\|WP_138939840.1\|3180514_3181270_-\|chitin-disaccharide-deacetylase	gnl\|CDD\|235007	PRK02134, PRK02134, chitin disaccharide deacetylase.	1.53125e-123

>NZ_CP046814.1|WP_005381001.1|3164949_3166089_+|membrane-bound-lytic-murein-transglycosylase-MltC
MKKIVFIAAALLMAGCSREFVEKIYDVNYEPTNRFANNLAELPGQFEKDTAALDALINSFSGNIQKRWGKKEIKYAGKSNYVKYIDNYLSRAEVDFRKGVITIETVSPTEPQKHLKDAIVTTLLTPDDPAHVDLFSSKGITLEGQPFLYKQVVDQDNKPIQWSWRANRFAEYLIANKIKTKNVDFKKAYYVEIPMVEDHFSTRSYQYADIVRRASKKYDIPEDLIYAIIKTESSFNPYAVSWANAYGLMQVVPKTAGRDVFKLVKKRSGQPSPEYLFNPENNIDTGTAYFYILKNRYLREVRHPTSLEYSMISAYNGGTGGVLNTFHRSDRKRAMQDLNSLQPNQVYWALTKKHPNAEARRYLEKVTNFKKEFNSKQTL
>NZ_CP046814.1|WP_005381002.1|3164599_3164872_+|oxidative-damage-protection-protein
MSRTVFCARLKKEGEGLDFQLYPGELGKRIFDNISKEAWAQWQHKQTMLINEKKLNMMDPEHRKLIETEMVNFLFEGKDVHIEGYTPPSE
>NZ_CP046814.1|WP_017635575.1|3163503_3164580_+|A/G-specific-adenine-glycosylase
MTPFASAILEWYDAYGRKDLPWQQNKTAYSVWLSEIMLQQTQVTTVIPYYQRFLERFPTVIDLANAEQDEVLHLWTGLGYYARARNLHKAAQEVASTYNGEFPLDIEKMNALPGIGRSTAAAILSSVYKQPHAILDGNVKRTLSRCFAVAGWPGQKKVENQLWEIAETHTPQTDVDKYNQAMMDMGAMVCTRSKPKCSLCPVADLCVAKQQGNVLDYPGKKPKKDKPIKQTRFVMLHHNTENGHEVWLEQRPQTGIWGGLFCFPQTEHVDAESDIELLLDQRGIQASNIKQKQTLITFRHTFSHYHLDITPILIDLSKQPDVIMEGNKGLWYNLSKPEEVGLAAPVKLLLETLPHELR
>NZ_CP046814.1|WP_005384506.1|3162580_3163300_-|tRNA-(guanosine(46)-N7)-methyltransferase-TrmB
MSEVTTNEYNEDGKLIRKIRSFVRREGRLTKGQESAMNECWPTMGIDFKAELLDWKEVFGNDNPVVLEIGFGMGASLVEMAKNAPEKNFIGIEVHSPGVGACLADAREAGITNLRVMCHDAVEVFEHMIPNGSLSTLQLFFPDPWHKKRHHKRRIVQLGFAEMVREKLIPNEGIFHMATDWENYAEHMIEVMNQAPGFENIAKDGDFVPRPDDRPLTKFEARGHRLGHGVWDIKYKRIA
>NZ_CP046814.1|WP_005384509.1|3161534_3162563_-|DNA-methylase
MYHYAILANPGHNRIYFDSAMTIACSELKAILASQGVDVTEIGSKDVGLPAALVFSCQEALTDEQARRIAASSIYYALFEVREDGLLRPVQAPVFNTFPESMSQILRYTGKTNEQFTRLMVNIGISASNTGSEQLTLMDPMCGKGTTLFEGLIHGLNVVGVEINAKWVQEIQTFIVKFMKNGRFKHKVSKEKRTAGGKKVADGFVVEAAANKEDYNQGNLQFMKLYSADTRIADQVVKKNSVDVMVSDLPYGVQHGSKNAKDSKLNRSPLELLKEALPAWKVVLKKQGSVVLSFNEFTLKWKDVAALFEEQGWKVLSEEPYIGYLHRVDQSINRNIIVAVKP
>NZ_CP046814.1|WP_005381007.1|3160515_3161436_-|glutaminase-B
MKPTVEILTDILAEVRPLIGQGKVADYIPALAKVPSNKLGIAVYTNEGEVIKAGDADEPFSIQSISKALSLTLAMCLYKQEEIWSRVGKEPSGQAFNSLIQLEMEQGIPRNPFINAGAIVVADLLQTRLSAPRQRLLEFVRQLSGDTHIVYDKVVAASEMMHGDRNAAIAYLMRSFGNFENEVIPVLQNYFHACALKMSCVDLAKTFSYLANKGTSVQTGKPVVSPVQTKQLNALLATCGLYDGAGEFAYRVGMPGKSGVGGGIIAVVPGEMTISVWSPELDPSGNSLAGTKALELLSERIGRSIF
>NZ_CP046814.1|WP_042521300.1|3159246_3160425_+|radical-SAM-family-heme-chaperone-HemW
MLTPPALSLYVHIPWCVQKCPYCDFNSHALKTEIPEEEYISALLEDLDTDIEKYRLNEAPRPLHSIFIGGGTPSLISAEGIERLLKGIEARIPFKPEIEITMEANPGTIEAERFVGYRKAGVTRISIGVQSFEQQKLERLGRIHGQDEAVNAAQLAHQIGLNSFNLDLMHGLPDQSIEQALADLDKAIELAPPHLSWYQLTIEPNTMFYYKPPTLPDDDDLWDIFELGHQKLAAAGYVQYEISGYSKPGYQCQHNLNYWRFGDYLGIGCGSHGKLSFTDGRIIRTTKVKHPRGYLAAYQNMVKPYLHTEHVVADEDRPFEFFMNRFRLIEACPKQDYVDTTGLPLSTIQETIDWAIEMGYLSETATHWQITEKGKLFLNDLLEAFMAEESEE
>NZ_CP046814.1|WP_006743095.1|3158625_3159228_+|XTP/dITP-diphosphatase
MKKIVLATGNQGKVREMADLLSDFGFEVLAQSEFNVSEVAETGTTFIENAIIKARHAAQETGLPAIADDSGLEVDFLKGAPGIYSARYAGESASDQENLEKLLAAMEGVPEAERTARFHCVLVLMRHENDPTPIVCHGKWEGRILTEAHGENGFGYDPIFFVPEDNCASAELEPARKKQLSHRGKALQSLFAQLSEQVSQ
>NZ_CP046814.1|WP_053350811.1|3158075_3158507_+|DUF4426-domain-containing-protein
MSKWITALLISLLSLPSFADQFKNMKDIEVHYVAFNSTFLSPKVARSYDIKRNGYLAVVNISVLDRASLGKPALEAKIAGRAKNLIGQTQTLTFREVKEGNAIYYLAELPITHEETFTFDIDVKAGNKGSGKLKFTQKFYVEE
>NZ_CP046814.1|WP_005381011.1|3157656_3157947_+|YggU-family-protein
MSAAVWQDGEDIILKLYIQPKASRDKIVGLHGEELKIAITAPPVDGKANAHLTKFLAKQFKIAKGLVHIEKGELGRHKQIRIESPTQIPTEIKAII
>NZ_CP046814.1|WP_158159779.1|3167237_3168863_+|methyl-accepting-chemotaxis-protein
MKLKTQAYLLSAIILLALLALTATGLWTLRVASNLDNKARVTELFKSAYSILTEVEKMAIEGKMPEDEAKALATRLLRNNIYKDNEYVYVADENMMFIAAPLDPQLHGTSFHDFRDGSGNSVGQLILDVLGHKTGQIVEYTWSQKQADGSIEEKHSIAEKTPHWGWVVGTGIGFNEVNARFWSTAQWQLALCLIIAGSILSGLIISIRKMLNLLGGEPNDVRKAVQAVAQGDIQTSFDTVAPRGSIYRAVQDMSQSLATMVTNLEKSMHALRAELFAVEARSNTIANLTVSQQQSTAMIATAMTEMASSANHVANSASDTANNTDEADKQSQHTQKLIHNTVENIQGLASQLNTASKAVADLDQDVNNIVKVLDVIGDIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRNLAGRTQDSTKEIQYMISNLQEGSRNAIHTMEICAETSESTVTESKNASEALQQIVTALESITTMSQQIATAAAEQTQVSDDIALRIKLIDESGGQLNSVVTESQSSTQSLASLANELEGWVNKFSVKH
>NZ_CP046814.1|WP_053350813.1|3169851_3171285_-|NAD-dependent-succinate-semialdehyde-dehydrogenase
MQQIKNETLKSVFKQWSSDEGIVVINPATEQELIRLKPSTLDELDDLIGQCKTEQVRWAKLSAKERSRRLRGWYQLLLDNAEDIATIITLEQGKPLAESKGEVMYGASFVEWFSEEAKRAYGEVIPAPTTDRRLSAIRQPVGVCAAITPWNFPIAMITRKAAPALAAGCGMLIKPSELTPLTAIAVVELAYQAGIPKELLSVVVSEQAAEFGQVLSTDPRIQKISFTGSTRVGKILMKQASDSVKAVSMELGGNAPFIVFEDADLDAASEGLVASKFRNAGQTCVCTNRLYVHKNVKQAFIDKVLSKLSKLKLGNGLEKGVTLGPVITMASKHRLEAVIDQAVQEGASIANSPQRRPGRFMEPVLLDSVTQNMSIVQQELFGPVLPIVTFENDDQVLEMANDTEYGLACYFYTNSLKRIVTFSEGLEYGMVGVNEGIISTEVAPFGGVKESGVGREGAKQGLDEYLETKYICLGGLS
>NZ_CP046814.1|WP_158159780.1|3178027_3179281_-|DUF3391-domain-containing-protein
MAAIKLTVDRIQPGLHIRLPLKWNDHPFLLNSFKIKDQEQVEMIRHLGVKFVYFNPEQSDAVPLPVDQRQADRVTNEASLDHETQKMWQEKQNRIEKLSAYRRRVIQCEKEFERSLARMRSVMTKIRNRPTAAVDEAKLLIEDIVEKLMCDDNVTLHLMNGKNEFEDIYFHSLNVAVISMMIGRAKGYSAAQLKELSFSALFHDIGKIKIPTAILRKQLPLTEPETNYLKLHTKYGVDLASQIEAFPEVARIVIAQHHELRDGSGYPKGLKGDEINEFAQIIAVANAFDNLCHTPIVSDQKIPYTALSHLYKNCKHLYKEENLNILIKFMGVFPPGTVVQLSNNMVGLVISVNASHLLFPNVLVYDPSVPRTQAPIIDLASKDIKIVNAIHPSKLPDKVEEYLNPRSRISYFFDSDE
>NZ_CP046814.1|WP_005381031.1|3179411_3180410_-|LacI-family-DNA-binding-transcriptional-regulator
MARIKDVAELAGVNRSTVSRIINGEGKFREETRKKVEQAMAQLNYRPSAIARSLATSSSNMVGLLVTYYTGGFFGEMMEQVQTELDIHKKFLITAQGHHSAQGEKEAIQRFNDLRCDGYVLHSRYLSDDDLRELAKQPTPFVLLDRYVEGIEERCVTFNHHHASRIAVEHLLAGGHRKIACIAGPSQRHNSVLRKLGYIDAMKDAGIDIDESWCEEGNYGRQSGYDAMAAILQRHPDVTAVFSCSEEMTVGAMQYLHEHSISVPEQISLTSFDSVDLCESLYPTVSAVHFPISDMARVAVQTLMGLVKDQEVIDKPVFEAKLKIRKADRSLK
>NZ_CP046814.1|WP_138939840.1|3180514_3181270_-|chitin-disaccharide-deacetylase
MKVIFNADDFGLTRGVNSGIVKAHQQGVVHSTTMMVGMDAEQHALELARHNPDLKVGVHLRFTAGVPITKHRNLTNGRAHFINYDELWSKQDFETQVVYDEAKAQVEHFLSLGLELSHLDSHHHAHTHPQILPVIKEVANEYRVPLRGTGLCQESMTIRYIFTDEFYDQKVSLDGLMAHLLSLKADYDLVEVMCHPAEADQALILKSGYALQRELELQVLTSPILKEQLAHHGITVTDYSELVSTNQMVSV
>NZ_CP046814.1|WP_158159781.1|3181288_3182611_-|6-phospho-beta-glucosidase
MSREAIKLAIIGGGSSYTPELVEGVIKRLEYLPVRKIHFVDIESGAEKLEIIKGLAQRMVDKSGAKIEIKAGFDRRAAIKDADFVMTQFRVGGLAARANDERIPIKYDVIGQETTGPGGFAKALRTIPVILDICKDIEELAPNAWMLNFTNPAGLVSEAVSKYTKVKSIGLCNVPVSMEMMIAEMMECEPKELQLEFAGLNHLVWVHKAWLNGEDITQTVLEKVGDGANFSMKNIWEEPWDPAFLKALGAIPCPYHRYFYQTDAMLAEEKQSADEKGTRAEQVMETENALFKLYQDPTLDHKPKELEERGGAYYSDASLNLVDSIYNNRNSIHVVNVLNNGAINGLPDDAVIECSAVIGSWGAKPLAVGELSNNIKGLLYQVKAYEQLTIEAAVEGNYDKALMALTNNPLVPDIGRAKSILDDILAVNAPYLPQFKLTTL
>NZ_CP046814.1|WP_031777269.1|3182623_3182935_-|PTS-lactose/cellobiose-transporter-subunit-IIA
MEQELVVMEIICNAGEARSLSYEALRLSREQDFEAADEKLSQARECINKAHLIQTQLIEEDQGEGKVPMTLVMVHAQDHLMTTILAQEMAVEIVALNKKISNK
>NZ_CP046814.1|WP_005385544.1|3182986_3184330_-|PTS-sugar-transporter-subunit-IIC
MDSMKLYDAIIGAVEKHIAPIAAKVGNQPHVRAMRDGFIVAMPFIIVGSFILIFAFPPFAEDTTFTFGRIWLDFATTHFDTIMMPYNMSMGIMTIFVSLGVAYSLAKAYKMDGITSAVLSLMSFLLIAAPAKDGALSMSHMGGTGIFTAVMCAFFSVELYRFMKKHNITIRMPEQVPPAIARSFEVLLPVLAIFITLYPLSLFVQTQYDMLIPDAVMAIFKPLISASNSLPAIIGALLLCQLLWFAGIHGAAIVVGLLSPIFLTNIGANIEAFVAGEPIPNVFTQPFWDFYIFIGGSGATLALVMLMSFSRSVHLKSIGRMSAVPGFFQINEPVIFGSPVVMNPTLFIPFVFAPVINATIAYFAVHVGFVGMGVATTPWTTPALIGASWGSGWTFAPVLLVIGLLILDLIIYFPFFKMFEKQMLEQELPTTKETKGDTQPSGEGVTA
>NZ_CP046814.1|WP_020480920.1|3184408_3184714_-|PTS-sugar-transporter-subunit-IIB
MKKILLCCSAGMSTSMLVKKMEQAAENKGIECKIDAMSVNAFEDVIKEYDVCLLGPQVRFQLEELRKTAQEHGKNIDAISPQHYGMMKGEEVLEQALELIN
>NZ_CP046814.1|WP_017821842.1|3184961_3186245_+|polysaccharide-deacetylase-family-protein
MKFNKLAIAALVSAALSQHSFAQTDSKGTIYLTFDDGPINASIDVIQVLNQEDIKATFYFNAWHLDGIGDENEDRSLEALKLALDTGHIVANHSYDHMVHNCVDEFGPNSAAECNATGDHQLNSYQDPVYDASMFTENLSVLAKYLPNITSYPNYKATEFARLPYTNGWRVTKDFKADGLCATSDDLKPWEPGYVCDTSNPSNSVKAAIEVQNILANNGYQTHGWDVDWAPENWGIEMPANSLTEAEAFLGYVDSALNTCAPTTINPINSKAQEFPCGTPLHADKVIVLTHEFLFEDGKRGMGATQNLPKLAKFIQLAKQAGYDFDTMDNYTPNWQVGHNYDAGDYVLHLGTVYQAVTNHTAQQDWAPSPTSSLWTNADPATNWTQNVSYKQGDVVTYQGLRYLVDVPHVSQADWTPNTQNTLFTAL

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP046814.1	3166374-3166410	0	1.0
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP046814.1	182349-182385	0	1.0
NZ_CP046814_1	1.2\|3166811\|75\|NZ_CP046814\|PILER-CR	3166811-3166885	75	NZ_CP046814.1	3166457-3166531	16	0.787

1. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to position: 3166374-3166410, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattc	Protospacer
*************************************

2. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to position: 182349-182385, mismatch: 0, identity: 1.0

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccattc	Protospacer
*************************************

3. spacer 1.2|3166811|75|NZ_CP046814|PILER-CR matches to position: 3166457-3166531, mismatch: 16, identity: 0.787

cgtgtcggtggttcgattccgcctcgaggcaccatatctggtgcacttgcttcataagca	CRISPR spacer
cgtgtcggtggttcgattccgcctcgaggcaccatatttggtgcacttgcttcataagca	Protospacer
*************************************.**********************

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP041417	Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence	296499-296535	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_LN868946	Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence	103821-103857	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	1164-1200	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	KU052038	Escherichia phage SerU-LTIIb, partial genome	3070-3106	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	LN997803	Escherichia coli phage phi467	15126-15162	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP022660	Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence	52078-52114	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP045061	Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence	52084-52120	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP045054	Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence	52089-52125	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP045058	Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence	52088-52124	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NC_021742	Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence	35428-35464	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	MH791411	UNVERIFIED: Escherichia phage Ecwhy_1, complete genome	13645-13681	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	MH494197	Escherichia phage CMSTMSU, complete genome	196772-196808	2	0.946
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP023526	Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence	1927-1963	3	0.919
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NZ_CP054057	Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence	85817-85853	3	0.919
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	KY653118	Morganella phage IME1369_01, complete genome	698-734	4	0.892
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	LC494302	Escherichia phage SP27 DNA, complete genome	76611-76647	5	0.865
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	LT603033	Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I	17117-17153	5	0.865
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NC_027364	Escherichia phage PBECO 4, complete genome	207832-207868	5	0.865
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	NC_049942	Escherichia phage JLK-2012, complete sequence	23524-23560	5	0.865
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	MK817115	Escherichia phage vB_EcoM_phAPEC6, complete genome	52945-52981	6	0.838
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	MH383160	Escherichia phage UB, complete genome	272124-272160	6	0.838
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	MK327931	Escherichia phage vB_EcoM_G17, complete genome	77929-77965	6	0.838
NZ_CP046814_1	1.1\|3166728\|37\|NZ_CP046814\|PILER-CR	3166728-3166764	37	KM507819	Escherichia phage 121Q, complete genome	77938-77974	7	0.811

1. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP041417 (Escherichia coli strain STEC711 plasmid pSTEC711_1, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

2. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_LN868946 (Salmonella enterica subsp. enterica serovar Senftenberg strain NCTC10384 plasmid 4, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatca	Protospacer
***********************************.

3. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

4. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to KU052038 (Escherichia phage SerU-LTIIb, partial genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

5. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to LN997803 (Escherichia coli phage phi467) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccatat	Protospacer
*********************************** .

6. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP022660 (Salmonella enterica subsp. enterica strain RM11060 plasmid pRM11060-2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

7. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP045061 (Salmonella enterica subsp. enterica serovar Muenchen strain LG26 plasmid pLG26p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

8. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP045054 (Salmonella enterica subsp. enterica serovar Muenchen strain LG24 plasmid pLG24p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

9. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP045058 (Salmonella enterica subsp. enterica serovar Muenchen strain LG25 plasmid pLG25p2, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccactt	Protospacer
**********************************.*.

10. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NC_021742 (Serratia liquefaciens ATCC 27592 plasmid unnamed, complete sequence) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagccggcaccaatc	Protospacer
*************************.******** **

11. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to MH791411 (UNVERIFIED: Escherichia phage Ecwhy_1, complete genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * **

12. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to MH494197 (Escherichia phage CMSTMSU, complete genome) position: , mismatch: 2, identity: 0.946

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcacaaatc	Protospacer
******************************** * **

13. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP023526 (Cedecea neteri strain FDAARGOS_392 plasmid unnamed, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccagaa	Protospacer
**********************************

14. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NZ_CP054057 (Scandinavium goeteborgense strain CCUG 66741 plasmid pSg66741_1, complete sequence) position: , mismatch: 3, identity: 0.919

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgattccggtagtcggcaccaaat	Protospacer
**********************************  .

15. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to KY653118 (Morganella phage IME1369_01, complete genome) position: , mismatch: 4, identity: 0.892

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
taggtcaccagttcgactccggtagccggcaccatat	Protospacer
****************.********.********* .

16. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to LC494302 (Escherichia phage SP27 DNA, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

17. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to LT603033 (Escherichia phage vB_Eco_slurp01 genome assembly, chromosome: I) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

18. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NC_027364 (Escherichia phage PBECO 4, complete genome) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aaggtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 ******************************* *  .

19. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to NC_049942 (Escherichia phage JLK-2012, complete sequence) position: , mismatch: 5, identity: 0.865

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
caggtcgccagttcgattccggtagccggcaccatat	Protospacer
.*****.******************.********* .

20. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to MK817115 (Escherichia phage vB_EcoM_phAPEC6, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

21. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to MH383160 (Escherichia phage UB, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

22. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to MK327931 (Escherichia phage vB_EcoM_G17, complete genome) position: , mismatch: 6, identity: 0.838

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcgattccggtagtcggcacaaaat	Protospacer
 * ***************************** *  .

23. spacer 1.1|3166728|37|NZ_CP046814|PILER-CR matches to KM507819 (Escherichia phage 121Q, complete genome) position: , mismatch: 7, identity: 0.811

taggtcaccagttcgattccggtagtcggcaccattc	CRISPR spacer
aatgtcaccagttcaattccggtagtcggcacaaaat	Protospacer
 * ***********.***************** *  .

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1043333 : 1050117

Staphylococcus_phage(50.0%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383771.1\|1043333_1044473_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	4.5e-63	42.0
WP_053350266.1\|1044490_1045741_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.5e-99	48.5
WP_005381578.1\|1045947_1046397_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_053350267.1\|1046404_1047532_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	1.9e-45	34.8
WP_053306528.1\|1047540_1048194_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	8.9e-32	36.1
WP_005381573.1\|1048367_1049477_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.2e-65	39.8
WP_005381572.1\|1049646_1050117_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	48.7

DBSCAN-SWA_2

1515215 : 1524984

Mycobacterium_phage(16.67%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730708.1\|1515215_1518263_+	hypothetical protein	A0A218M9A2	Mycobacterium_phage	1.3e-88	48.0
WP_005388103.1\|1518324_1518951_+	outer membrane lipoprotein chaperone LolA	NA	NA	NA	NA
WP_053349536.1\|1518957_1520307_+	replication-associated recombination protein A	G3MBE0	Bacillus_virus	1.1e-84	42.9
WP_005437179.1\|1520398_1521706_+\|tRNA	serine--tRNA ligase	A0A1B1IVT2	uncultured_Mediterranean_phage	7.6e-91	42.8
WP_053349493.1\|1521909_1522812_+	DUF3380 domain-containing protein	A0A291LBS7	Pseudomonas_phage	1.4e-35	42.9
WP_053349537.1\|1522801_1523230_+	hypothetical protein	NA	NA	NA	NA
WP_053349494.1\|1523367_1523634_+	DksA/TraR family C4-type zinc finger protein	A0A1S6UBD1	Serratia_phage	8.1e-16	46.6
WP_033905079.1\|1523703_1524984_-	adenosylmethionine--8-amino-7-oxononanoate transaminase	A0A1V0SKB7	Klosneuvirus	2.1e-21	25.6

DBSCAN-SWA_3

2596462 : 2620549

Vibrio_phage(93.33%)

tail,head,capsid,terminase,portal

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_078230707.1\|2596462_2596660_-	hypothetical protein	A0A2I7RNJ8	Vibrio_phage	1.3e-15	68.8
WP_025518650.1\|2596662_2597334_-	hypothetical protein	A0A2I7RNK2	Vibrio_phage	1.5e-95	74.0
WP_158159717.1\|2597324_2598014_-	hypothetical protein	A0A2I7RNK1	Vibrio_phage	6.4e-105	75.0
WP_158159718.1\|2598023_2598560_-	adenine glycosylase	A0A2I7RNK5	Vibrio_phage	5.5e-64	71.2
WP_158159719.1\|2598556_2601256_-	hypothetical protein	A0A2I7RNJ3	Vibrio_phage	2.0e-141	84.2
WP_052131904.1\|2601269_2601872_-	hemolysin	A0A2I7RNJ4	Vibrio_phage	2.0e-102	85.5
WP_158159720.1\|2601858_2603046_-	hypothetical protein	A0A2I7RNJ7	Vibrio_phage	2.4e-192	82.3
WP_025589745.1\|2603045_2603387_-	DUF2590 family protein	A0A2I7RNH9	Vibrio_phage	4.0e-44	80.9
WP_158159721.1\|2603386_2605225_-\|tail	phage tail tape measure protein	A0A2I7RNI7	Vibrio_phage	2.7e-243	71.9
WP_078230715.1\|2605436_2605700_-	hypothetical protein	A0A2I7RNJ9	Vibrio_phage	1.3e-29	78.2
WP_025589374.1\|2605696_2605933_-	hypothetical protein	NA	NA	NA	NA
WP_031429740.1\|2605935_2606166_-	hypothetical protein	NA	NA	NA	NA
WP_031429739.1\|2606162_2606660_-	hypothetical protein	A0A2I7S7C4	Vibrio_phage	1.7e-22	48.1
WP_025517563.1\|2606656_2606875_-	molecular chaperone DnaK	A0A2I7RNJ6	Vibrio_phage	1.2e-22	72.1
WP_025605246.1\|2606887_2607337_-	DUF2597 family protein	A0A2I7RNI0	Vibrio_phage	9.6e-78	96.0
WP_158159722.1\|2607340_2608471_-	DUF2586 family protein	A0A2I7RNI8	Vibrio_phage	4.9e-179	82.7
WP_140345060.1\|2608474_2609131_-	virion morphogenesis protein	A0A2I7RNI6	Vibrio_phage	8.5e-99	82.1
WP_158159723.1\|2609114_2609606_-\|tail	phage tail protein	A0A2I7RNH2	Vibrio_phage	1.4e-77	85.6
WP_158159724.1\|2609602_2610022_-\|head	head completion/stabilization protein	A0A2I7RNH7	Vibrio_phage	2.5e-51	75.5
WP_158159725.1\|2610136_2610853_-\|terminase	terminase	A0A2I7RNJ0	Vibrio_phage	5.6e-104	84.4
WP_140345067.1\|2610863_2611868_-\|capsid	phage major capsid protein, P2 family	R9TPZ5	Vibrio_phage	4.3e-110	63.6
WP_158159726.1\|2611867_2612752_-\|capsid	capsid protein	E5E3S5	Burkholderia_phage	2.7e-23	48.5
WP_158159727.1\|2612919_2614695_+\|terminase	terminase	A0A2I7RNI3	Vibrio_phage	2.8e-306	90.4
WP_140315742.1\|2614691_2615720_+\|portal	phage portal protein	A0A2I7RNI9	Vibrio_phage	2.2e-149	74.1
WP_045607465.1\|2615798_2616050_+	ogr/Delta-like zinc finger family protein	R9TNQ2	Vibrio_phage	1.1e-30	75.9
WP_158159728.1\|2616044_2616308_-	hypothetical protein	Q8HA64	Vibrio_phage	9.8e-14	56.9
WP_158159729.1\|2616390_2618271_-	replication endonuclease	A0A218M4H2	Erwinia_phage	2.5e-63	38.0
WP_025517534.1\|2618276_2618513_-	hypothetical protein	NA	NA	NA	NA
WP_025517531.1\|2618509_2618737_-	hypothetical protein	U3PIK2	Vibrio_phage	4.8e-17	53.3
WP_025517529.1\|2618736_2618937_-	hypothetical protein	A0A2I7RNH0	Vibrio_phage	3.4e-11	65.4
WP_025517527.1\|2618965_2619505_-	phage regulatory protein (CII)	A0A2I7RNI1	Vibrio_phage	1.9e-51	57.0
WP_025517525.1\|2619619_2619832_-	hypothetical protein	R9TMQ7	Vibrio_phage	1.1e-12	48.6
WP_158159730.1\|2619922_2620549_+	transcriptional regulator	A0A2I7RNF9	Vibrio_phage	1.8e-37	40.0

DBSCAN-SWA_4

3086272 : 3103435

uncultured_Mediterranean_phage(18.18%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159774.1\|3086272_3088855_-\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	5.9e-79	38.1
WP_017633543.1\|3088997_3089465_-	recombination regulator RecX	NA	NA	NA	NA
WP_157664334.1\|3089356_3089536_-	hypothetical protein	NA	NA	NA	NA
WP_005380874.1\|3089592_3090636_-	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	61.0
WP_005383794.1\|3090836_3091319_-	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.8e-26	48.1
WP_033907432.1\|3091403_3093965_+	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-30	23.2
WP_005380887.1\|3094047_3095034_-	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	6.9e-36	35.2
WP_017633546.1\|3095114_3096038_-	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005380892.1\|3096051_3096678_-	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	2.3e-37	54.5
WP_005380894.1\|3096677_3097454_-	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.3e-66	49.4
WP_053350720.1\|3097453_3098497_-\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005380896.1\|3098542_3099019_-	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_017821625.1\|3099033_3099741_-	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	9.1e-06	23.6
WP_005380907.1\|3099742_3100024_-	cell division protein FtsB	NA	NA	NA	NA
WP_005383785.1\|3100414_3101716_-	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.1e-137	60.6
WP_053350721.1\|3101794_3103435_-	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	7.2e-155	52.2

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046813

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 3661

Sulfolobus_monocaudavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062731013.1\|1290_2592_+	anaerobic sulfatase maturase	NA	NA	NA	NA
WP_005376549.1\|2677_3661_+	MoxR family ATPase	W0UTA7	Sulfolobus_monocaudavirus	1.5e-06	24.3

DBSCAN-SWA_2

9348 : 11763

Indivirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349169.1\|9348_9774_+	DeoR family transcriptional regulator	A0A1V0SE20	Indivirus	2.6e-24	49.6
WP_102970239.1\|9922_10852_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_053349168.1\|10860_11763_+	lipid kinase YegS	A0A1V0SBJ0	Catovirus	3.1e-11	30.0

DBSCAN-SWA_3

18680 : 23742

Diadromus_pulchellus_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821552.1\|18680_19805_-	acyl-CoA desaturase	F2NZ38	Diadromus_pulchellus_ascovirus	1.2e-31	31.8
WP_005376525.1\|20076_20625_+	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_025767847.1\|20715_21333_-	HAD family phosphatase	NA	NA	NA	NA
WP_053303516.1\|21696_23742_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.0e-09	31.6

DBSCAN-SWA_4

26756 : 36855

Hokovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159338.1\|26756_30422_+	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	1.5e-30	36.2
WP_054576033.1\|30405_31572_+	EAL domain-containing protein	NA	NA	NA	NA
WP_158159339.1\|31564_32161_+	response regulator	NA	NA	NA	NA
WP_053307630.1\|32170_33541_+	GGDEF domain-containing protein	G3MA91	Bacillus_virus	3.1e-10	30.3
WP_033906494.1\|33698_34586_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_102949793.1\|34582_35203_-	response regulator transcription factor	NA	NA	NA	NA
WP_025998672.1\|35874_36855_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	4.6e-133	74.1

DBSCAN-SWA_5

53248 : 55099

Pseudomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159343.1\|53248_55099_-	acyltransferase family protein	B5WZU0	Pseudomonas_phage	1.9e-58	29.5

DBSCAN-SWA_6

61011 : 61599

Ochrobactrum_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102970238.1\|61011_61599_+	AAA family ATPase	A0A219VHB7	Ochrobactrum_phage	1.9e-09	37.2

DBSCAN-SWA_7

66218 : 66725

Synechococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005388756.1\|66218_66725_+	peptide deformylase	E3SLL2	Synechococcus_phage	9.0e-16	41.8

DBSCAN-SWA_8

71865 : 74444

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062731004.1\|71865_73626_-	ABC transporter ATP-binding protein/permease	W8CYL7	Bacillus_phage	1.2e-62	31.5
WP_102970265.1\|73799_74444_-	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	1.8e-21	38.0

DBSCAN-SWA_9

82480 : 87201

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349136.1\|82480_85345_-	aminomethyl-transferring glycine dehydrogenase	M4QFZ1	Prochlorococcus_phage	4.8e-271	52.3
WP_005376432.1\|85471_85852_-	glycine cleavage system protein GcvH	NA	NA	NA	NA
WP_005376430.1\|85905_87201_-	serine hydroxymethyltransferase	A0A240F3L3	Aeromonas_phage	5.9e-104	52.6

DBSCAN-SWA_10

92676 : 95736

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349132.1\|92676_95736_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	2.8e-51	22.0

DBSCAN-SWA_11

107306 : 108041

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730988.1\|107306_108041_-	amino acid ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.3e-28	35.8

DBSCAN-SWA_12

111675 : 116716

Tupanvirus(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159348.1\|111675_114837_+	chitinase	A0A2K9KZQ8	Tupanvirus	5.1e-24	25.9
WP_017633711.1\|114986_115421_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	8.8e-20	34.8
WP_033906540.1\|115498_116716_-	glucose-1-phosphate adenylyltransferase	I7I009	Enterobacteria_phage	4.0e-09	25.0

DBSCAN-SWA_13

120776 : 127126

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005397614.1\|120776_121247_-	CreA family protein	A0A2I7SAK3	Vibrio_phage	1.1e-23	42.5
WP_005376378.1\|121392_121902_+	hypothetical protein	NA	NA	NA	NA
WP_054575167.1\|122097_122766_+	HAD-IA family hydrolase	NA	NA	NA	NA
WP_005376380.1\|123196_124627_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.8e-08	63.2
WP_081442502.1\|125010_125115_+	hypothetical protein	NA	NA	NA	NA
WP_053303599.1\|125196_125799_+	DUF479 domain-containing protein	NA	NA	NA	NA
WP_086013822.1\|125854_127126_+	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.7e-53	33.9

DBSCAN-SWA_14

138397 : 139417

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159352.1\|138397_139417_+	TerC/Alx family metal homeostasis membrane protein	A0A291LBC5	Escherichia_phage	1.1e-39	39.8

DBSCAN-SWA_15

151292 : 152132

Pandoravirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376329.1\|151292_152132_+	isopenicillin N synthase family oxygenase	S4VNP9	Pandoravirus	1.6e-09	39.4

DBSCAN-SWA_16

158664 : 159357

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033907076.1\|158664_159357_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.0e-21	31.2

DBSCAN-SWA_17

166323 : 169353

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767774.1\|166323_168282_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.3e-27	40.7
WP_005376309.1\|168336_169353_+	UDP-glucose 4-epimerase GalE	A0A2K9L5H6	Tupanvirus	4.0e-79	45.6

DBSCAN-SWA_18

183002 : 184226

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349889.1\|183002_184226_-	chromosome partitioning protein ParB	R9U8L2	Vibrio_phage	6.4e-15	34.7

DBSCAN-SWA_19

189725 : 201283

Vibrio_phage(85.71%)

coat

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025522911.1\|189725_190094_-	hypothetical protein	R9TE55	Vibrio_phage	1.8e-42	71.1
WP_025518896.1\|190293_190596_+	hypothetical protein	NA	NA	NA	NA
WP_158159353.1\|190595_192626_+	replication endonuclease	A0A0F6YPA7	Vibrio_phage	2.1e-196	53.0
WP_005389159.1\|192709_193015_+	hypothetical protein	Q2PZB5	Vibrio_virus	1.1e-19	51.0
WP_158159354.1\|193285_193549_+	hypothetical protein	NA	NA	NA	NA
WP_158159355.1\|193619_195209_+	chemotaxis protein	NA	NA	NA	NA
WP_012841818.1\|195208_195568_+\|coat	minor coat protein	R9TIT8	Vibrio_phage	4.1e-23	45.6
WP_158159499.1\|195567_196641_+	hypothetical protein	O80263	Vibrio_phage	8.6e-125	62.6
WP_158159356.1\|196658_198011_+	type II secretory pathway protein	R9TEZ5	Vibrio_phage	2.1e-123	60.1
WP_158159357.1\|198050_198710_-	DUF2726 domain-containing protein	NA	NA	NA	NA
WP_158159358.1\|198950_200315_+	adenylate/guanylate cyclase domain-containing protein	NA	NA	NA	NA
WP_158159359.1\|200316_200889_+	hypothetical protein	NA	NA	NA	NA
WP_158159360.1\|200917_201283_-	regulator	Q9MCC4	Vibrio_phage	5.8e-49	79.7

DBSCAN-SWA_20

207144 : 207807

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376251.1\|207144_207807_-	response regulator transcription factor	W8CYM9	Bacillus_phage	3.9e-27	33.6

DBSCAN-SWA_21

213712 : 218055

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349903.1\|213712_214951_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	8.7e-12	29.0
WP_005388042.1\|215201_216173_-	diguanylate cyclase	W8CYM9	Bacillus_phage	2.4e-09	32.2
WP_005376232.1\|216434_216872_+	DUF3069 domain-containing protein	NA	NA	NA	NA
WP_005388041.1\|216948_218055_-	molybdenum ABC transporter ATP-binding protein ModC	G9BWD6	Planktothrix_phage	4.6e-20	31.0

DBSCAN-SWA_22

226881 : 229557

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634628.1\|226881_227352_-	anaerobic ribonucleoside-triphosphate reductase-activating protein	H6WXC9	Vibrio_phage	1.2e-51	62.9
WP_005388026.1\|227436_229557_-	anaerobic ribonucleoside-triphosphate reductase	A0A2I7QNQ7	Vibrio_phage	1.3e-270	65.4

DBSCAN-SWA_23

248823 : 250086

Archaeal_BJ1_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767748.1\|248823_250086_+	hydroxymethylglutaryl-CoA reductase	A2RQD2	Archaeal_BJ1_virus	4.7e-05	38.6

DBSCAN-SWA_24

254740 : 255175

Streptomyces_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376074.1\|254740_255175_+	thioredoxin TrxC	A0A1J0GW78	Streptomyces_phage	1.4e-12	39.6

DBSCAN-SWA_25

269816 : 276848

Bacillus_virus(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767735.1\|269816_270776_+	diguanylate cyclase	G3MA91	Bacillus_virus	2.5e-14	31.0
WP_005376042.1\|271003_271990_+	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_062730975.1\|271991_273329_+	diguanylate cyclase	G3MA91	Bacillus_virus	7.0e-15	26.9
WP_005376038.1\|273564_274557_+	LLM class flavin-dependent oxidoreductase	NA	NA	NA	NA
WP_053350851.1\|275060_275990_+	CHAD domain-containing protein	NA	NA	NA	NA
WP_005375991.1\|276059_276848_+	lipase	Q6XLV5	Feldmannia_irregularis_virus	5.0e-05	28.7

DBSCAN-SWA_26

279873 : 281505

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375988.1\|279873_281505_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	4.8e-18	31.0

DBSCAN-SWA_27

289510 : 291957

Aphanizomenon_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375980.1\|289510_291172_-	DUF3763 domain-containing protein	A0A2H4PB07	Aphanizomenon_phage	2.4e-33	29.3
WP_005375979.1\|291441_291957_+	NUDIX hydrolase	Q5ULM8	Lactobacillus_virus	1.0e-06	28.6

DBSCAN-SWA_28

296440 : 296974

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375974.1\|296440_296974_-	hypothetical protein	A0A1W6JNX6	Morganella_phage	3.2e-40	46.8

DBSCAN-SWA_29

300786 : 308564

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767717.1\|300786_301920_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	1.2e-10	28.3
WP_025767716.1\|302281_303121_-	hypothetical protein	NA	NA	NA	NA
WP_005375969.1\|303121_303412_-	type VI secretion protein	NA	NA	NA	NA
WP_053349933.1\|303423_305259_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.9e-26	25.0
WP_005375967.1\|305308_305788_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_053349934.1\|305996_308564_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	8.5e-86	31.1

DBSCAN-SWA_30

326981 : 329135

Megavirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159365.1\|326981_329135_+	protein kinase	H2EBQ2	Megavirus	7.5e-19	28.8

DBSCAN-SWA_31

337240 : 338077

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053053060.1\|337240_338077_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	8.2e-30	37.6

DBSCAN-SWA_32

350337 : 358193

Bacillus_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_081051357.1\|350337_352251_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	2.7e-20	31.8
WP_025767691.1\|352261_352603_+	hypothetical protein	NA	NA	NA	NA
WP_053349952.1\|352851_354630_+	S8 family serine peptidase	A0A2H4PQH1	Staphylococcus_phage	3.9e-05	25.1
WP_025767689.1\|354642_355098_+	hypothetical protein	NA	NA	NA	NA
WP_053349953.1\|355244_356174_-	transcriptional regulator	NA	NA	NA	NA
WP_053349954.1\|356311_357553_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_053303698.1\|357524_358193_-	response regulator transcription factor	W8CYM9	Bacillus_phage	5.2e-27	33.9

DBSCAN-SWA_33

364715 : 365471

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017634222.1\|364715_365471_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.2e-18	29.9

DBSCAN-SWA_34

378790 : 380356

Ectocarpus_siliculosus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821221.1\|378790_380356_-	alginate lyase	Q8QKV2	Ectocarpus_siliculosus_virus	4.9e-20	41.0

DBSCAN-SWA_35

390468 : 393651

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159372.1\|390468_391185_+	3'-5' exonuclease	A0A0A7RWA3	Clostridium_phage	6.2e-10	27.1
WP_031781211.1\|391869_393651_+	transporter	A0A219Y9P9	Aeromonas_phage	4.0e-10	23.2

DBSCAN-SWA_36

404562 : 409028

Lactobacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375813.1\|404562_405393_+	LysR family transcriptional regulator	A0A2P0ZL89	Lactobacillus_phage	2.4e-05	26.9
WP_031778904.1\|405402_405975_-	protocatechuate 3,4-dioxygenase	NA	NA	NA	NA
WP_005375809.1\|406111_406780_-	arginine ABC transporter permease ArtM	NA	NA	NA	NA
WP_053349973.1\|406776_407466_-	arginine ABC transporter permease ArtQ	NA	NA	NA	NA
WP_053303704.1\|407467_408211_-	transporter substrate-binding domain-containing protein	NA	NA	NA	NA
WP_102970230.1\|408299_409028_-	arginine ABC transporter ATP-binding protein ArtP	G9BWD6	Planktothrix_phage	5.3e-25	34.4

DBSCAN-SWA_37

415994 : 417596

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730959.1\|415994_417596_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.5e-11	24.4

DBSCAN-SWA_38

429100 : 430875

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375778.1\|429100_429859_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	7.5e-06	27.1
WP_005375775.1\|429969_430875_-	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	9.5e-24	27.9

DBSCAN-SWA_39

438672 : 444684

Pike_perch_iridovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064376502.1\|438672_440277_+	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	1.2e-18	65.3
WP_158159376.1\|440306_441146_+	gamma-carboxygeranoyl-CoA hydratase	NA	NA	NA	NA
WP_053303725.1\|441145_442054_+	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	3.5e-50	40.1
WP_053303726.1\|442100_442979_-	DMT family transporter	NA	NA	NA	NA
WP_158159377.1\|443370_444684_-	PAS domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	6.4e-13	51.1

DBSCAN-SWA_40

450878 : 452150

Pontimonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730950.1\|450878_452150_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2K9VGT1	Pontimonas_phage	2.7e-16	37.5

DBSCAN-SWA_41

467007 : 471356

Chrysochromulina_ericina_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375680.1\|467007_468939_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	4.6e-52	29.8
WP_158159381.1\|469352_471356_+	exoribonuclease II	Q0GXV6	Lactococcus_phage	4.7e-31	24.5

DBSCAN-SWA_42

475040 : 478331

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_102970228.1\|475040_476597_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	5.4e-27	30.2
WP_158159383.1\|476876_478331_+	molybdate ABC transporter ATP-binding protein ModF	Q9EMR9	Amsacta_moorei_entomopoxvirus	2.1e-09	23.8

DBSCAN-SWA_43

485084 : 486377

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350644.1\|485084_486377_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	6.4e-50	31.3

DBSCAN-SWA_44

489541 : 489754

Morganella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375644.1\|489541_489754_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	4.4e-17	61.4

DBSCAN-SWA_45

494608 : 495859

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350636.1\|494608_495859_-	DEAD/DEAH box helicase	A0A0N9Q9J4	Chrysochromulina_ericina_virus	2.9e-47	31.8

DBSCAN-SWA_46

505446 : 510606

Synechococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159384.1\|505446_507216_+	alkaline phosphatase	E3SII1	Synechococcus_phage	4.6e-06	32.3
WP_005375563.1\|507287_507626_-	4a-hydroxytetrahydrobiopterin dehydratase	NA	NA	NA	NA
WP_053350625.1\|507615_508410_-	phenylalanine 4-monooxygenase	NA	NA	NA	NA
WP_053350624.1\|508632_510606_+	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	5.8e-18	26.5

DBSCAN-SWA_47

519009 : 521790

Clostridium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375587.1\|519009_519489_-	DNA starvation/stationary phase protection protein	A0A0A7RTZ1	Clostridium_phage	6.3e-19	35.0
WP_062730943.1\|519789_521790_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.5e-21	26.4

DBSCAN-SWA_48

543862 : 546094

Feldmannia_species_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159387.1\|543862_546094_+	response regulator	B5LWN0	Feldmannia_species_virus	3.3e-09	32.3

DBSCAN-SWA_49

551710 : 555505

Vibrio_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635872.1\|551710_552601_-	sigma-70 family RNA polymerase sigma factor	A0A2I7SAT0	Vibrio_phage	1.2e-23	32.4
WP_017635871.1\|552934_554377_-	sensor domain-containing diguanylate cyclase	G3MA91	Bacillus_virus	9.8e-15	28.5
WP_017635870.1\|554633_554930_-	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_005375625.1\|555295_555505_+	cold-shock protein	Q9AZD3	Lactococcus_phage	1.7e-16	66.1

DBSCAN-SWA_50

564438 : 569255

Flavobacterium_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375510.1\|564438_566070_-	cytochrome c oxidase subunit I	R9VX24	Flavobacterium_phage	3.3e-11	36.4
WP_005385208.1\|566066_567230_-	cytochrome c oxidase subunit II	NA	NA	NA	NA
WP_025768465.1\|567560_569255_+	phospho-sugar mutase	A0A1X9I671	Streptococcus_phage	1.6e-93	36.4

DBSCAN-SWA_51

577483 : 578098

Cronobacter_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159393.1\|577483_578098_+	glutaredoxin	A0A0K1YA09	Cronobacter_phage	1.2e-09	46.5

DBSCAN-SWA_52

581387 : 584598

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375494.1\|581387_583208_+	phosphodiesterase	A0A127AWB9	Bacillus_phage	2.1e-06	28.8
WP_025768471.1\|583314_584598_-	peptidoglycan DD-metalloendopeptidase family protein	A0A2L1IVP0	Streptomyces_phage	1.0e-15	43.9

DBSCAN-SWA_53

589051 : 590923

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768473.1\|589051_590923_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.5e-26	38.7

DBSCAN-SWA_54

596468 : 597344

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053307850.1\|596468_597344_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.7e-07	26.1

DBSCAN-SWA_55

620039 : 620966

Cedratvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_020194754.1\|620039_620966_+	ABC transporter ATP-binding protein	A0A285PWH2	Cedratvirus	6.3e-23	33.3

DBSCAN-SWA_56

635490 : 638725

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821520.1\|635490_636342_+	CARB family carbenicillin-hydrolyzing class A beta-lactamase	Q1MVP3	Enterobacteria_phage	8.5e-51	43.3
WP_053303796.1\|636624_637674_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	4.9e-16	30.2
WP_005375418.1\|637786_637939_-	hypothetical protein	NA	NA	NA	NA
WP_005375417.1\|638185_638725_+	spermidine N1-acetyltransferase	G3MB37	Bacillus_virus	7.6e-05	25.0

DBSCAN-SWA_57

646674 : 650612

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350524.1\|646674_648834_-	S9 family peptidase	A0A1V0SHT0	Klosneuvirus	3.9e-68	34.5
WP_062730925.1\|649040_650612_-	ABC-F family ATP-binding cassette domain-containing protein	Q6DMX7	Streptococcus_phage	7.6e-29	29.7

DBSCAN-SWA_58

664451 : 666011

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031778895.1\|664451_666011_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.4e-27	36.9

DBSCAN-SWA_59

671530 : 675413

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031777205.1\|671530_672163_-	aldolase	A0A077SK32	Escherichia_phage	1.0e-69	62.6
WP_005375358.1\|672189_673446_-	four-carbon acid sugar kinase family protein	A0A077SLJ7	Escherichia_phage	1.5e-131	56.2
WP_005375356.1\|673471_674380_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.1e-100	67.3
WP_005375354.1\|674654_675413_+	DeoR/GlpR transcriptional regulator	A0A077SK06	Escherichia_phage	1.6e-56	47.4

DBSCAN-SWA_60

678853 : 683775

Planktothrix_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350531.1\|678853_679702_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	6.2e-17	33.8
WP_080996863.1\|679722_680484_-	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.3e-13	27.4
WP_053350532.1\|680632_681961_-	MATE family efflux transporter	NA	NA	NA	NA
WP_005375342.1\|682304_682583_-	peptidyl-prolyl cis-trans isomerase	NA	NA	NA	NA
WP_005385059.1\|682860_683775_+	chemotaxis protein CheV	Q56AR1	Bacillus_thuringiensis_phage	1.2e-23	26.1

DBSCAN-SWA_61

690942 : 693701

Bacillus_virus(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005385036.1\|690942_691725_+	heme ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	6.9e-15	30.6
WP_005385033.1\|691837_692299_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_005375307.1\|692906_693206_+	YfcZ/YiiS family protein	NA	NA	NA	NA
WP_062730726.1\|693266_693701_-\|transposase	IS200/IS605 family transposase	W0UUZ0	Sulfolobus_monocaudavirus	8.8e-20	39.4

DBSCAN-SWA_62

698420 : 699251

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350088.1\|698420_699251_+	ammonia-dependent NAD(+) synthetase	G3MA24	Bacillus_virus	2.2e-59	48.2

DBSCAN-SWA_63

705640 : 706585

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_033906772.1\|705640_706585_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	1.9e-59	35.6

DBSCAN-SWA_64

711096 : 714395

Pithovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375287.1\|711096_712707_+	ABC transporter ATP-binding protein	W5SAS9	Pithovirus	4.4e-16	31.3
WP_053350081.1\|712703_714395_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	3.3e-22	40.9

DBSCAN-SWA_65

722214 : 723333

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375271.1\|722214_723333_+	maltose/maltodextrin ABC transporter ATP-binding protein MalK	G3M9Y6	Bacillus_virus	2.0e-23	32.4

DBSCAN-SWA_66

738907 : 741420

Tupanvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821260.1\|738907_740347_+	catalase	A0A2K9L0T1	Tupanvirus	4.7e-102	47.2
WP_017635296.1\|740541_741420_-	NAD(P)-dependent oxidoreductase	A0A077SLF7	Escherichia_phage	2.6e-26	32.3

DBSCAN-SWA_67

755418 : 767499

Bacillus_phage(40.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_044129598.1\|755418_757155_+	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	2.0e-30	27.5
WP_017635307.1\|757248_758175_-	transcriptional regulator GcvA	Q6JIH3	Burkholderia_virus	3.1e-54	38.7
WP_062730915.1\|758422_759787_-	Ktr system potassium transporter B	NA	NA	NA	NA
WP_005375180.1\|759788_760442_-	TrkA family potassium uptake protein	NA	NA	NA	NA
WP_062730914.1\|760593_761292_-	response regulator transcription factor	W8CYM9	Bacillus_phage	2.3e-25	31.7
WP_102970261.1\|761288_762335_-	DUF4118 domain-containing protein	NA	NA	NA	NA
WP_033906862.1\|762560_764414_-	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	8.1e-30	26.4
WP_054578633.1\|764559_766662_+	TonB-dependent siderophore receptor	NA	NA	NA	NA
WP_017635311.1\|766713_767499_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	1.6e-14	28.2

DBSCAN-SWA_68

772737 : 774456

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350060.1\|772737_774456_-	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	2.7e-19	24.2

DBSCAN-SWA_69

777462 : 779379

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017821859.1\|777462_779379_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	2.5e-18	52.9

DBSCAN-SWA_70

786596 : 794573

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768552.1\|786596_788720_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.7e-10	33.0
WP_005375156.1\|789047_789797_-	phosphate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	2.5e-14	28.6
WP_005383923.1\|789857_790721_-	phosphate ABC transporter permease PstA	NA	NA	NA	NA
WP_005375154.1\|790743_791676_-	phosphate ABC transporter permease subunit PstC	NA	NA	NA	NA
WP_005375153.1\|791776_792598_-	phosphate ABC transporter substrate-binding protein	E3SLK5	Synechococcus_phage	7.3e-07	28.5
WP_158159416.1\|792929_794573_+	HAMP domain-containing protein	A0A2H4J162	uncultured_Caudovirales_phage	2.8e-10	58.0

DBSCAN-SWA_71

801111 : 808779

Organic_Lake_phycodnavirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350052.1\|801111_803109_-	S9 family peptidase	F2Y2S5	Organic_Lake_phycodnavirus	1.6e-10	30.3
WP_053350051.1\|803432_804776_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	1.3e-40	28.1
WP_005375145.1\|805326_805581_+	membrane protein	NA	NA	NA	NA
WP_158159420.1\|805607_806534_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_053350050.1\|806540_807956_-	deoxyribodipyrimidine photo-lyase	A0A1V0SGL1	Hokovirus	2.0e-60	31.3
WP_033906723.1\|807978_808779_-	MerR family transcriptional regulator	Q9EYF2	Enterobacteria_phage	7.3e-20	30.8

DBSCAN-SWA_72

814002 : 824423

Bacillus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375136.1\|814002_815586_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	4.0e-17	40.7
WP_042521635.1\|815830_816211_+	DUF3302 domain-containing protein	NA	NA	NA	NA
WP_005375134.1\|816210_817341_+	HlyD family secretion protein	NA	NA	NA	NA
WP_005375133.1\|817676_818225_+	ECF-type riboflavin transporter substrate-binding protein	NA	NA	NA	NA
WP_053350047.1\|818231_819971_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.2e-20	35.1
WP_005383942.1\|819967_820807_+	energy-coupling factor transporter transmembrane protein EcfT	NA	NA	NA	NA
WP_025768568.1\|820929_821211_-	hypothetical protein	A0A2H4IYD3	uncultured_Caudovirales_phage	8.2e-19	61.6
WP_005375129.1\|821417_822599_-	MFS transporter	NA	NA	NA	NA
WP_053350046.1\|822798_823653_-	quinol dehydrogenase ferredoxin subunit NapH	NA	NA	NA	NA
WP_005383947.1\|823652_824423_-	ferredoxin-type protein NapG	A0A077SLP0	Escherichia_phage	7.3e-09	28.1

DBSCAN-SWA_73

828969 : 830598

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005375120.1\|828969_830598_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	3.8e-31	46.8

DBSCAN-SWA_74

834012 : 837920

Planktothrix_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635486.1\|834012_835644_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	3.0e-20	33.0
WP_158159421.1\|835886_837920_-	prolyl oligopeptidase family serine peptidase	A0A1V0SHT0	Klosneuvirus	1.1e-67	31.9

DBSCAN-SWA_75

850664 : 852934

Vibrio_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383983.1\|850664_851696_-	L-threonine 3-dehydrogenase	R9TPW0	Vibrio_phage	6.5e-21	88.5
WP_005375095.1\|851740_852934_-	glycine C-acetyltransferase	V5LQ39	Emiliania_huxleyi_virus	5.0e-41	30.0

DBSCAN-SWA_76

858419 : 861213

Salmonella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350035.1\|858419_858935_+	superoxide dismutase family protein	Q9MC02	Salmonella_phage	6.1e-44	52.7
WP_053350034.1\|858961_860335_-	HAMP domain-containing histidine kinase	NA	NA	NA	NA
WP_115386940.1\|860451_861213_-	response regulator transcription factor	W8CYM9	Bacillus_phage	1.1e-30	32.8

DBSCAN-SWA_77

871050 : 872109

Neodiprion_lecontei_nucleopolyhedrovirus(100.0%)

protease

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768593.1\|871050_872109_+\|protease	serine protease	Q6JPG5	Neodiprion_lecontei_nucleopolyhedrovirus	7.2e-15	27.4

DBSCAN-SWA_78

896370 : 902730

Lactococcus_phage(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005386881.1\|896370_896748_-	PH domain-containing protein	A5GYQ0	Lactococcus_phage	1.9e-26	48.4
WP_005374999.1\|896860_897076_-	TIGR02450 family Trp-rich protein	NA	NA	NA	NA
WP_005374998.1\|897214_897688_-	HPP family protein	NA	NA	NA	NA
WP_025768600.1\|897786_898332_+	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_158159423.1\|898416_900855_-	formate C-acetyltransferase/glycerol dehydratase family glycyl radical enzyme	A0A1S6KUZ1	Providencia_phage	4.0e-08	40.8
WP_053350020.1\|900857_901799_-	glycyl-radical enzyme activating protein	A0A2P0VNQ0	Tetraselmis_virus	1.3e-12	24.6
WP_053350092.1\|902055_902730_+	fructose-6-phosphate aldolase	A0A0E3FNR2	Synechococcus_phage	2.3e-27	32.2

DBSCAN-SWA_79

929475 : 930633

Stx2-converting_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_024701007.1\|929475_930633_-	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	1.9e-77	43.1

DBSCAN-SWA_80

934057 : 938055

Catovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350005.1\|934057_935539_+	deoxyribodipyrimidine photo-lyase	A0A1V0S949	Catovirus	2.7e-28	25.2
WP_053350004.1\|935619_936120_+	fasciclin domain-containing protein	NA	NA	NA	NA
WP_158159424.1\|936591_938055_+	N-acetylglucosamine-binding protein GbpA	A0A0K1Y848	Apis_mellifera_filamentous_virus	5.5e-13	31.5

DBSCAN-SWA_81

950841 : 952419

Prochlorococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768632.1\|950841_952035_+	lipase family protein	Q58MF5	Prochlorococcus_phage	7.1e-11	32.6
WP_053349999.1\|952044_952419_-	DUF1232 domain-containing protein	A0A2I7S9Z5	Vibrio_phage	2.1e-25	53.5

DBSCAN-SWA_82

964425 : 966879

Iris_mild_mosaic_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349993.1\|964425_966879_-	glycogen/starch/alpha-glucan phosphorylase	Q8B3H5	Iris_mild_mosaic_virus	3.0e-16	44.8

DBSCAN-SWA_83

973100 : 975283

Vibrio_phage(50.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350190.1\|973100_973409_+	PTS transporter subunit EIIB	A0A2I7SAJ6	Vibrio_phage	1.4e-08	47.5
WP_053350189.1\|973684_974761_+	ribosome small subunit-dependent GTPase A	NA	NA	NA	NA
WP_017633711.1\|974848_975283_-\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	8.8e-20	34.8

DBSCAN-SWA_84

989100 : 990717

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350184.1\|989100_990717_-	endonuclease I	A0A2P0VMP9	Tetraselmis_virus	3.9e-12	30.9

DBSCAN-SWA_85

1007098 : 1007833

Trichoplusia_ni_ascovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768659.1\|1007098_1007833_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	8.5e-15	30.9

DBSCAN-SWA_86

1018917 : 1032162

Enterobacteria_phage(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374731.1\|1018917_1019925_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	1.0e-18	27.6
WP_053350170.1\|1020070_1020715_+	recombinase family protein	NA	NA	NA	NA
WP_053350169.1\|1020711_1021896_+	multidrug effflux MFS transporter	S4TR35	Salmonella_phage	1.8e-22	28.4
WP_102970221.1\|1021973_1022618_+	START domain-containing protein	NA	NA	NA	NA
WP_062731086.1\|1022698_1024435_-	hypothetical protein	NA	NA	NA	NA
WP_005374721.1\|1024880_1025834_+	M23 family metallopeptidase	V5R8R0	Arthrobacter_phage	3.6e-13	42.2
WP_080659230.1\|1025737_1026190_+	polymer-forming cytoskeletal protein	NA	NA	NA	NA
WP_158159427.1\|1026278_1029029_-	insulinase family protein	A0A2P1EL85	Moumouvirus	3.1e-17	30.0
WP_053350167.1\|1029393_1031280_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-22	44.8
WP_053350166.1\|1031397_1032162_-	Fe(3+) dicitrate ABC transporter ATP-binding protein FecE	G9BWD6	Planktothrix_phage	3.7e-13	28.5

DBSCAN-SWA_87

1045784 : 1051293

Bovine_gammaherpesvirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350159.1\|1045784_1046987_+	type III PLP-dependent enzyme	A0A060D2X4	Bovine_gammaherpesvirus	7.2e-11	23.6
WP_047102439.1\|1047078_1047525_-	DUF302 domain-containing protein	NA	NA	NA	NA
WP_158159428.1\|1047752_1049744_+	U32 family peptidase	Q6DW11	Phage_TP	8.2e-20	27.8
WP_005374689.1\|1049849_1050095_+	DUF3297 family protein	NA	NA	NA	NA
WP_047102441.1\|1050582_1051293_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.9e-21	29.3

DBSCAN-SWA_88

1061692 : 1063261

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730882.1\|1061692_1063261_+	alkyl hydroperoxide reductase subunit F	G3MA85	Bacillus_virus	2.5e-40	32.4

DBSCAN-SWA_89

1067411 : 1067897

Salmonella_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383526.1\|1067411_1067897_+	sigma-70 family RNA polymerase sigma factor	G0X4Y0	Salmonella_phage	1.1e-07	26.1

DBSCAN-SWA_90

1071597 : 1079670

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_062730879.1\|1071597_1072836_-	DEAD/DEAH box helicase	A0A1B1IS59	uncultured_Mediterranean_phage	3.7e-47	31.6
WP_062730878.1\|1073101_1074103_-	amidinotransferase	NA	NA	NA	NA
WP_005374597.1\|1074507_1076358_+	ABC transporter ATP-binding protein	W8CYL7	Bacillus_phage	6.0e-33	25.4
WP_025998611.1\|1076949_1077657_+	hypothetical protein	NA	NA	NA	NA
WP_005374595.1\|1077760_1078237_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_081007959.1\|1078529_1078778_-	hypothetical protein	NA	NA	NA	NA
WP_062730877.1\|1079136_1079670_+	GNAT family N-acetyltransferase	G9BWD5	Planktothrix_phage	2.6e-05	29.7

DBSCAN-SWA_91

1087145 : 1089650

Bordetella_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768702.1\|1087145_1087958_-	AraC family transcriptional regulator	A0A291LAM3	Bordetella_phage	1.4e-05	35.4
WP_017820063.1\|1088930_1089650_+	helix-turn-helix transcriptional regulator	A2I306	Vibrio_virus	8.6e-36	41.6

DBSCAN-SWA_92

1097862 : 1099977

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374556.1\|1097862_1099977_+	type I secretion system permease/ATPase	W8CYL7	Bacillus_phage	4.0e-33	26.6

DBSCAN-SWA_93

1109820 : 1117799

Burkholderia_virus(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635661.1\|1109820_1110732_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.3e-09	24.4
WP_054575282.1\|1110820_1111480_+	CatB-related O-acetyltransferase	A0A2R8FE91	Brazilian_cedratvirus	4.3e-26	39.8
WP_158159430.1\|1111535_1113215_-	DUF342 domain-containing protein	NA	NA	NA	NA
WP_158159431.1\|1113466_1115494_-	GNAT family N-acetyltransferase	Q56AQ2	Bacillus_thuringiensis_phage	3.0e-09	27.7
WP_158159432.1\|1115599_1116574_-	ParB/RepB/Spo0J family partition protein	Q6UAV8	Klebsiella_phage	9.5e-22	30.3
WP_005374503.1\|1116581_1117799_-	ParA family protein	Q1MVJ3	Enterobacteria_phage	4.5e-37	29.8

DBSCAN-SWA_94

1121763 : 1128197

Bacillus_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159434.1\|1121763_1122696_-	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	8.3e-15	29.9
WP_158159435.1\|1122698_1123547_-	ATP-binding cassette domain-containing protein	W6JKT0	Anomala_cuprea_entomopoxvirus	5.6e-18	31.5
WP_005374493.1\|1123908_1124106_+	hypothetical protein	NA	NA	NA	NA
WP_017635221.1\|1124344_1125406_+	GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	1.9e-39	44.0
WP_005374490.1\|1125474_1126230_-	ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_158159436.1\|1126298_1128197_+	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	1.1e-58	38.0

DBSCAN-SWA_95

1131584 : 1132283

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374479.1\|1131584_1132283_+	ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	5.0e-41	42.2

DBSCAN-SWA_96

1135709 : 1140638

Enterobacteria_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374473.1\|1135709_1136732_+	sensor histidine kinase	Q9EYF3	Enterobacteria_phage	1.4e-20	30.3
WP_158159437.1\|1136747_1137539_+	response regulator	NA	NA	NA	NA
WP_005374466.1\|1137607_1138243_+	hypothetical protein	NA	NA	NA	NA
WP_005374458.1\|1138360_1138855_-	peptidyl-prolyl cis-trans isomerase	A0A076FI46	Aureococcus_anophage	1.3e-11	31.4
WP_025768726.1\|1138976_1140638_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	7.1e-17	65.4

DBSCAN-SWA_97

1145046 : 1145904

Anomala_cuprea_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374445.1\|1145046_1145904_-	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	3.1e-16	28.3

DBSCAN-SWA_98

1155310 : 1155793

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374431.1\|1155310_1155793_+	methylated-DNA--[protein]-cysteine S-methyltransferase	M1PFU9	Streptococcus_phage	3.0e-29	47.0

DBSCAN-SWA_99

1162899 : 1168498

Orgyia_leucostigma_nucleopolyhedrovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159439.1\|1162899_1165446_-	chitinase	B0FDP2	Orgyia_leucostigma_nucleopolyhedrovirus	1.0e-147	48.0
WP_005374408.1\|1165815_1166319_-	DUF2850 domain-containing protein	NA	NA	NA	NA
WP_005374407.1\|1166647_1166932_+	pyrimidine/purine nucleoside phosphorylase	NA	NA	NA	NA
WP_005374405.1\|1167064_1167346_+	hypothetical protein	NA	NA	NA	NA
WP_053308037.1\|1167349_1168498_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	8.9e-19	31.0

DBSCAN-SWA_100

1172854 : 1180208

Diadromus_pulchellus_ascovirus(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374393.1\|1172854_1173721_-	MBL fold metallo-hydrolase	F2NZ47	Diadromus_pulchellus_ascovirus	1.6e-20	27.6
WP_005374391.1\|1173847_1174735_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005374389.1\|1174829_1175633_+	Cof-type HAD-IIB family hydrolase	NA	NA	NA	NA
WP_062730863.1\|1175740_1176145_-	hypothetical protein	NA	NA	NA	NA
WP_005383270.1\|1176154_1177252_-	GGDEF domain-containing protein	G3MA91	Bacillus_virus	8.5e-11	34.4
WP_005374384.1\|1177257_1177713_-	hypothetical protein	NA	NA	NA	NA
WP_005374382.1\|1178157_1178997_-	S-formylglutathione hydrolase	NA	NA	NA	NA
WP_017821027.1\|1179059_1180208_-	S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase	E3SJ82	Synechococcus_phage	6.8e-35	28.9

DBSCAN-SWA_101

1184667 : 1185846

Agrotis_ipsilon_multiple_nucleopolyhedrovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054578559.1\|1184667_1185846_+	spindolin	B6D5U4	Agrotis_ipsilon_multiple_nucleopolyhedrovirus	2.7e-31	38.1

DBSCAN-SWA_102

1194778 : 1195315

Klosneuvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054576492.1\|1194778_1195315_-	DUF924 domain-containing protein	A0A1V0SIY0	Klosneuvirus	6.2e-23	36.0

DBSCAN-SWA_103

1201019 : 1203709

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042522351.1\|1201019_1202156_+	glycerate kinase	W6LM47	Streptococcus_phage	3.7e-41	37.0
WP_158159442.1\|1202251_1203709_-	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	4.0e-24	26.6

DBSCAN-SWA_104

1207435 : 1212527

Trichoplusia_ni_ascovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005383319.1\|1207435_1208167_-	glucose 1-dehydrogenase	Q06VL0	Trichoplusia_ni_ascovirus	2.8e-26	31.7
WP_017634358.1\|1208176_1208692_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_158159444.1\|1208962_1210057_+	cytochrome C	NA	NA	NA	NA
WP_053308056.1\|1210079_1212527_+	molybdopterin guanine dinucleotide-containing S/N-oxide reductase	A0A077SK27	Escherichia_phage	3.3e-79	29.7

DBSCAN-SWA_105

1217528 : 1218284

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064354467.1\|1217528_1218284_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	4.5e-27	40.4

DBSCAN-SWA_106

1232551 : 1237286

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053350830.1\|1232551_1233547_-	2-hydroxyacid dehydrogenase	A0A1J0F959	Only_Syngen_Nebraska_virus	4.0e-68	42.4
WP_054574480.1\|1233788_1234271_+	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_005386019.1\|1234306_1235017_-	glycerophosphoryl diester phosphodiesterase	A0A173GBD0	Staphylococcus_phage	4.2e-19	29.0
WP_005386018.1\|1235247_1235913_+	response regulator transcription factor	W8CYM9	Bacillus_phage	2.0e-26	35.2
WP_158159448.1\|1235912_1237286_+	HAMP domain-containing protein	W8CYF6	Bacillus_phage	4.2e-15	24.5

DBSCAN-SWA_107

1249370 : 1258305

Organic_Lake_phycodnavirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017635536.1\|1249370_1250099_+	metal ABC transporter ATP-binding protein	F2Y2R6	Organic_Lake_phycodnavirus	1.1e-09	28.2
WP_109168823.1\|1250098_1250974_+	metal ABC transporter permease	NA	NA	NA	NA
WP_053349397.1\|1250996_1251866_+	zinc ABC transporter solute-binding protein	NA	NA	NA	NA
WP_017635534.1\|1252081_1253077_+	porin	Q1MVN1	Enterobacteria_phage	5.5e-09	23.5
WP_053349396.1\|1253292_1255458_-	oligopeptidase B	F2Y2Z7	Organic_Lake_phycodnavirus	3.7e-34	26.9
WP_053349395.1\|1255769_1256975_-	multidrug efflux MFS transporter EmrD	NA	NA	NA	NA
WP_005374233.1\|1257384_1258305_-	agmatinase	A0A0N9R043	Chrysochromulina_ericina_virus	3.1e-06	27.8

DBSCAN-SWA_108

1265251 : 1266151

uncultured_Caudovirales_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349393.1\|1265251_1266151_-	LysR family transcriptional regulator	A0A2H4J8I9	uncultured_Caudovirales_phage	2.7e-07	42.5

DBSCAN-SWA_109

1271768 : 1273829

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349390.1\|1271768_1273829_-	PAS domain S-box protein	A0A1V0SGX0	Hokovirus	2.0e-05	22.1

DBSCAN-SWA_110

1294164 : 1304012

Bacillus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349380.1\|1294164_1294770_-	alpha-ketoglutarate-dependent dioxygenase AlkB	A0A0B5J690	Pandoravirus	1.2e-19	35.2
WP_062730844.1\|1294902_1296258_+	sensor domain-containing diguanylate cyclase	A0A127AWB9	Bacillus_phage	9.2e-15	32.1
WP_005384164.1\|1296645_1298202_-	DUF3612 domain-containing protein	NA	NA	NA	NA
WP_005384163.1\|1298370_1298955_+	malate synthase	NA	NA	NA	NA
WP_017635511.1\|1299045_1300059_-	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.6e-16	36.6
WP_053349378.1\|1300408_1301761_+	DASH family cryptochrome	F2Y1V1	Organic_Lake_phycodnavirus	2.0e-30	38.0
WP_062730843.1\|1301760_1303305_+	deoxyribodipyrimidine photolyase	A0A1V0SE91	Indivirus	2.2e-52	31.1
WP_053349376.1\|1303304_1304012_+	SDR family oxidoreductase	Q56AQ6	Bacillus_thuringiensis_phage	9.0e-30	35.6

DBSCAN-SWA_111

1308598 : 1309285

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005497912.1\|1308598_1309285_-	YafY family transcriptional regulator	A0A1B0RXM1	Streptococcus_phage	2.1e-15	31.2

DBSCAN-SWA_112

1316167 : 1319309

Dickeya_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_054576182.1\|1316167_1317343_+	efflux RND transporter periplasmic adaptor subunit	A0A140XAI1	Dickeya_phage	1.3e-17	44.7
WP_054576181.1\|1317344_1319309_+	MacB family efflux pump subunit	G9BWD6	Planktothrix_phage	2.7e-39	40.8

DBSCAN-SWA_113

1323928 : 1325959

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025768035.1\|1323928_1325959_+	S8 family serine peptidase	A0A1B0T6A2	Bacillus_phage	4.1e-27	30.9

DBSCAN-SWA_114

1334920 : 1336027

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159456.1\|1334920_1336027_+	putative 2-aminoethylphosphonate ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	9.8e-31	36.8

DBSCAN-SWA_115

1345087 : 1347138

Bacillus_virus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275126.1\|1345087_1346068_+	OmpA family protein	G3M9Z0	Bacillus_virus	6.0e-08	26.4
WP_053349355.1\|1346268_1347138_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.5e-13	25.9

DBSCAN-SWA_116

1352472 : 1354173

uncultured_Caudovirales_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005374021.1\|1352472_1352991_+	NUDIX domain-containing protein	A0A2H4J8B3	uncultured_Caudovirales_phage	2.1e-31	46.2
WP_053349351.1\|1353426_1354173_-	lytic transglycosylase domain-containing protein	I1VXB7	Halocynthia_phage	4.0e-12	42.1

DBSCAN-SWA_117

1373346 : 1377945

Micromonas_pusilla_virus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349346.1\|1373346_1373697_-	rhodanese-like domain-containing protein	G9E686	Micromonas_pusilla_virus	5.3e-07	29.7
WP_005373989.1\|1373964_1374255_+	co-chaperone GroES	A0A221S386	uncultured_virus	2.0e-12	38.1
WP_053304624.1\|1374288_1375887_+	chaperonin GroEL	A0A2I7SAK5	Vibrio_phage	8.2e-180	65.8
WP_005373984.1\|1375992_1376202_+	hypothetical protein	NA	NA	NA	NA
WP_005388704.1\|1376333_1376945_-	LysE family translocator	NA	NA	NA	NA
WP_062731078.1\|1377054_1377945_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.9e-11	23.5

DBSCAN-SWA_118

1390094 : 1391405

Agrobacterium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025998656.1\|1390094_1391405_+	nicotinate phosphoribosyltransferase	A0A2L0UZQ6	Agrobacterium_phage	3.0e-39	30.4

DBSCAN-SWA_119

1394806 : 1395691

Burkholderia_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387224.1\|1394806_1395691_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	6.6e-14	35.8

DBSCAN-SWA_120

1400182 : 1401412

Planktothrix_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349336.1\|1400182_1401412_-	glycine betaine/L-proline ABC transporter ATP-binding protein	G9BWD6	Planktothrix_phage	2.6e-24	37.3

DBSCAN-SWA_121

1405055 : 1407080

Streptococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159461.1\|1405055_1407080_-	elongation factor G	A0A1S5SF82	Streptococcus_phage	5.4e-35	23.0

DBSCAN-SWA_122

1418278 : 1421437

Leptospira_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767992.1\|1418278_1421437_+	efflux RND transporter permease subunit	S5VTK5	Leptospira_phage	1.1e-47	20.9

DBSCAN-SWA_123

1424782 : 1431726

Leptospira_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159463.1\|1424782_1427884_-	MMPL family transporter	S5VTK5	Leptospira_phage	1.3e-64	23.8
WP_017633564.1\|1427880_1429209_-	acriflavin resistance protein	NA	NA	NA	NA
WP_021707693.1\|1429195_1429852_-	TetR/AcrR family transcriptional regulator	NA	NA	NA	NA
WP_158159464.1\|1430044_1430704_-	HAD-IB family hydrolase	NA	NA	NA	NA
WP_005373862.1\|1430706_1431726_-	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.5e-35	38.6

DBSCAN-SWA_124

1436306 : 1437929

Vibrio_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005387086.1\|1436306_1437929_-	BCCT family transporter	A0A2I7QNT1	Vibrio_phage	1.3e-10	22.9

DBSCAN-SWA_125

1442766 : 1456556

Yersinia_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159467.1\|1442766_1444026_-\|tRNA	tyrosine--tRNA ligase	A0A2C9CYK4	Yersinia_phage	3.4e-88	44.1
WP_025767978.1\|1444108_1444915_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005373824.1\|1445108_1445888_-	hypothetical protein	NA	NA	NA	NA
WP_139831983.1\|1446058_1448449_-	phosphoenolpyruvate synthase	A0A1V0SGR7	Hokovirus	2.1e-171	37.8
WP_005373820.1\|1448682_1449519_+	kinase/pyrophosphorylase	NA	NA	NA	NA
WP_042523261.1\|1449595_1450660_-	L-asparaginase 2	NA	NA	NA	NA
WP_158155762.1\|1451030_1452287_-	adenylosuccinate synthase	A0A2R8FF47	Brazilian_cedratvirus	1.5e-48	31.9
WP_062731066.1\|1452392_1453262_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_017819813.1\|1453281_1453674_+	ribosome recycling factor	NA	NA	NA	NA
WP_017633575.1\|1453751_1454366_+	LysE family translocator	NA	NA	NA	NA
WP_053307193.1\|1454458_1454980_-	DUF2058 domain-containing protein	NA	NA	NA	NA
WP_017819816.1\|1455152_1456556_-	aspartate aminotransferase family protein	A0A1V0SKB7	Klosneuvirus	2.9e-19	26.4

DBSCAN-SWA_126

1461398 : 1466384

Streptococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159468.1\|1461398_1462832_+	aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme	A0A1X9I5H2	Streptococcus_phage	1.3e-11	23.7
WP_158159469.1\|1462852_1463875_-	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158159470.1\|1464006_1464768_+	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	2.5e-09	27.0
WP_053304588.1\|1464808_1465321_+	2,4'-dihydroxyacetophenone dioxygenase	NA	NA	NA	NA
WP_064369391.1\|1465325_1466384_+	zinc-binding dehydrogenase	E3SJ82	Synechococcus_phage	9.7e-12	25.8

DBSCAN-SWA_127

1473436 : 1475005

Diachasmimorpha_longicaudata_entomopoxvirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_065275163.1\|1473436_1475005_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	4.4e-53	35.7

DBSCAN-SWA_128

1495582 : 1508034

Enterobacteria_phage(20.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349295.1\|1495582_1496569_-	LacI family transcriptional regulator	C6ZCU4	Enterobacteria_phage	9.3e-25	29.8
WP_062731055.1\|1496804_1498244_+	PTS sucrose transporter subunit IIBC	NA	NA	NA	NA
WP_053349293.1\|1498409_1499333_+	aminoimidazole riboside kinase	NA	NA	NA	NA
WP_053349292.1\|1499364_1500819_+	sucrose-6-phosphate hydrolase	S6ATV4	Bacillus_phage	1.1e-21	24.5
WP_053349291.1\|1501256_1502114_+	glutathione-dependent disulfide-bond oxidoreductase	NA	NA	NA	NA
WP_031778835.1\|1503300_1504470_+	D-alanyl-D-alanine carboxypeptidase	B6DZZ7	Stx2-converting_phage	7.8e-87	46.7
WP_005373701.1\|1504681_1505089_+	cell division protein DamX	NA	NA	NA	NA
WP_005373699.1\|1505139_1505613_-	peroxiredoxin	M1I839	Pelagibacter_phage	9.3e-23	43.1
WP_017819853.1\|1505739_1506756_-	adenosine deaminase	NA	NA	NA	NA
WP_017633782.1\|1507183_1507324_-	hypothetical protein	NA	NA	NA	NA
WP_005373692.1\|1507374_1507584_-	hypothetical protein	NA	NA	NA	NA
WP_005373691.1\|1507824_1508034_-	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-18	65.2

DBSCAN-SWA_129

1515942 : 1517954

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_042522686.1\|1515942_1517241_-	HAMP domain-containing protein	W8CYF6	Bacillus_phage	3.7e-21	29.0
WP_053349288.1\|1517240_1517954_-	response regulator	W8CYM9	Bacillus_phage	7.9e-34	34.4

DBSCAN-SWA_130

1521379 : 1526527

Staphylococcus_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373655.1\|1521379_1522036_-	3,4-dihydroxy-2-butanone-4-phosphate synthase	A0A2H4PQS2	Staphylococcus_phage	5.4e-37	38.4
WP_005373653.1\|1522394_1523012_-	hypothetical protein	A0A2I7SAF7	Vibrio_phage	2.6e-17	33.5
WP_053349285.1\|1523129_1524983_-	MFS transporter	NA	NA	NA	NA
WP_102949801.1\|1524981_1525089_+	hypothetical protein	NA	NA	NA	NA
WP_053349284.1\|1525129_1525888_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_053349283.1\|1525888_1526527_-	HD domain-containing protein	A0A1D6Y7U0	Golden_Marseillevirus	1.5e-12	34.9

DBSCAN-SWA_131

1531564 : 1532887

Micromonas_pusilla_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_064376223.1\|1531564_1532887_-	AarF/ABC1/UbiB kinase family protein	G9E5W0	Micromonas_pusilla_virus	8.4e-21	28.9

DBSCAN-SWA_132

1539039 : 1540362

Bacillus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159476.1\|1539039_1540362_+	two-component sensor histidine kinase	W8CYF6	Bacillus_phage	1.1e-07	22.6

DBSCAN-SWA_133

1549565 : 1552202

Hokovirus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159481.1\|1549565_1552202_+	response regulator	A0A1V0SGX0	Hokovirus	1.9e-48	30.5

DBSCAN-SWA_134

1555307 : 1559630

Invertebrate_iridovirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349265.1\|1555307_1555625_+	GIY-YIG nuclease family protein	W8W2G4	Invertebrate_iridovirus	2.5e-11	48.6
WP_005385634.1\|1555956_1557054_+	substrate-binding domain-containing protein	NA	NA	NA	NA
WP_017635176.1\|1557053_1559630_+	response regulator	A0A1V0SGX0	Hokovirus	2.0e-50	34.6

DBSCAN-SWA_135

1564820 : 1565444

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349262.1\|1564820_1565444_+	class I SAM-dependent methyltransferase	A0A1B1IT46	uncultured_Mediterranean_phage	8.5e-08	31.7

DBSCAN-SWA_136

1569944 : 1573288

uncultured_Mediterranean_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349260.1\|1569944_1570847_+	protein translocase subunit SecF	A0A1B1IVP7	uncultured_Mediterranean_phage	1.7e-36	36.4
WP_005373566.1\|1570905_1571172_-	hypothetical protein	NA	NA	NA	NA
WP_021035942.1\|1571187_1571808_-	LysE family translocator	NA	NA	NA	NA
WP_005373555.1\|1572547_1573288_+	SDR family oxidoreductase	A0A0K0KVL6	Prochlorococcus_phage	7.8e-08	27.7

DBSCAN-SWA_137

1587002 : 1587467

Xanthomonas_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373515.1\|1587002_1587467_-	cell division protein DedD	A0A292GIT0	Xanthomonas_phage	2.2e-24	41.7

DBSCAN-SWA_138

1592264 : 1604133

uncultured_Caudovirales_phage(25.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025767924.1\|1592264_1594034_-	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	8.3e-24	29.6
WP_017635196.1\|1594134_1594548_-\|tRNA	aminoacyl-tRNA hydrolase	NA	NA	NA	NA
WP_017819896.1\|1594624_1595227_+	beta-phosphoglucomutase family hydrolase	NA	NA	NA	NA
WP_017635198.1\|1595315_1596308_-	OmpA family protein	NA	NA	NA	NA
WP_017635200.1\|1596767_1597820_+	3-deoxy-7-phosphoheptulonate synthase AroG	S4W5F1	Pandoravirus	1.5e-81	50.5
WP_086013829.1\|1597973_1599152_+	MFS transporter	NA	NA	NA	NA
WP_053349255.1\|1599361_1600924_+	methyl-accepting chemotaxis protein	A0A1B0V854	Salmonella_phage	3.4e-29	43.4
WP_053349254.1\|1601065_1603057_-	transketolase	NA	NA	NA	NA
WP_005373488.1\|1603182_1604133_-	transaldolase	M4SIN4	Cyanophage	1.1e-11	28.2

DBSCAN-SWA_139

1609532 : 1612468

Pandoravirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349250.1\|1609532_1610282_-	molybdopterin-synthase adenylyltransferase MoeB	S4VW33	Pandoravirus	4.6e-08	34.4
WP_017635208.1\|1610291_1611527_-	molybdopterin molybdotransferase MoeA	NA	NA	NA	NA
WP_005373478.1\|1611814_1612468_+	GTP cyclohydrolase I FolE	R9TJA5	Vibrio_phage	3.4e-55	54.3

DBSCAN-SWA_140

1616179 : 1617597

Pseudomonas_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349247.1\|1616179_1616593_-	helix-turn-helix transcriptional regulator	A0A1C6ZDG7	Pseudomonas_phage	3.1e-06	41.3
WP_005387688.1\|1616688_1617597_+	aldo/keto reductase family oxidoreductase	A0A1V0SDE7	Indivirus	7.3e-08	28.8

DBSCAN-SWA_141

1621469 : 1622513

Chrysochromulina_ericina_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373458.1\|1621469_1622513_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.0e-98	53.8

DBSCAN-SWA_142

1652000 : 1652975

Clostridium_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349235.1\|1652000_1652975_-	peptidoglycan DD-metalloendopeptidase family protein	Q8SBN9	Clostridium_phage	2.0e-19	35.0

DBSCAN-SWA_143

1673779 : 1679584

Cronobacter_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159506.1\|1673779_1676458_-	type VI secretion system ATPase TssH	K4FB40	Cronobacter_phage	7.0e-91	31.3
WP_005373415.1\|1676914_1677433_+	Hcp family type VI secretion system effector	NA	NA	NA	NA
WP_005373412.1\|1677505_1679584_+	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	4.7e-34	26.5

DBSCAN-SWA_144

1683630 : 1685631

uncultured_Mediterranean_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159486.1\|1683630_1685631_+	protein kinase	A0A1B1IUU3	uncultured_Mediterranean_phage	5.7e-13	30.2

DBSCAN-SWA_145

1708759 : 1713194

Clostridium_botulinum_C_phage(33.33%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_017633711.1\|1708759_1709194_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	8.8e-20	34.8
WP_053349223.1\|1709330_1710467_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_053349222.1\|1710566_1711340_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005373334.1\|1711430_1712339_-	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	2.4e-11	29.9
WP_053307575.1\|1712474_1713194_+	SDR family oxidoreductase	A0A0N9R355	Chrysochromulina_ericina_virus	1.2e-05	23.8

DBSCAN-SWA_146

1724561 : 1726589

Staphylococcus_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159492.1\|1724561_1726589_-	acetoacetate--CoA ligase	A0A2H4PQU7	Staphylococcus_phage	4.4e-21	27.0

DBSCAN-SWA_147

1730388 : 1731189

Bacillus_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373297.1\|1730388_1731189_+	ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	1.3e-13	25.0

DBSCAN-SWA_148

1736483 : 1743791

Anomala_cuprea_entomopoxvirus(25.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005373283.1\|1736483_1737305_+	ABC transporter ATP-binding protein	W6JKT0	Anomala_cuprea_entomopoxvirus	1.6e-14	28.1
WP_158159495.1\|1737314_1738517_+	AMP-binding protein	NA	NA	NA	NA
WP_053349212.1\|1738653_1739250_+	methyltransferase domain-containing protein	NA	NA	NA	NA
WP_017820351.1\|1739538_1740297_-	SDR family oxidoreductase	Q06VL0	Trichoplusia_ni_ascovirus	6.3e-13	27.8
WP_053349211.1\|1740293_1741997_-	acetolactate synthase AlsS	M4QSI1	Ostreococcus_lucimarinus_virus	3.7e-21	23.1
WP_005373273.1\|1742026_1742812_-	acetolactate decarboxylase	NA	NA	NA	NA
WP_047101317.1\|1742909_1743791_+	LysR family transcriptional regulator	Q6JIH3	Burkholderia_virus	1.7e-06	45.3

DBSCAN-SWA_149

1751748 : 1757168

Klosneuvirus(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349205.1\|1751748_1752651_-	hydroxymethylglutaryl-CoA lyase	A0A1V0SKU2	Klosneuvirus	8.5e-49	39.9
WP_155487264.1\|1752631_1754719_-	acetyl-CoA carboxylase biotin carboxylase subunit	NA	NA	NA	NA
WP_086026655.1\|1754672_1755476_-	enoyl-CoA hydratase/isomerase family protein	NA	NA	NA	NA
WP_053349203.1\|1755560_1757168_-	methylcrotonoyl-CoA carboxylase	A0A1B2ITV7	Pike_perch_iridovirus	9.6e-19	66.7

DBSCAN-SWA_150

1765073 : 1784335

Escherichia_phage(16.67%)

holin

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349198.1\|1765073_1765970_+	3-hydroxyisobutyrate dehydrogenase	A0A077SLF7	Escherichia_phage	8.2e-28	29.2
WP_053349197.1\|1765979_1766738_+	SDR family oxidoreductase	NA	NA	NA	NA
WP_081051365.1\|1767200_1769222_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	3.9e-17	36.0
WP_017820329.1\|1769827_1770427_+	transcriptional regulator BetI	NA	NA	NA	NA
WP_053349195.1\|1770445_1771906_+	betaine-aldehyde dehydrogenase	NA	NA	NA	NA
WP_053349194.1\|1772086_1773802_+\|holin	choline dehydrogenase	A0A1V0S9M4	Catovirus	8.0e-56	30.3
WP_005382646.1\|1773838_1774777_+\|holin	choline ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_005392552.1\|1774852_1775695_+\|holin	choline ABC transporter permease subunit	NA	NA	NA	NA
WP_042523602.1\|1775697_1776876_+\|holin	choline ABC transporter ATP-binding protein	G3M9Y6	Bacillus_virus	3.8e-25	33.2
WP_102970241.1\|1776972_1777707_-	NAD(P)H-dependent oxidoreductase	NA	NA	NA	NA
WP_053349193.1\|1777872_1778307_+	globin	NA	NA	NA	NA
WP_005373196.1\|1778348_1779131_-	slipin family protein	A0A2K9L3L2	Tupanvirus	2.8e-24	29.9
WP_053349192.1\|1779141_1780518_-	nodulation protein NfeD	NA	NA	NA	NA
WP_005373180.1\|1781016_1781985_+	c-type cytochrome	NA	NA	NA	NA
WP_053349191.1\|1781977_1784335_+	response regulator	A0A1V0SGX0	Hokovirus	1.9e-55	35.4

DBSCAN-SWA_151

1797566 : 1810446

Enterobacteria_phage(25.0%)

transposase

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349187.1\|1797566_1799072_+	ribose ABC transporter ATP-binding protein RbsA	A0A2H4PQG7	Staphylococcus_phage	1.2e-18	27.8
WP_005373145.1\|1799068_1800052_+	ribose ABC transporter permease	NA	NA	NA	NA
WP_005373143.1\|1800139_1801018_+	ribose ABC transporter substrate-binding protein RbsB	C6ZCU4	Enterobacteria_phage	7.3e-05	23.1
WP_053349186.1\|1801241_1802159_+	ribokinase	NA	NA	NA	NA
WP_033906467.1\|1802194_1803202_+	LacI family DNA-binding transcriptional regulator	C6ZCU4	Enterobacteria_phage	3.6e-32	29.2
WP_005499106.1\|1803433_1803652_+	hypothetical protein	NA	NA	NA	NA
WP_053349184.1\|1803812_1804544_+	nicotinamide riboside transporter PnuC	A0A126HGA3	Vibrio_phage	3.1e-25	34.5
WP_017635382.1\|1804554_1805286_+	nucleoside phosphorylase	D0R0G0	Streptococcus_phage	3.6e-05	31.3
WP_017633711.1\|1805474_1805909_+\|transposase	IS200/IS605 family transposase	Q331U4	Clostridium_botulinum_C_phage	8.8e-20	34.8
WP_033906468.1\|1806034_1806715_+	Crp/Fnr family transcriptional regulator	NA	NA	NA	NA
WP_005376635.1\|1806878_1807787_+	siderophore ABC transporter substrate-binding protein	NA	NA	NA	NA
WP_017820306.1\|1807809_1808745_+	iron chelate uptake ABC transporter family permease subunit	A0A2H4IY97	uncultured_Caudovirales_phage	2.0e-69	43.2
WP_005376631.1\|1808737_1809688_+	iron chelate uptake ABC transporter family permease subunit	NA	NA	NA	NA
WP_005376629.1\|1809690_1810446_+	ATP-binding cassette domain-containing protein	G3M9Y6	Bacillus_virus	1.5e-14	26.6

DBSCAN-SWA_152

1814465 : 1814717

Salicola_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376619.1\|1814465_1814717_-	membrane protein	A0A248SJ16	Salicola_phage	2.1e-05	38.9

DBSCAN-SWA_153

1840235 : 1846959

Bacillus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_053349176.1\|1840235_1842305_+	DNA helicase IV	A7KV33	Bacillus_phage	5.9e-21	25.9
WP_005376571.1\|1842382_1842838_-	methylglyoxal synthase	NA	NA	NA	NA
WP_033906475.1\|1842902_1843907_-	TMAO reductase system periplasmic protein TorT	NA	NA	NA	NA
WP_053349175.1\|1843995_1846959_+	TMAO reductase system sensor histidine kinase/response regulator TorS	A0A1V0SGX0	Hokovirus	3.3e-49	33.6

DBSCAN-SWA_154

1850347 : 1851895

Tetraselmis_virus(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005376560.1\|1850347_1851895_+	arylsulfatase	A0A2P0VMN7	Tetraselmis_virus	4.2e-165	57.4

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046812

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

20983 : 36539

Escherichia_phage(44.44%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159315.1\|20983_21901_+	ParB/RepB/Spo0J family partition protein	S5VTK0	Leptospira_phage	3.3e-08	30.4
WP_017634059.1\|21922_22255_-	hypothetical protein	NA	NA	NA	NA
WP_158159316.1\|22347_23793_-	hypothetical protein	Q71TE6	Escherichia_phage	4.3e-143	59.1
WP_158159317.1\|24075_24759_-	hypothetical protein	NA	NA	NA	NA
WP_158159318.1\|24827_29621_-	hypothetical protein	Q1MVM7	Enterobacteria_phage	4.0e-20	33.3
WP_158159319.1\|29617_30244_-	hypothetical protein	O21969	Escherichia_phage	5.4e-18	36.2
WP_158159320.1\|30236_30650_-	hypothetical protein	A0A077SK09	Escherichia_phage	1.4e-06	35.0
WP_054866416.1\|30646_30970_-	hypothetical protein	Q37876	Escherichia_phage	4.1e-06	36.4
WP_158159321.1\|31371_33999_-	hypothetical protein	A0A0D4DBD6	Vibrio_phage	4.5e-58	54.1
WP_158159322.1\|34089_35208_-	hypothetical protein	A0A1B0XUH9	Freshwater_phage	7.3e-18	32.4
WP_033905431.1\|35279_36539_-	hypothetical protein	X2L0B8	Vibrio_phage	3.3e-06	46.3

DBSCAN-SWA_2

53840 : 67440

Escherichia_phage(54.55%)

plate

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158159331.1\|53840_55382_-	N-6 DNA methylase	A0A220A2U4	Liberibacter_phage	1.6e-42	28.4
WP_158159332.1\|55921_57253_+	Fic family protein	A0A1V0E025	Clostridioides_phage	5.1e-26	31.3
WP_158159333.1\|57318_57816_-\|plate	baseplate protein	A0A222YWE4	Escherichia_phage	8.0e-33	44.5
WP_017635635.1\|57829_58438_-	hypothetical protein	Q1MVJ8	Enterobacteria_phage	1.8e-23	34.2
WP_104968932.1\|58447_59116_-	hypothetical protein	A0A222YXT7	Escherichia_phage	4.0e-11	36.5
WP_053307361.1\|59137_60712_-	hypothetical protein	Q71TB2	Escherichia_phage	2.8e-108	42.1
WP_053307362.1\|60704_61136_-	hypothetical protein	NA	NA	NA	NA
WP_053307363.1\|61182_62832_-	hypothetical protein	A0A222YWC7	Escherichia_phage	1.3e-63	31.8
WP_053307364.1\|63114_63465_-	hypothetical protein	NA	NA	NA	NA
WP_053307365.1\|63464_64016_-	N-acetylmuramoyl-L-alanine amidase	A0A2I7RXW8	Vibrio_phage	1.2e-29	44.5
WP_155484617.1\|64253_64589_-	hypothetical protein	NA	NA	NA	NA
WP_053307366.1\|64639_65395_-	hypothetical protein	NA	NA	NA	NA
WP_053307367.1\|65404_65689_-	hypothetical protein	Q1MVI7	Enterobacteria_phage	2.8e-06	34.4
WP_053307368.1\|65695_66466_-	hypothetical protein	A0A222YWF1	Escherichia_phage	3.5e-19	37.0
WP_053307369.1\|66462_67440_-	hypothetical protein	A0A222YXZ0	Escherichia_phage	2.7e-32	28.0

DBSCAN-SWA_3

131556 : 139322

Escherichia_phage(57.14%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_080996186.1\|131556_133146_-	diguanylate cyclase	A0A127AWB9	Bacillus_phage	7.0e-22	41.9
WP_053307323.1\|133529_135029_+	bifunctional diguanylate cyclase/phosphodiesterase	NA	NA	NA	NA
WP_053307324.1\|135109_135622_-	hypothetical protein	A0A222YXU3	Escherichia_phage	2.3e-35	47.4
WP_053307325.1\|135618_136770_-	hypothetical protein	Q71T88	Escherichia_phage	5.7e-74	48.6
WP_053307326.1\|136773_137097_-	hypothetical protein	A0A222YYR0	Escherichia_phage	8.3e-15	40.2
WP_053307327.1\|137089_137722_-	hypothetical protein	A0A222YZ79	Escherichia_phage	1.1e-18	30.1
WP_017634104.1\|138274_138808_-	PadR family transcriptional regulator	K7R9C0	Vibrio_phage	3.2e-11	32.1
WP_053307375.1\|138824_139322_-	hypothetical protein	M4M9K3	Vibrio_phage	1.3e-51	66.9

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046814

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046813

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046812

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection