CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Self targeting spacer number	Target MGE spacer number	Prophage number	Anti-CRISPR protein number
NZ_CP046820	Vibrio metoecus strain 2011V-1015 chromosome 1, complete sequence	0 crisprs	csx1,DinG,DEDDh,cas3,csa3,WYL	0	0	4	0
NZ_CP046819	Vibrio metoecus strain 2011V-1015 chromosome 2, complete sequence	1 crisprs	cas3HD,csa3	0	0	3	0

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

822116 : 828596

Staphylococcus_phage(66.67%)

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_000864130.1\|822116_822587_-	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	6.8e-34	48.7
WP_001122869.1\|822727_823837_-	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	3.3e-63	39.3
WP_158119937.1\|823876_824530_-	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	4.0e-32	37.5
WP_158119938.1\|824534_825638_-	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A2H4PQS8	Staphylococcus_phage	3.8e-43	32.8
WP_055027591.1\|825650_826100_-	transcriptional regulator NrdR	NA	NA	NA	NA
WP_167517845.1\|826200_827451_-	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	2.8e-98	49.0
WP_000210569.1\|827462_828596_-	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.4e-64	39.3

DBSCAN-SWA_2

1896576 : 1903791

uncultured_Mediterranean_phage(33.33%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_055029827.1\|1896576_1897329_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	2.8e-69	53.3
WP_158120302.1\|1897321_1897948_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.8e-37	53.3
WP_158120303.1\|1897947_1898886_+	murein hydrolase activator NlpD	D7RWE0	Brochothrix_phage	7.8e-05	34.7
WP_055029829.1\|1898959_1899970_+	RNA polymerase sigma factor RpoS	F4YCU2	Synechococcus_phage	1.0e-34	34.2
WP_158120304.1\|1900048_1902637_-	DNA mismatch repair protein MutS	A0A1V0SJ67	Klosneuvirus	5.5e-32	26.7
WP_158120305.1\|1902903_1903791_-	cysteine synthase CysM	A0A1X9I5K7	Streptococcus_phage	9.2e-56	41.1

DBSCAN-SWA_3

2136883 : 2143888

Faustovirus(16.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_055027530.1\|2136883_2138098_+	IscS subfamily cysteine desulfurase	A0A0H3TPH2	Faustovirus	2.6e-32	30.5
WP_000331703.1\|2138134_2138518_+	Fe-S cluster assembly scaffold IscU	A0A218MKD1	uncultured_virus	5.4e-53	78.2
WP_158120366.1\|2138578_2138902_+	iron-sulfur cluster assembly protein IscA	A0A2H4N7N5	Lake_Baikal_phage	4.0e-25	52.3
WP_158120367.1\|2138950_2139466_+	co-chaperone HscB	NA	NA	NA	NA
WP_158120368.1\|2139489_2141340_+	Fe-S protein assembly chaperone HscA	A0A0N9QXN8	Chrysochromulina_ericina_virus	3.7e-107	41.2
WP_001124187.1\|2141353_2141692_+	ISC system 2Fe-2S type ferredoxin	NA	NA	NA	NA
WP_055027527.1\|2141740_2141935_+	Fe-S cluster assembly protein IscX	NA	NA	NA	NA
WP_158120369.1\|2142092_2143382_+	aminopeptidase PepB	Q6GYZ8	Mycoplasma_phage	2.9e-34	34.0
WP_001162850.1\|2143459_2143888_+	nucleoside-diphosphate kinase	D2E8E1	Anguillid_herpesvirus	1.0e-20	38.4

DBSCAN-SWA_4

2592058 : 2662782

Vibrio_phage(46.34%)

portal,tRNA,integrase,protease,plate,terminase,capsid,tail

attL 2636458:2636473|attR 2655801:2655816

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_167517919.1\|2592058_2593690_+\|protease	trypsin-like serine protease	G4YAA2	Emiliania_huxleyi_virus	2.6e-11	29.1
WP_000480154.1\|2593764_2594490_-	DUF3581 domain-containing protein	NA	NA	NA	NA
WP_158120549.1\|2594638_2596174_-	histidine ammonia-lyase	A0A1V0S940	Catovirus	8.9e-91	39.6
WP_158120550.1\|2596185_2597883_-	urocanate hydratase	NA	NA	NA	NA
WP_158120551.1\|2597901_2598924_-	formimidoylglutamase	NA	NA	NA	NA
WP_158120552.1\|2598913_2600122_-	imidazolonepropionase	NA	NA	NA	NA
WP_055064509.1\|2600225_2600936_-	histidine utilization repressor	NA	NA	NA	NA
WP_158120553.1\|2601052_2602000_-	DUF3187 family protein	NA	NA	NA	NA
WP_000818873.1\|2602138_2602459_-	YciU family protein	NA	NA	NA	NA
WP_001123593.1\|2602463_2603030_-	elongation factor P-like protein YeiP	NA	NA	NA	NA
WP_158120554.1\|2603246_2604014_+	nucleotidyltransferase domain-containing protein	NA	NA	NA	NA
WP_158120555.1\|2604123_2606223_+	EAL domain-containing protein	NA	NA	NA	NA
WP_158120556.1\|2606194_2608558_-	DNA polymerase II	R4TLV1	Halovirus	1.8e-26	23.4
WP_001890391.1\|2608933_2609578_+	UvrY/SirA/GacA family response regulator transcription factor	NA	NA	NA	NA
WP_158120557.1\|2609577_2611410_+	excinuclease ABC subunit UvrC	NA	NA	NA	NA
WP_001211977.1\|2611457_2612015_+	CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase	NA	NA	NA	NA
WP_158120558.1\|2612878_2613997_+	diguanylate cyclase	G3MA91	Bacillus_virus	1.1e-13	30.2
WP_158120559.1\|2613993_2614479_-	GNAT family N-acetyltransferase	NA	NA	NA	NA
WP_055027268.1\|2614769_2615753_+\|tRNA	phenylalanine--tRNA ligase subunit alpha	A0A2H4UW22	Bodo_saltans_virus	4.0e-36	39.1
WP_158120560.1\|2615779_2618167_+\|tRNA	phenylalanine--tRNA ligase subunit beta	A0A1L3IZU3	BeAn_58058_virus	2.3e-08	25.6
WP_001229255.1\|2618603_2618900_+	integration host factor subunit alpha	A0A0H3UZA0	Geobacillus_virus	2.4e-13	41.1
WP_000054951.1\|2619142_2619922_-	phosphoribosylglycinamide formyltransferase	NA	NA	NA	NA
WP_055032753.1\|2620257_2620914_+	thiopurine S-methyltransferase	NA	NA	NA	NA
WP_000468090.1\|2621010_2622186_-	phosphoribosylglycinamide formyltransferase 2	NA	NA	NA	NA
WP_158120561.1\|2622337_2623213_-	AEC family transporter	NA	NA	NA	NA
WP_158120562.1\|2623372_2624260_-	cytidine deaminase	NA	NA	NA	NA
WP_000270058.1\|2624425_2625103_-	LrgB family protein	NA	NA	NA	NA
WP_032469900.1\|2625093_2625468_-	CidA/LrgA family protein	NA	NA	NA	NA
WP_158120563.1\|2625499_2626924_-	exodeoxyribonuclease I	NA	NA	NA	NA
WP_148522370.1\|2627105_2628299_+\|integrase	tyrosine-type recombinase/integrase	K7P7J2	Enterobacteria_phage	2.7e-103	47.3
WP_002051850.1\|2628295_2628592_-	hypothetical protein	NA	NA	NA	NA
WP_002051851.1\|2628726_2628987_-	hypothetical protein	R9TNM3	Vibrio_phage	2.1e-16	55.3
WP_158120564.1\|2629021_2629570_-	hypothetical protein	NA	NA	NA	NA
WP_158120565.1\|2629569_2630574_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	2.2e-77	44.4
WP_158120566.1\|2630611_2631286_-	hypothetical protein	A0A059WLH8	Vibrio_phage	7.2e-69	59.8
WP_053033956.1\|2631289_2631523_-	hypothetical protein	K4I1E3	Acidithiobacillus_phage	1.1e-08	50.8
WP_148522380.1\|2631764_2632139_-	hypothetical protein	NA	NA	NA	NA
WP_032468854.1\|2632135_2632393_-	hypothetical protein	NA	NA	NA	NA
WP_158120567.1\|2632782_2633481_-	hypothetical protein	D4HTY2	Vibrio_phage	1.1e-19	47.6
WP_032468855.1\|2633582_2633837_+	hypothetical protein	NA	NA	NA	NA
WP_053033958.1\|2633876_2634422_+	hypothetical protein	NA	NA	NA	NA
WP_158120783.1\|2634625_2635396_+	helix-turn-helix domain-containing protein	A0A1W6JP36	Morganella_phage	1.1e-07	25.2
WP_032468856.1\|2635392_2636124_+	ATP-binding protein	A0A1W6JP39	Morganella_phage	2.4e-41	38.1
WP_158120568.1\|2636123_2636756_+	hypothetical protein	A0A2I7RNS2	Vibrio_phage	1.7e-64	59.3
2636458:2636473	attL	NA	NA	NA	NA
WP_148522383.1\|2636757_2637339_+	hypothetical protein	NA	NA	NA	NA
WP_002051883.1\|2637523_2637814_+	hypothetical protein	NA	NA	NA	NA
WP_158120569.1\|2637791_2638280_+	hypothetical protein	A0A2I7R3H9	Vibrio_phage	1.9e-18	37.6
WP_057568767.1\|2638318_2638633_+	hypothetical protein	NA	NA	NA	NA
WP_158120570.1\|2638738_2638987_+	hypothetical protein	NA	NA	NA	NA
WP_148522387.1\|2639320_2640550_+\|integrase	tyrosine-type recombinase/integrase	A0A067ZJC5	Vibrio_phage	1.1e-54	33.2
WP_158120571.1\|2640983_2641553_+	hypothetical protein	B0ZSE9	Halomonas_phage	2.2e-26	37.6
WP_095467471.1\|2641563_2643516_+\|terminase	terminase	A2I2W6	Vibrio_virus	5.8e-212	58.9
WP_158120572.1\|2643509_2644037_+	hypothetical protein	NA	NA	NA	NA
WP_057568772.1\|2644036_2645605_+\|portal	phage portal protein	A0A088FVG5	Escherichia_phage	1.1e-117	42.9
WP_088127474.1\|2645561_2647541_+\|capsid	phage major capsid protein	A0A1W6JT82	Escherichia_phage	4.9e-158	46.8
WP_158120573.1\|2647593_2647890_+	hypothetical protein	NA	NA	NA	NA
WP_158120574.1\|2647882_2648233_+	hypothetical protein	R9TMM0	Vibrio_phage	2.9e-29	53.4
WP_114774479.1\|2648195_2648816_+	hypothetical protein	R9TR34	Vibrio_phage	6.8e-66	60.2
WP_158120575.1\|2648808_2649333_+	hypothetical protein	R9TNK0	Vibrio_phage	9.6e-29	39.2
WP_158120576.1\|2649329_2649977_+\|plate	phage baseplate assembly protein V	R4JMH2	Burkholderia_phage	7.0e-13	38.5
WP_148522400.1\|2649978_2650320_+\|plate	phage baseplate protein	A0A088FV58	Escherichia_phage	1.6e-32	60.4
WP_158120577.1\|2650316_2651195_+\|plate	phage baseplate protein	R9TML5	Vibrio_phage	4.7e-68	46.9
WP_046121709.1\|2651194_2651752_+\|tail	phage tail protein I	R9TR33	Vibrio_phage	2.9e-63	63.7
WP_158118984.1\|2651753_2652485_+	hypothetical protein	A0A1V0E875	Vibrio_phage	8.4e-47	58.9
WP_158118983.1\|2652484_2653027_+\|tail	phage tail protein	A9ZT45	Vibrio_virus	6.2e-79	85.3
WP_158118982.1\|2653114_2654581_+\|tail	phage tail protein	R9TMQ0	Vibrio_phage	1.1e-119	47.8
WP_158118981.1\|2654580_2655096_+\|tail	phage tail protein	R9TR65	Vibrio_phage	1.9e-21	39.1
WP_167517799.1\|2655186_2655450_+\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	1.0e-07	37.8
WP_158120578.1\|2655553_2657335_+\|tail	phage tail protein	R9TRP8	Vibrio_phage	1.4e-103	40.8
2655801:2655816	attR	NA	NA	NA	NA
WP_000179074.1\|2657334_2657730_+\|tail	phage tail protein	R9TMP6	Vibrio_phage	4.7e-28	48.1
WP_000246642.1\|2657713_2657920_+\|tail	tail protein	R9TR63	Vibrio_phage	5.8e-14	52.2
WP_158120579.1\|2657910_2658915_+\|tail	phage tail protein	R9TNM7	Vibrio_phage	3.1e-60	39.5
WP_158120580.1\|2658911_2659328_-	hypothetical protein	NA	NA	NA	NA
WP_156844164.1\|2659421_2660009_-	hypothetical protein	A5VW58	Enterobacteria_phage	4.5e-35	57.9
WP_158120581.1\|2660038_2660245_-	hypothetical protein	NA	NA	NA	NA
WP_002051958.1\|2660313_2660586_-	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_002051960.1\|2660830_2661046_+	hypothetical protein	NA	NA	NA	NA
WP_158120785.1\|2661118_2661526_+	translesion error-prone DNA polymerase V autoproteolytic subunit	A0A1B1ITQ0	uncultured_Mediterranean_phage	6.1e-23	46.6
WP_158120582.1\|2661525_2662782_+	DUF4113 domain-containing protein	A0A1W6JNT0	Morganella_phage	5.1e-92	42.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046819_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046819_1

965186-965286

Orphan

Consensus_repeat	Method
CGGAAGGGGGGAAAAAAATCACCCC	CRISPRCasFinder

1 spacers

The CRISPR arrays of NZ_CP046819_1

>merge|NZ_CP046819|1|965186-965286|CRISPRCasFinder
CCGGAAGGGGGGAAAAAAATCACCCCTTTAGATGAAGGGGGGGAAAAAAATCCCGAAGAGGGGGGATTTTTCTGCACGGAAGGGGGGGAAAAAAATCACCC

>NZ_CP046819|1|1|965186-965286|CRISPRCasFinder
CCGGAAGGGGGGAAAAAAATCACCC	CTTTAGATGAAGGGGGGGAAAAAAATCCCGAAGAGGGGGGATTTTTCTGCA
CGGAAGGGGGGGAAAAAAATCACCC

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046819.1\|WP_032479255.1\|974443_974770_+\|membrane-protein	unknown	unknown	gnl\|CDD\|374352
NZ_CP046819.1\|WP_167517773.1\|975373_975532_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_167517770.1\|967082_967877_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274243
NZ_CP046819.1\|WP_158119298.1\|959700_960669_-\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274008
NZ_CP046819.1\|WP_032479254.1\|966367_966832_+\|VRR-NUC-domain-containing-protein	unknown	unknown	gnl\|CDD\|370112
NZ_CP046819.1\|WP_148527905.1\|962373_962883_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_032479200.1\|957889_958885_-\|nucleoid-associated-protein-YejK	unknown	unknown	gnl\|CDD\|178993
NZ_CP046819.1\|WP_167517772.1\|972141_974226_+\|portal-protein	unknown	unknown	gnl\|CDD\|236729
NZ_CP046819.1\|WP_032479204.1\|961174_961819_-\|ParA-family-protein	unknown	unknown	gnl\|CDD\|349760
NZ_CP046819.1\|WP_032479216.1\|970444_972142_+\|terminase	unknown	unknown	gnl\|CDD\|222858
NZ_CP046819.1\|WP_032479215.1\|969609_970452_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|274987
NZ_CP046819.1\|WP_148527904.1\|961837_962350_-\|PadR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|224609
NZ_CP046819.1\|WP_032479203.1\|960893_961175_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_032479202.1\|960685_960886_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_032479212.1\|968028_969207_+\|site-specific-integrase	unknown	unknown	gnl\|CDD\|271182
NZ_CP046819.1\|WP_158119299.1\|963465_964110_-\|LexA-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|119397
NZ_CP046819.1\|WP_158119300.1\|964273_964528_+\|hypothetical-protein	unknown	unknown	gnl\|CDD\|374243
NZ_CP046819.1\|WP_158119297.1\|958937_959369_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_167517771.1\|967857_968025_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046819.1\|WP_032479218.1\|974843_975362_+\|glycoside-hydrolase-family-108-protein	unknown	unknown	gnl\|CDD\|226439

Protein	Function_ID	Function_description	E-value
NZ_CP046819.1\|WP_167517770.1\|967082_967877_+\|hypothetical-protein	gnl\|CDD\|274243	TIGR02642, hypothetical_protein_YPTB1803, uncharacterized phage protein. This uncharacterized protein is found in prophage regions of Shewanella oneidensis MR-1, Vibrio vulnificus YJ016, Yersinia pseudotuberculosis IP 32953, and Aeromonas hydrophila ATCC7966. It appears to have regions of sequence similarity to phage lambda antitermination protein Q. [Mobile and extrachromosomal element functions, Prophage functions].	1.92716e-23
NZ_CP046819.1\|WP_158119298.1\|959700_960669_-\|hypothetical-protein	gnl\|CDD\|274008	TIGR02168, Chromosome_partition_protein_Smc, chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].	2.4476e-06
NZ_CP046819.1\|WP_032479254.1\|966367_966832_+\|VRR-NUC-domain-containing-protein	gnl\|CDD\|370112	pfam08774, VRR_NUC, VRR-NUC domain.	6.64135e-17
NZ_CP046819.1\|WP_032479212.1\|968028_969207_+\|site-specific-integrase	gnl\|CDD\|271182	cd00801, INT_P4_C, Bacteriophage P4 integrase, C-terminal catalytic domain. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes. This family belongs to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism. The catalytic domain contains six conserved active site residues. Their overall reaction mechanism involves cleavage of a single strand of a DNA duplex by nucleophilic attack of a conserved tyrosine to give a 3' phosphotyrosyl protein-DNA adduct. In the second rejoining step, a terminal 5' hydroxyl attacks the covalent adduct to release the enzyme and generate duplex DNA.	1.93941e-45
NZ_CP046819.1\|WP_032479200.1\|957889_958885_-\|nucleoid-associated-protein-YejK	gnl\|CDD\|178993	PRK00378, PRK00378, nucleoid-associated protein NdpA; Validated.	2.32271e-159
NZ_CP046819.1\|WP_032479218.1\|974843_975362_+\|glycoside-hydrolase-family-108-protein	gnl\|CDD\|226439	COG3926, zliS, Lysozyme family protein [General function prediction only].	6.23991e-39
NZ_CP046819.1\|WP_032479204.1\|961174_961819_-\|ParA-family-protein	gnl\|CDD\|349760	cd02042, ParAB_family, partition proteins ParAB family. ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation. ParB binds to DNA sequences adjacent to the origin of replication and localizes to opposite cell poles shortly following the initiation of DNA replication. ParB regulates the ParA ATPase activity by promoting nucleotide exchange in a fashion reminiscent of the exchange factors of eukaryotic G proteins. ADP-bound ParA binds single-stranded DNA, whereas the ATP-bound form dissociates ParB from its DNA binding sites. Increasing the fraction of ParA-ADP in the cell inhibits cell division, suggesting that this simple nucleotide switch may regulate cytokinesis. ParA shares sequence similarity to a conserved and widespread family of ATPases which includes the repA protein of the repABC operon in Rhizobium etli symbiotic plasmid. This operon is involved in the plasmid replication and partition.	2.56326e-33
NZ_CP046819.1\|WP_167517772.1\|972141_974226_+\|portal-protein	gnl\|CDD\|236729	PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional.	0.000426284
NZ_CP046819.1\|WP_032479215.1\|969609_970452_+\|hypothetical-protein	gnl\|CDD\|274987	TIGR04111, conserved_hypothetical_protein, phage-associated protein, BcepMu gp16 family. Members of this protein family occur in Burkholderia phage BcepMu, Pseudomonas phage B3, and Burkholderia phage KS10, and many bacterial putative prophage regions. The member from Burkholderia phage BcepMu is named gp16. Homology suggests DNA-binding activity. [Mobile and extrachromosomal element functions, Prophage functions].	0.00472443
NZ_CP046819.1\|WP_148527904.1\|961837_962350_-\|PadR-family-transcriptional-regulator	gnl\|CDD\|224609	COG1695, COG1695, Predicted transcriptional regulators [Transcription].	8.81229e-15
NZ_CP046819.1\|WP_032479216.1\|970444_972142_+\|terminase	gnl\|CDD\|222858	PHA02533, 17, large terminase protein; Provisional.	4.65408e-11
NZ_CP046819.1\|WP_158119299.1\|963465_964110_-\|LexA-family-transcriptional-regulator	gnl\|CDD\|119397	cd06529, S24_LexA-like, Peptidase S24 LexA-like proteins are involved in the SOS response leading to the repair of single-stranded DNA within the bacterial cell. This family includes: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The LexA-like proteins contain two-domains: an N-terminal DNA binding domain and a C-terminal domain (CTD) that provides LexA dimerization as well as cleavage activity. They undergo autolysis, cleaving at an Ala-Gly or a Cys-Gly bond, separating the DNA-binding domain from the rest of the protein. In the presence of single-stranded DNA, the LexA, UmuD and MucA proteins interact with RecA, activating self cleavage, thus either derepressing transcription in the case of LexA or activating the lesion-bypass polymerase in the case of UmuD and MucA. The LexA proteins are serine proteases that carry out catalysis using a serine/lysine dyad instead of the prototypical serine/histidine/aspartic acid triad found in most serine proteases. LexA sequence homologs are found in almost all of the bacterial genomes sequenced to date, covering a large number of phyla, suggesting both, an ancient origin and a widespread distribution of lexA and the SOS response.	2.47131e-07
NZ_CP046819.1\|WP_158119300.1\|964273_964528_+\|hypothetical-protein	gnl\|CDD\|374243	pfam15943, YdaS_antitoxin, Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT. YdaS_antitoxin is a family of putative bacterial antitoxins, neutralising the toxin YdaT, family pfam06254.	0.000794821
NZ_CP046819.1\|WP_032479255.1\|974443_974770_+\|membrane-protein	gnl\|CDD\|374352	pfam16083, Phage_holin_3_3, LydA holin phage, holin superfamily III. Phage_holin_3_3 is a family of small hydrophobic holin proteins with one or more transmembrane domains. Holins are encoded within the genomes of Gram-positive and Gram-negative bacteria as well as those of the bacteriophages of these organisms. Their primary function appears to be transport of murein hydrolases across the cytoplasmic membrane to the cell wall where these enzymes hydrolyze the cell wall polymer as a prelude to cell lysis. When chromosomally encoded, these enzymes are therefore autolysins. Holins may also facilitate leakage of electrolytes and nutrients from the cell cytoplasm, thereby promoting cell death. Some may catalyze export of nucleases. LydA and lydB are encoded on the dar operon. The phenotype of a rapid lysis in the absence of active LydB suggests that this protein might be an antagonist of the holin LydA.	2.03732e-18

>NZ_CP046819.1|WP_158119300.1|964273_964528_+|hypothetical-protein
MEELKNYLSSLSMQQKMDYATRAGTTLSYLRKVISISRHTIHPLTCALLEKESDGKVSRKSLRPDDWQLIWPELDLKERMRDAA
>NZ_CP046819.1|WP_158119299.1|963465_964110_-|LexA-family-transcriptional-regulator
MDKYEIRRKNLLRIKTEFCNGSQKELAARLGRTSSYLSRMLSEPGKTGHRRIADEMVEVITQAFNLPLAWLDTINHHSPMQSGCNAVKINMEASFKPNGEAEMINSEYLGQLYIPTSFGIVDVIKVKGDGLFPRVKHGESIVLSRSAIPTPGDDVAIRIKKTNDLMIKTITADRGEHYQVFDVNNATRPETINKDDIDTIQVIAAIFSEAFAVV
>NZ_CP046819.1|WP_148527905.1|962373_962883_-|hypothetical-protein
MQICHHSQFTLLVREGRLYASPETYLCFFSGLQRIVQEVINKKWQEAVADAQTNPESKLNIKTSSEIRETMTFINNQLIFSDMEEKIQGMPVKYSVPLEMPIKELNEHRRNELTSSLLELAKQDLIKYSRYALTRASESINDPHLLSMGEAILEIAQSVSTRLETAPLH
>NZ_CP046819.1|WP_148527904.1|961837_962350_-|PadR-family-transcriptional-regulator
MNLPVVLLSQLLNTKSGQSGYDLHKSIIEKLPYVWDCSHQQVYRELNKLETLGYVTFTVHPQDGKPDRKVYIITSEGRAYLDEQTQKPTPLPSMRNPLSALILALDSQGKSATELLTNHAGACSKRIERLGKQRSNVANDDLLTALLDRQINLLKVDLEWAKGLMESTNH
>NZ_CP046819.1|WP_032479204.1|961174_961819_-|ParA-family-protein
MIITIGGCKGGPGKTTTTVNLAVALALKGRDVLVIDADDQLATSKWFSYRDEQQGVVEINHTIAEGNISQTLLNFHKKYEVILVDVAGGRTIELEAALKVSDLVLCPFEPSQLDLNTFPDFIQIIESAKVYNPKLKERFYLNRCAPLLTLDNQQEVVAALEQMPEITLLKTRMYINKYFGKSFPLGLGVLEVPEATKAQDNFNELLNELMGSVI
>NZ_CP046819.1|WP_032479203.1|960893_961175_-|hypothetical-protein
MRAGTQSDHLRGGLGNGVNRNSAKRRRQGASVSLPITMLNTLDQTNEALLFNERIKGSNASKIVELALQELFKNESPQDIAKRIAAEIRKLNR
>NZ_CP046819.1|WP_032479202.1|960685_960886_-|hypothetical-protein
MMNKRQPTPPQDSLLITRKEIIELLGRPAGSVDKLLKRTPDFPEKISGGFYSRKAVLEWLAAHNLI
>NZ_CP046819.1|WP_158119298.1|959700_960669_-|hypothetical-protein
MTQETPVIDIPHCIQSLATAIEAKMPHSALMSVLTELSDAWNRECDESDKLFDKLEQQETLVQQLNRTNTDLSNKEKLWRDQAEAANRISSRADGLFRNLKVDYDLLKKELEKTARSLEVEKEDHKRTKEQVKRNKETSEKYKTRSNALEKSVAELKKEKYNIEKRAIELGSERLQLINELATFKMLTVWAENGEALMMLPNILSIQIEGQKKISKAYTLLYTDSRGIWRQAAIGSDHRVSFSKFAYCDEVDHEITDTANKVLLKPSEMAQKIAQRWLYKVNVVQNSRITDQDLDIRNTANYLREIGELEECPTTSQTQPTP
>NZ_CP046819.1|WP_158119297.1|958937_959369_-|hypothetical-protein
MAILNLTLAESTVLNGLVHRGGSTSESLTCGFVTGDLSHFSHHFVRFSDAWERLDSGQRQAVIDVRLRCNLDLEDENITPDNFVSVFIDWKKRQLFTEKEEAFWKQWGRNPQYEQHYYDDGELPPEEQKKIEASVKRILSKHL
>NZ_CP046819.1|WP_032479200.1|957889_958885_-|nucleoid-associated-protein-YejK
MSIKINNVITHLITLNEQGELTLSLRNQALDTQTPQSESFALELHRVYTQKPKGFAAFNEESDFHARLAQMRDNQTGFIEFTQAAAANLKSELCKYPFADTGVLTFIEYTNLASEYLLIALLPIKASIRLDDGLDINIIEYVDFNQITIAARINLTELETKSSERPVTFIHGRVGRRVSDFFLDFLNVRINFDPKMQNQVLKQALDDFCNDGKLERDEKLQLKRSASDYCKEQIASNDEISIKELSAQLPPAPNGESFETYVTEQGYELAESFPADKATVRSLTKYIGAGGGLNISFDSLLLGERVFYDPETDTLTIKGTPPNLRDQLART
>NZ_CP046819.1|WP_032479254.1|966367_966832_+|VRR-NUC-domain-containing-protein
MTTSLSDQLNLHHLAKGRNAPSYKSNATKRVMVLRERAEQAALVEWADVTTVHGILIGEFLTHVPNEGKRGPQARNDFIELGGSAGYPDLILDIPTRRYAGLRIEMKAPEPFDAKVTSSQMAWHEKLRKMGYRVEVCRGLEEAKRIIIDYLSEL
>NZ_CP046819.1|WP_167517770.1|967082_967877_+|hypothetical-protein
MLTLLSAARTMKWEDHVSKNGPTKEQLLGAIGLAQRDNPVGIAILSAKYMQCAHSTDKIHQYLKLQPFPLLTSVQRDHASYLLIADALDMPIDVMQKRIVGAWKRYSMRGERARKTIDSLKKAVKSMEKAILLKTTSQEVKHLEEQIAAHMARIESEERALLEYAAAKASESCKCPRCRATGVVQKTQRYCDTCAGSGEFRVTEADWLTSLLAISGNDHFRLRELWPEVVLVLREKKAQLRGYELDALSAIEKRLSAEYENPSY
>NZ_CP046819.1|WP_167517771.1|967857_968025_+|hypothetical-protein
MKTQAIDTASIEQLPEEGVCSLCCYEHTCGLVDTEPCCASVREDGRDVYFIEIEE
>NZ_CP046819.1|WP_032479212.1|968028_969207_+|site-specific-integrase
MRTLEVVLSDAAIKRHLDDAAVYQLKDPRHSLYLRYNTARTGGSWLLVHYAKGKQVRNKIGAWPITSSKVIFDRLGTIKADMGLNSASADVCIGQFSTVGDLLRWYQERVSKNRTMSQSRKVNTKSMIKCHLLPMLGDIELGHVSRQLLDTQLMWPLQERYELSMVRCVFAALKVAFKQAKKLKLIEENPLADLKFREFIEAAIAIKDAKVRPEHVKNLIESLSKHDDVSQALIVMMLAHGTRIGETRKARWDHIDFESREWFIPSEHTKTKTAHRLPLTDEMIGYLQQYRTNQKSDSVFLFPSAGKRSAMSACAASKKVKAVSDGKWTAHDLRKVARTVWADLGVDYMVSEILLNHALSTLDKTYVHTFVEAKKREALTDYHAWLNLQSLL
>NZ_CP046819.1|WP_032479215.1|969609_970452_+|hypothetical-protein
MAKRDWKALQQEYKLAFDERGISIKAWCDENGINYNTARRYLQVISSDDENPENCAKNAKQPRTVSTPPISKWTEKSDQFGGGEGEKPKKSKGKGRKKKVISESDQLTDQNTDQFTDHSEKMAFIRRFLGFDMDSQRDEKGRFVLGHQMSVVHNGYTARLKNPDVAFDASQSEIDYEIAFARAKLMETIDIYYKINADLEKEGVPIADRVKLYELRRDTDANVDRALTIIATLLRTKAQVKKTELESARIEQESAGLGTAIADIVQEIQAMESDGFVLNA
>NZ_CP046819.1|WP_032479216.1|970444_972142_+|terminase
MRSLGSVTPEQISAGDRAFILSKIGDKWWRLNNLYKIENEDGELVTFKLRPAQALLFKLMGHRNIILKARQLGFSTAIDIYLLDEALFNNRLKCGIVAQDKQAAGEIFRTKVEVPYDNLPAWLRAALPTVERKSGANGGRMVFKNGSSIQVATSFRSGTVQRLHISEHGKICAKYPQKAKEVKTGTLNAIHQNAICFIESTAEGVGGDFYTMCMRAMEQAKSGVQLSREDYRFHFFAWWQDPKYRSRVPMNGLVVPKAMQEYFLGVEKSMDCKLDDEQKQWYLEKEAMQGEDMKQEFPSTPLEAFLTSGRRVFNPAHIMAAEADVLSPFLVYDMEPITGKLTRVNSIDSDDPLRMQRNAMNLLLMWELFDEDEEYAIGVDIAEGLEHGDRSSIDVVKKSDGEQVAHWFGHIDAELLAYIVKHIAEMYGNAYVMPERNNHGHAFIQKLRDIYPTKFIYSEQYLDRDNDNETVKLGWLTTKQSKPILTEGMKSLFKGGVSGIRWIGTISEYHSYVYDKKGAMNAQEGCFDDQVMSHMLAQEARARMPKRVKSEDLKRDSSNNHWQTK
>NZ_CP046819.1|WP_167517772.1|972141_974226_+|portal-protein
MELAKLDDFMRRILSDIDGQPDWRSAAKVAAAYYDGDQLSPAVKEKLKERGQPTTIHNLIAPTIDGVLGMEAKTRTNLLVCADDPDEQMELMAEAVNAEFSDAARLGRLDKARSDAYASQIKAGVGFVEAYRNPNPFGPKYKIKGVPRDEVFWDWFSVEPDWSDCRWVMRMRWMDIDELATLVPDKAGILEYAKKDWRGFIDVEPLEGLDPLLTSAHDAFNNWSRSHSEYLSHNRERIRLQIVYVRHIERKPVLETPDGRVIEFDDKNLTHAMAVAMGRATVRQAQVSRIKEEWYAGIYHLLSRDCDAPGGMFPIVPFWGYRKDSSGEPYGLIARAIPAQDEVNFRRIKLTWLLQAKRVLMDEDATNMSQKQILEEVERPDGLIKLNSQRKNQKSISEVFQVQQDFNIAAQQFNVMQDSMKLIQDTMGVYGAFLGQDSNASSGVAIANLVEQGATTLAEINDNYNYGSQLLGELLLGYILEDMKQQQNKAIVINREDKRKRKTVVVNEVSEDGLINNDLTRLRAHIALAPIQQTAAYKSQLAERMMMLTSQLPPEVQITVIDLVLELSDVPNKQEFMERVRGALNIQKDPEDMTEEEQAAIQQQQQQEQALQQKQLELQMREMEAKVLKLESEAKNIMAKAQREEGLTDSQRFDNAKTQAETKRIMQEIESLNLEMQAMQGQMLQTVESMIDQL
>NZ_CP046819.1|WP_032479255.1|974443_974770_+|membrane-protein
MVGVDMPLKEPENWSQLQTIGLALMAIWGGLVTYIVDIRKNNRQFRWIDALMQIIVSGFAGALCALAAVYFQWPQELAGFACGISGYAGSRIIAVFERKFISTIDNQP
>NZ_CP046819.1|WP_032479218.1|974843_975362_+|glycoside-hydrolase-family-108-protein
MFDVVFERVVMHEGGYQCDPKDRGNWTGGRVGVGELKGTNRGISAMTYPHLDIKNLTDKQIKALYFEDWWLKLGMDKFRPAMQYQLFDAAVQHGWSRAVKMLQHAVGEKPDGIIGPKTLKATKAMEINDLIMRFIAYRIRFYTKVSTFSEYGKGWMCRVAECLLFATQDNDL
>NZ_CP046819.1|WP_167517773.1|975373_975532_+|hypothetical-protein
MEKFLAVLKSRKVISALVTLLSALALSFGYNVSPEFKSAVSVITCEIVECVE

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

165542 : 207461

Vibrio_phage(43.75%)

integrase,plate,tRNA,tail,capsid,portal,terminase

attL 178434:178449|attR 208245:208260

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_158118973.1\|165542_166505_+\|integrase	integron integrase	A0A1P8DJJ6	Virus_Rctr41k	8.4e-63	44.4
WP_158118974.1\|166586_166940_-	50S ribosomal protein L20	NA	NA	NA	NA
WP_001885060.1\|166981_167176_-	50S ribosomal protein L35	NA	NA	NA	NA
WP_001894072.1\|167279_167831_-	translation initiation factor IF-3	A0A2L0UZ54	Agrobacterium_phage	9.2e-14	35.1
WP_158118975.1\|167834_169763_-\|tRNA	threonine--tRNA ligase	A0A2K9L297	Tupanvirus	3.3e-127	37.4
WP_001911595.1\|170031_170259_-	hypothetical protein	NA	NA	NA	NA
WP_000132861.1\|170383_171055_-	hypothetical protein	NA	NA	NA	NA
WP_158118976.1\|171054_171585_-	type VI secretion system PAAR protein	A0A2R3ZY74	Campylobacter_phage	8.6e-09	39.5
WP_158118977.1\|172105_173383_-	hypothetical protein	NA	NA	NA	NA
WP_158118978.1\|173737_174742_-\|tail	phage tail protein	R9TNM7	Vibrio_phage	3.1e-60	39.2
WP_000246642.1\|174732_174939_-\|tail	tail protein	R9TR63	Vibrio_phage	5.8e-14	52.2
WP_000179074.1\|174922_175318_-\|tail	phage tail protein	R9TMP6	Vibrio_phage	4.7e-28	48.1
WP_158118979.1\|175317_177099_-\|tail	phage tail protein	R9TRP8	Vibrio_phage	9.0e-111	42.2
WP_167517799.1\|177202_177466_-\|tail	phage tail assembly protein	Q75QK8	Wolbachia_phage	1.0e-07	37.8
WP_158118981.1\|177556_178072_-\|tail	phage tail protein	A0A193GYM4	Enterobacter_phage	2.0e-18	32.1
WP_158118982.1\|178071_179538_-\|tail	phage tail protein	R9TMQ0	Vibrio_phage	1.1e-119	47.8
178434:178449	attL	NA	NA	NA	NA
WP_158118983.1\|179625_180168_-\|tail	phage tail protein	A9ZT45	Vibrio_virus	6.2e-79	85.3
WP_158118984.1\|180167_180899_-	hypothetical protein	A0A1V0E875	Vibrio_phage	8.4e-47	58.9
WP_046121709.1\|180900_181458_-\|tail	phage tail protein I	R9TR33	Vibrio_phage	2.9e-63	63.7
WP_158118985.1\|181457_182336_-\|plate	phage baseplate protein	R9TML5	Vibrio_phage	2.1e-68	46.9
WP_033935878.1\|182332_182674_-\|plate	phage baseplate protein	A0A088FV58	Escherichia_phage	1.2e-32	60.4
WP_158118986.1\|182675_183329_-\|plate	phage baseplate assembly protein V	V5YUM9	Pseudomonas_phage	6.8e-16	31.9
WP_158118987.1\|183325_183850_-	hypothetical protein	R9TNK0	Vibrio_phage	1.3e-22	37.0
WP_113598385.1\|183842_184448_-	hypothetical protein	R9TR34	Vibrio_phage	1.0e-58	53.2
WP_094392025.1\|184410_184761_-	hypothetical protein	R9TMM0	Vibrio_phage	4.9e-29	53.4
WP_158118988.1\|184753_184990_-	hypothetical protein	NA	NA	NA	NA
WP_002051907.1\|185042_187022_-\|capsid	phage major capsid protein	A0A1W6JT82	Escherichia_phage	1.4e-157	46.6
WP_158118989.1\|186978_188547_-\|portal	phage portal protein	A0A088FVG5	Escherichia_phage	4.8e-116	42.3
WP_000236573.1\|188546_189074_-	hypothetical protein	A2I2W7	Vibrio_virus	5.3e-11	31.3
WP_158119415.1\|189067_191020_-\|terminase	terminase	A2I2W6	Vibrio_virus	5.8e-212	58.9
WP_113609152.1\|191030_191600_-	hypothetical protein	B0ZSE9	Halomonas_phage	2.2e-26	38.8
WP_158118990.1\|192044_193274_-\|integrase	tyrosine-type recombinase/integrase	A0A2D1GND4	Pseudomonas_phage	1.0e-60	35.7
WP_141239284.1\|193732_194098_-	hypothetical protein	NA	NA	NA	NA
WP_071170792.1\|194099_194627_-	lysozyme	A0A1S6KZY9	Salmonella_phage	3.3e-29	41.3
WP_001156560.1\|194607_194820_-	hypothetical protein	NA	NA	NA	NA
WP_158118991.1\|194971_195916_-	DUF4435 domain-containing protein	NA	NA	NA	NA
WP_158118992.1\|195917_197069_-	AAA family ATPase	NA	NA	NA	NA
WP_158118993.1\|197308_197935_-	hypothetical protein	NA	NA	NA	NA
WP_158118994.1\|197936_198569_-	hypothetical protein	A0A2I7RNS2	Vibrio_phage	1.3e-64	59.2
WP_046121726.1\|198568_198988_-	hypothetical protein	A0A2I7RQ30	Vibrio_phage	7.0e-06	30.6
WP_167517800.1\|198956_199865_-	hypothetical protein	A0A067ZIA1	Vibrio_phage	5.2e-22	45.1
WP_148506700.1\|200120_200666_-	hypothetical protein	NA	NA	NA	NA
WP_158118996.1\|200734_200929_-	hypothetical protein	NA	NA	NA	NA
WP_148516772.1\|201041_201743_+	LexA family transcriptional repressor	H9C160	Pectobacterium_phage	8.1e-31	50.7
WP_148516773.1\|201883_202153_+	hypothetical protein	NA	NA	NA	NA
WP_046121729.1\|202179_202485_+	hypothetical protein	NA	NA	NA	NA
WP_167517801.1\|202789_202948_+	helix-turn-helix domain-containing protein	NA	NA	NA	NA
WP_158118998.1\|202955_204782_-	hypothetical protein	NA	NA	NA	NA
WP_058666995.1\|204848_205274_-	hypothetical protein	NA	NA	NA	NA
WP_158118999.1\|205261_206263_-	hypothetical protein	NA	NA	NA	NA
WP_158119000.1\|206255_207461_-\|integrase	integrase arm-type DNA-binding domain-containing protein	A0A1P8DTG6	Proteus_phage	7.1e-59	33.0
208245:208260	attR	NA	NA	NA	NA

DBSCAN-SWA_2

730272 : 805527

Vibrio_phage(69.05%)

integrase,transposase,head,tail,capsid,portal,terminase

attL 754811:754826|attR 773079:773094

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_055029372.1\|730272_731487_-\|transposase	transposase	NA	NA	NA	NA
WP_158119194.1\|731586_733005_-	tryptophanase	NA	NA	NA	NA
WP_081017583.1\|733363_733435_-	tryptophanase leader peptide	NA	NA	NA	NA
WP_000462099.1\|733670_733883_+	hypothetical protein	NA	NA	NA	NA
WP_001236195.1\|733918_734401_-	L,D-transpeptidase family protein	NA	NA	NA	NA
WP_095470168.1\|734819_736952_+	GGDEF domain-containing protein	A0A127AWB9	Bacillus_phage	1.9e-14	35.5
WP_000078819.1\|737197_737410_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	1.8e-18	62.9
WP_055027895.1\|737600_738317_-	SIMPL domain-containing protein	NA	NA	NA	NA
WP_158119195.1\|738458_740102_-	protein BatD	NA	NA	NA	NA
WP_158119196.1\|740095_741952_-	VWA domain-containing protein	NA	NA	NA	NA
WP_158119197.1\|741953_742910_-	VWA domain-containing protein	NA	NA	NA	NA
WP_000665189.1\|742896_743385_-	DUF4381 domain-containing protein	NA	NA	NA	NA
WP_158119198.1\|743381_744314_-	DUF58 domain-containing protein	NA	NA	NA	NA
WP_000009894.1\|744317_745274_-	MoxR family ATPase	NA	NA	NA	NA
WP_000475375.1\|745677_747594_+	methyl-accepting chemotaxis protein	A0A2H4J162	uncultured_Caudovirales_phage	1.9e-26	35.7
WP_000997592.1\|747653_747854_+	chromosome segregation ATPase	NA	NA	NA	NA
WP_000549398.1\|747958_748612_-	DsbA family oxidoreductase	NA	NA	NA	NA
WP_055029381.1\|749280_750489_+	NupC/NupG family nucleoside CNT transporter	NA	NA	NA	NA
WP_000793853.1\|750836_752069_+	peptidase T	NA	NA	NA	NA
WP_055029382.1\|752279_753137_+	mechanosensitive ion channel family protein	NA	NA	NA	NA
WP_032470271.1\|753133_754726_-	nitric oxide reductase transcriptional regulator NorR	NA	NA	NA	NA
754811:754826	attL	NA	NA	NA	NA
WP_158119199.1\|754919_756104_+	NO-inducible flavohemoprotein	NA	NA	NA	NA
WP_000106983.1\|756161_756371_-	cold-shock protein	Q9AZD3	Lactococcus_phage	5.7e-17	68.3
WP_095469038.1\|756730_756955_+	alternative ribosome-rescue factor A	NA	NA	NA	NA
WP_000765286.1\|757363_757741_+	hypothetical protein	NA	NA	NA	NA
WP_055029385.1\|757924_758164_+	hypothetical protein	NA	NA	NA	NA
WP_000009682.1\|758251_759256_+	response regulator	NA	NA	NA	NA
WP_000880545.1\|759255_759702_+	PAS domain-containing protein	NA	NA	NA	NA
WP_167517805.1\|759752_761225_+	NAD(P)H-hydrate dehydratase	NA	NA	NA	NA
WP_055029386.1\|761213_762209_-	2-hydroxyacid dehydrogenase	M1HUW8	Acanthocystis_turfacea_Chlorella_virus	1.0e-71	43.9
WP_055029387.1\|762390_763728_+	Na+/H+ antiporter NhaC family protein	NA	NA	NA	NA
WP_000761426.1\|763734_764559_-	potassium channel family protein	A0A1B0Y2S3	Lactobacillus_phage	1.9e-07	33.1
WP_158119200.1\|764623_765175_-	outer membrane beta-barrel protein	NA	NA	NA	NA
WP_001217706.1\|765695_766739_+	GMP reductase	A0A0N9Q9A5	Chrysochromulina_ericina_virus	1.3e-98	53.9
WP_158119432.1\|766871_767903_-\|integrase	tyrosine-type recombinase/integrase	A0A1S6L016	Salmonella_phage	2.1e-99	53.8
WP_158119201.1\|768063_769215_+	DNA (cytosine-5-)-methyltransferase	A0A1P8CX13	Bacillus_phage	2.1e-20	31.5
WP_158119202.1\|769338_771288_+	DUF262 domain-containing protein	NA	NA	NA	NA
WP_158119203.1\|771289_772441_+	DUF3696 domain-containing protein	Q2P9X8	Enterobacteria_phage	2.5e-13	33.1
WP_158119204.1\|772443_773358_+	hypothetical protein	NA	NA	NA	NA
773079:773094	attR	NA	NA	NA	NA
WP_158119205.1\|773369_774362_-	HNH endonuclease	NA	NA	NA	NA
WP_158119206.1\|774365_775019_-	chromosome partitioning protein ParA	A0A166YHA0	Vibrio_phage	1.1e-79	71.8
WP_000959091.1\|775186_775399_+	hypothetical protein	U3PFJ1	Vibrio_phage	3.2e-23	78.6
WP_148516817.1\|775509_776049_+	transcriptional regulator	U3PIJ8	Vibrio_phage	3.0e-94	98.3
WP_158119207.1\|776570_777089_+	hypothetical protein	U3PB56	Vibrio_phage	2.2e-57	76.5
WP_001198812.1\|777088_777316_+	hypothetical protein	U3PIK2	Vibrio_phage	2.6e-23	61.3
WP_123161953.1\|777514_777802_-	hypothetical protein	NA	NA	NA	NA
WP_158119208.1\|777840_780426_+	replication endonuclease	A0A166YHE2	Vibrio_phage	0.0e+00	98.6
WP_057551844.1\|780569_781079_-	hypothetical protein	NA	NA	NA	NA
WP_158119209.1\|781582_781801_+	hypothetical protein	Q8HA64	Vibrio_phage	1.6e-30	97.2
WP_158119210.1\|781795_782047_-	transcriptional regulator	Q8HA63	Vibrio_phage	5.6e-43	98.8
WP_158119211.1\|782126_782660_-	hypothetical protein	NA	NA	NA	NA
WP_158119212.1\|782664_782829_-	hypothetical protein	NA	NA	NA	NA
WP_158119213.1\|783038_784061_-\|portal	phage portal protein	U3PFK6	Vibrio_phage	3.3e-190	95.0
WP_158119214.1\|784057_785878_-\|terminase	terminase	U3PIL1	Vibrio_phage	0.0e+00	97.5
WP_158119215.1\|786051_786942_+\|capsid	capsid protein	R9TRS3	Vibrio_phage	5.4e-88	58.7
WP_000930691.1\|786941_787943_+\|capsid	phage major capsid protein, P2 family	R9TPZ5	Vibrio_phage	1.5e-107	61.9
WP_158119216.1\|787953_788676_+\|terminase	terminase	U3PCG2	Vibrio_phage	1.7e-121	94.3
WP_158119217.1\|788782_789244_+\|head	head completion/stabilization protein	U3PFL1	Vibrio_phage	3.4e-78	99.3
WP_158119218.1\|789240_789729_+	hypothetical protein	U3PIL4	Vibrio_phage	1.7e-88	98.8
WP_158119219.1\|789715_790375_+	phage virion morphogenesis protein	U3PDG7	Vibrio_phage	2.6e-116	99.5
WP_158119220.1\|790376_791486_+	DUF2586 family protein	U3PB71	Vibrio_phage	3.9e-205	98.4
WP_158119221.1\|791485_791944_+	DUF2597 family protein	U3PCG7	Vibrio_phage	1.6e-59	78.9
WP_000382491.1\|791958_792168_+	TraR/DksA family transcriptional regulator	U3PFL5	Vibrio_phage	2.0e-33	100.0
WP_001077689.1\|792164_792392_+	hypothetical protein	U3PIL8	Vibrio_phage	2.1e-36	100.0
WP_158119222.1\|792378_792966_+	glycoside hydrolase family protein	U3PDH1	Vibrio_phage	4.7e-109	99.0
WP_000990572.1\|792940_793282_+	hypothetical protein	U3PB75	Vibrio_phage	1.1e-52	100.0
WP_001892969.1\|793331_793493_+	hypothetical protein	A0A166YHN7	Vibrio_phage	3.7e-24	98.1
WP_000165784.1\|793489_793771_+	hypothetical protein	A9ZT39	Vibrio_virus	3.7e-43	96.8
WP_158119223.1\|793967_795785_+\|tail	phage tail tape measure protein	U3PFL8	Vibrio_phage	0.0e+00	99.3
WP_158119224.1\|795774_796107_+	DUF2590 family protein	U3PIM1	Vibrio_phage	2.5e-54	99.1
WP_158119225.1\|797298_797958_+\|tail	phage tail protein	U3PB79	Vibrio_phage	2.2e-123	97.7
WP_158119226.1\|799530_800061_+	hypothetical protein	A9ZT45	Vibrio_virus	3.2e-40	86.2
WP_158119227.1\|800063_800957_+	hypothetical protein	U3PIM3	Vibrio_phage	1.2e-151	94.3
WP_158119228.1\|800944_801418_+	DNA-binding protein	U3PDI0	Vibrio_phage	1.5e-76	99.4
WP_158119229.1\|801414_803046_+	hypothetical protein	A0A160DHT6	Vibrio_phage	2.3e-310	98.2
WP_158119230.1\|804132_805527_-	DEAD/DEAH box helicase	Q5GF26	Diachasmimorpha_longicaudata_entomopoxvirus	3.8e-48	36.1

DBSCAN-SWA_3

957889 : 1007199

Vibrio_phage(44.44%)

integrase,portal,terminase

attL 954079:954092|attR 969752:969765

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
954079:954092	attL	NA	NA	NA	NA
WP_032479200.1\|957889_958885_-	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	7.8e-88	51.4
WP_158119297.1\|958937_959369_-	hypothetical protein	NA	NA	NA	NA
WP_158119298.1\|959700_960669_-	hypothetical protein	A0A2I7R7C8	Vibrio_phage	1.9e-06	27.8
WP_032479202.1\|960685_960886_-	hypothetical protein	NA	NA	NA	NA
WP_032479203.1\|960893_961175_-	hypothetical protein	NA	NA	NA	NA
WP_032479204.1\|961174_961819_-	ParA family protein	J9Q7R7	Salmonella_phage	1.7e-14	27.6
WP_148527904.1\|961837_962350_-	PadR family transcriptional regulator	A0A2I7RSZ7	Vibrio_phage	8.3e-09	35.7
WP_148527905.1\|962373_962883_-	hypothetical protein	NA	NA	NA	NA
WP_158119299.1\|963465_964110_-	LexA family transcriptional regulator	NA	NA	NA	NA
WP_158119300.1\|964273_964528_+	hypothetical protein	K7PHA1	Enterobacteria_phage	3.2e-14	50.0
WP_158119301.1\|965068_965866_+	hypothetical protein	W8EA44	Vibrio_phage	9.3e-07	31.1
WP_032479254.1\|966367_966832_+	VRR-NUC domain-containing protein	M4SRS1	Psychrobacter_phage	8.0e-11	34.5
WP_167517770.1\|967082_967877_+	hypothetical protein	NA	NA	NA	NA
WP_167517771.1\|967857_968025_+	hypothetical protein	NA	NA	NA	NA
WP_032479212.1\|968028_969207_+\|integrase	site-specific integrase	A0A067ZJC5	Vibrio_phage	3.2e-72	38.7
WP_032479215.1\|969609_970452_+	hypothetical protein	A0A2R2Z334	Escherichia_phage	7.0e-05	22.6
969752:969765	attR	NA	NA	NA	NA
WP_032479216.1\|970444_972142_+\|terminase	terminase	A0A1I9KFB6	Aeromonas_phage	1.4e-217	64.8
WP_167517772.1\|972141_974226_+\|portal	portal protein	A0A088CE71	Shigella_phage	4.3e-205	58.4
WP_032479255.1\|974443_974770_+	membrane protein	R9TR41	Vibrio_phage	2.5e-19	43.4
WP_032479218.1\|974843_975362_+	glycoside hydrolase family 108 protein	H9C0H1	Vibrio_phage	9.8e-58	59.8
WP_167517773.1\|975373_975532_+	hypothetical protein	NA	NA	NA	NA
WP_167517774.1\|975537_975714_+	hypothetical protein	NA	NA	NA	NA
WP_158119302.1\|975880_976471_+	hypothetical protein	A0A2I7R929	Vibrio_phage	2.0e-27	49.2
WP_032479220.1\|976486_976708_+	hypothetical protein	NA	NA	NA	NA
WP_148527912.1\|976710_977310_+	hypothetical protein	A0A2D0Z205	Vibrio_phage	1.2e-51	55.9
WP_158119303.1\|977376_978441_+	ATPase	A0A2L1IV47	Escherichia_phage	1.6e-25	29.0
WP_148527914.1\|978505_979711_+	DUF4043 family protein	A0A088CC32	Shigella_phage	1.3e-132	57.6
WP_032479223.1\|979737_980118_+	hypothetical protein	M4MCI2	Vibrio_phage	3.3e-10	35.1
WP_032479224.1\|980172_980652_+	hypothetical protein	A0A1I9KFH0	Aeromonas_phage	5.5e-23	53.9
WP_032479225.1\|980654_981254_+	hypothetical protein	NA	NA	NA	NA
WP_001143284.1\|981253_981883_+	hypothetical protein	A0A1B1ITG1	uncultured_Mediterranean_phage	6.0e-17	30.2
WP_158119304.1\|984676_985756_+	hypothetical protein	A0A0B5H8M6	Vibrio_phage	2.8e-99	54.6
WP_158119305.1\|985845_987453_+	hypothetical protein	A0A1I9KFD2	Aeromonas_phage	4.4e-125	45.4
WP_158119306.1\|987452_989585_+	DUF1983 domain-containing protein	A0A2L1IV54	Escherichia_phage	6.0e-53	29.1
WP_032479229.1\|989589_989952_+	hypothetical protein	NA	NA	NA	NA
WP_167517775.1\|989938_990334_+	hypothetical protein	NA	NA	NA	NA
WP_158119307.1\|990333_990984_+	hypothetical protein	A0A1I9KFE8	Aeromonas_phage	3.6e-41	46.2
WP_148527921.1\|990987_991365_+	hypothetical protein	A0A1I9KFD7	Aeromonas_phage	6.9e-21	52.8
WP_032479232.1\|991367_991628_+	hypothetical protein	NA	NA	NA	NA
WP_158119308.1\|991627_993106_+	ATPase	M4MHC7	Vibrio_phage	5.1e-43	35.2
WP_032479234.1\|993134_993476_-	hypothetical protein	NA	NA	NA	NA
WP_032479235.1\|993468_993729_-	AbrB/MazE/SpoVT family DNA-binding domain-containing protein	NA	NA	NA	NA
WP_158119309.1\|993912_1007199_+	PLxRFG domain-containing protein	A0A240F4T3	Ochrobactrum_phage	0.0e+00	30.1

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046820

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046819

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection