CRISPRimmunity

Please click to download your results

Overview of predicted results

Overview of the results

Contig_ID	Contig_def	CRISPR array number	Contig Signature genes	Prophage number
NZ_CP046829	Vibrio parahaemolyticus strain 2012AW-0224 chromosome 2, complete sequence	1 crisprs	cas3,DEDDh,WYL,csa3,RT	1
NZ_CP046831	Vibrio parahaemolyticus strain 2012AW-0224 chromosome 1, complete sequence	0 crisprs	DEDDh,DinG,csx1,cas3,RT,csa3,WYL	4
NZ_CP046830	Vibrio parahaemolyticus strain 2012AW-0224 plasmid unnamed1, complete sequence	0 crisprs	NA	5

Results visualization

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Crispr_ID: NZ_CP046829_1

CRISPR_ID

CRISPR_location

CRISPR_type

Repeat_type

Spacer_info

Cas_protein_info

CRISPR-Cas_info

NZ_CP046829_1

454950-455047

Orphan

Consensus_repeat	Method
TATTTTTAAAATGCCTTTTCAAAAA	CRISPRCasFinder

1 spacers

DEDDh

The CRISPR arrays of NZ_CP046829_1

>merge|NZ_CP046829|1|454950-455047|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAATTTGAAACCGCGCAATTAAAGAATTCAGAAAAACAAGATCGCAATCAATATTTTTAAAACGCCTTTTCAAAAA

>NZ_CP046829|1|1|454950-455047|CRISPRCasFinder
TATTTTTAAAATGCCTTTTCAAAAA	TTTGAAACCGCGCAATTAAAGAATTCAGAAAAACAAGATCGCAATCAA
TATTTTTAAAACGCCTTTTCAAAAA

Protein	Signature genes	Signature genes Name	Protein_function
NZ_CP046829.1\|WP_005497706.1\|455926_456451_+\|YgjV-family-protein	unknown	unknown	gnl\|CDD\|378474
NZ_CP046829.1\|WP_031847111.1\|455146_455908_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	unknown	unknown	gnl\|CDD\|181605
NZ_CP046829.1\|WP_005482867.1\|452156_454025_-\|CBS-domain-containing-protein	unknown	unknown	gnl\|CDD\|225457
NZ_CP046829.1\|WP_031847112.1\|451443_452154_-\|DNA-polymerase-III-subunit-epsilon	DEDDh	cd06127_DEDDh_CAS-I	gnl\|CDD\|236392
NZ_CP046829.1\|WP_083135601.1\|444931_445336_-\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046829.1\|WP_005464966.1\|447343_448183_-\|S-formylglutathione-hydrolase	unknown	unknown	gnl\|CDD\|178061
NZ_CP046829.1\|WP_031847108.1\|460280_462020_-\|transporter	unknown	unknown	gnl\|CDD\|271371
NZ_CP046829.1\|WP_025501292.1\|449686_450493_+\|arylamine-N-acetyltransferase	unknown	unknown	gnl\|CDD\|366312
NZ_CP046829.1\|WP_031847109.1\|457532_458444_+\|alpha/beta-hydrolase	unknown	unknown	gnl\|CDD\|223730
NZ_CP046829.1\|WP_031847110.1\|456819_457455_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	unknown	unknown	gnl\|CDD\|181746
NZ_CP046829.1\|WP_005482845.1\|462149_462827_+\|porin	unknown	unknown	gnl\|CDD\|368776
NZ_CP046829.1\|WP_005464972.1\|450573_451443_+\|LysR-family-transcriptional-regulator	unknown	unknown	gnl\|CDD\|176159
NZ_CP046829.1\|WP_005482833.1\|446436_446898_-\|oxidoreductase	unknown	unknown	gnl\|CDD\|226429
NZ_CP046829.1\|WP_005467181.1\|456458_456779_+\|cupin-domain-containing-protein	unknown	unknown	gnl\|CDD\|380366
NZ_CP046829.1\|WP_005497702.1\|454108_454906_-\|DNA-binding-transcriptional-regulator-KdgR	unknown	unknown	gnl\|CDD\|185046
NZ_CP046829.1\|WP_005460834.1\|459483_460107_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	unknown	unknown	gnl\|CDD\|235577
NZ_CP046829.1\|WP_031847107.1\|462842_465071_+\|hypothetical-protein	unknown	unknown	unknown
NZ_CP046829.1\|WP_083135602.1\|445345_446437_-\|GGDEF-domain-containing-protein	unknown	unknown	gnl\|CDD\|143635
NZ_CP046829.1\|WP_005482884.1\|458542_459472_+\|sugar-kinase	unknown	unknown	gnl\|CDD\|238571
NZ_CP046829.1\|WP_005464962.1\|448244_449393_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	unknown	unknown	gnl\|CDD\|176260

Protein	Function_ID	Function_description	E-value
NZ_CP046829.1\|WP_005497706.1\|455926_456451_+\|YgjV-family-protein	gnl\|CDD\|378474	pfam10688, Imp-YgjV, Bacterial inner membrane protein. This is a family of inner membrane proteins. Many of the members are YgjV protein.	9.00507e-50
NZ_CP046829.1\|WP_005482867.1\|452156_454025_-\|CBS-domain-containing-protein	gnl\|CDD\|225457	COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms].	2.84814e-139
NZ_CP046829.1\|WP_025501292.1\|449686_450493_+\|arylamine-N-acetyltransferase	gnl\|CDD\|366312	pfam00797, Acetyltransf_2, N-acetyltransferase. Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30kDa. It facilitates the transfer of an acetyl group from Acetyl Coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (M. tuberculosis, M. smegmatis etc) to man. It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat Tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid.	1.53608e-97
NZ_CP046829.1\|WP_031847112.1\|451443_452154_-\|DNA-polymerase-III-subunit-epsilon	gnl\|CDD\|236392	PRK09146, PRK09146, DNA polymerase III subunit epsilon; Validated.	1.30706e-39
NZ_CP046829.1\|WP_005464966.1\|447343_448183_-\|S-formylglutathione-hydrolase	gnl\|CDD\|178061	PLN02442, PLN02442, S-formylglutathione hydrolase.	5.2905e-143
NZ_CP046829.1\|WP_031847108.1\|460280_462020_-\|transporter	gnl\|CDD\|271371	cd11477, SLC5sbd_u1, Uncharacterized bacterial solute carrier 5 subfamily; putative solute-binding domain. SLC5 (also called the sodium/glucose cotransporter family or solute sodium symporter family) is a family of proteins that co-transports Na+ with sugars, amino acids, inorganic ions or vitamins. Prokaryotic members of this family include Vibrio parahaemolyticus glucose/galactose (vSGLT), and Escherichia coli proline (PutP) and pantothenate (PutF) cotransporters. One member of the SLC5 family, human SGLT3, has been characterized as a glucose sensor and not a transporter. This subfamily belongs to the solute carrier 5 (SLC5) transporter family.	4.17468e-108
NZ_CP046829.1\|WP_005482884.1\|458542_459472_+\|sugar-kinase	gnl\|CDD\|238571	cd01166, KdgK, 2-keto-3-deoxygluconate kinase (KdgK) phosphorylates 2-keto-3-deoxygluconate (KDG) to form 2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the common intermediate product, that allows organisms to channel D-glucuronate and/or D-galacturinate into the glycolysis and therefore use polymers, like pectin and xylan as carbon sources.	1.15929e-102
NZ_CP046829.1\|WP_031847109.1\|457532_458444_+\|alpha/beta-hydrolase	gnl\|CDD\|223730	COG0657, Aes, Esterase/lipase [Lipid metabolism].	1.45827e-18
NZ_CP046829.1\|WP_031847110.1\|456819_457455_+\|RpiB/LacA/LacB-family-sugar-phosphate-isomerase	gnl\|CDD\|181746	PRK09273, PRK09273, hypothetical protein; Provisional.	2.76139e-144
NZ_CP046829.1\|WP_005482845.1\|462149_462827_+\|porin	gnl\|CDD\|368776	pfam06178, KdgM, Oligogalacturonate-specific porin protein (KdgM). This family consists of several bacterial proteins which are homologous to the oligogalacturonate-specific porin protein KdgM from Erwinia chrysanthemi. The phytopathogenic Gram-negative bacteria Erwinia chrysanthemi secretes pectinases, which are able to degrade the pectic polymers of plant cell walls, and uses the degradation products as a carbon source for growth. KdgM is a major outer membrane protein, whose synthesis is strongly induced in the presence of pectic derivatives. KdgM behaves like a voltage-dependent porin that is slightly selective for anions and that exhibits fast block in the presence of trigalacturonate. In contrast to most porins, KdgM seems to be monomeric.	3.08357e-24
NZ_CP046829.1\|WP_005464972.1\|450573_451443_+\|LysR-family-transcriptional-regulator	gnl\|CDD\|176159	cd08470, PBP2_CrgA_like_1, The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator CrgA-like, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of an uncharacterized LysR-type transcriptional regulator (LTTR) CrgA-like 1. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene which coding for an NADPH-quinone reductase and that its action is increased by MBL (alpha-methylene-gamma-butyrolactone), an inducer of NADPH-quinone oxidoreductase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase domains. This interaction triggers the ligand translocation across the cytoplasmic membrane energized by ATP hydrolysis.	1.14139e-108
NZ_CP046829.1\|WP_005482833.1\|446436_446898_-\|oxidoreductase	gnl\|CDD\|226429	COG3915, COG3915, Uncharacterized protein conserved in bacteria [Function unknown].	3.9997e-40
NZ_CP046829.1\|WP_005467181.1\|456458_456779_+\|cupin-domain-containing-protein	gnl\|CDD\|380366	cd02238, cupin_KdgF, pectin degradation protein KdgF and related proteins, cupin domain. This family includes bacterial and archaeal pectin degradation protein KdgF that catalyzes the linearization of unsaturated uronates from both pectin and alginate, which are polysaccharides found in the cell walls of plants and brown algae, respectively, and represent an important source of carbon. These polysaccharides, mostly consisting of chains of uronates, can be metabolized by bacteria through a pathway of enzymatic steps to the key metabolite 2-keto-3-deoxygluconate (KDG). Pectin degradation is used by many plant-pathogenic bacteria during infection, and also, pectin and alginate can both represent abundant sources of carbohydrate for the production of biofuels. These proteins belong to the cupin superfamily with a conserved "jelly roll-like" beta-barrel fold.	1.13072e-54
NZ_CP046829.1\|WP_005497702.1\|454108_454906_-\|DNA-binding-transcriptional-regulator-KdgR	gnl\|CDD\|185046	PRK15090, PRK15090, DNA-binding transcriptional regulator KdgR; Provisional.	0
NZ_CP046829.1\|WP_005464962.1\|448244_449393_-\|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase	gnl\|CDD\|176260	cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases. Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding.	0
NZ_CP046829.1\|WP_005460834.1\|459483_460107_+\|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase	gnl\|CDD\|235577	PRK05718, PRK05718, keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional.	4.28455e-121
NZ_CP046829.1\|WP_083135602.1\|445345_446437_-\|GGDEF-domain-containing-protein	gnl\|CDD\|143635	cd01949, GGDEF, Diguanylate-cyclase (DGC) or GGDEF domain. Diguanylate-cyclase (DGC) or GGDEF domain: Originally named after a conserved residue pattern, and initially described as a domain of unknown function 1 (DUF1). This domain is widely present in bacteria, linked to a wide range of non-homologous domains in a variety of cell signaling proteins. The domain shows homology to the adenylyl cyclase catalytic domain. This correlates with the functional information available on two GGDEF-containing proteins, namely diguanylate cyclase and phosphodiesterase A of Acetobacter xylinum, both of which regulate the turnover of cyclic diguanosine monophosphate. Together with the EAL domain, GGDEF might be involved in regulating cell surface adhesion in bacteria.	5.59443e-44
NZ_CP046829.1\|WP_031847111.1\|455146_455908_+\|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD	gnl\|CDD\|181605	PRK08993, PRK08993, 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase KduD.	0

>NZ_CP046829.1|WP_005497702.1|454108_454906_-|DNA-binding-transcriptional-regulator-KdgR
MKGATMEKSTQPEAVSSVLKVFHILQALGEQKAIGVSELSQRLMMSKATTYRFLQTMKSLGYVSQEGEADKYSLTLKLFELGAKSLEYVDLIELADKEMRHISEQTNEALHLGALDENAIIYIHKIDSGYNLRMQSRIGRRNPLYSTAIGKVLLSERDESFVRDVLSDVEFIKHTEKTLENTDQVLEELAKVRDFHYAEDNEEQEPGLRCIAAPIYDRFGQIIAGLSISFPTIRFDEERMEYYVGLLHQAGKNISEQLGYHDYPA
>NZ_CP046829.1|WP_005482867.1|452156_454025_-|CBS-domain-containing-protein
MGTSVTPNIFDFLIKIDPFDKLPEPVVESIANSVKVKYLVRGETIGFSALCDQRYLYIIRTGAIEQRTPNGELRARLGQDDQFGFTFLDPLENAEDGYQAEAIEDSLLYLIPHSELKLVSEEHPEFADYFAAQANVRLSSAVKYVCRKEEKGLFFRTVGEIASENIAIVDVNDSIRSVAQTMCGKQRSSCAVVMKEGEIIGLVTDRDMTKSVVAQDMDTNQPIADVMTPNPVLIEDDAKVIQAISLMLQYNIRCLPVVHGKQVKGLLTTTHLVHNHRTQSLFLIEKIKYASSLNALAALKEERQTIFQALVESGVSAEIQGRVMSMIMDAFTRRIIQLNEELLGPPPCDYAWLVAGSHARNEVHMLSDQDSAIVLSDDATEEHKLYFTHLAMRVCNGLAACGYPLCDGKYMAASPKWCQPIRRWKEYYQKWVASPEYNKLLSISVFLEVRAIHGNREFVDQIQQHLHDCIQKSPSFIPALVRDAIDTQPPLGIFNNLVLEKGGENSNTLNIKKYALNLIIDLARIFSLAAGGSLTGTEERFRYAAQHGTLSKDSVENIIGAYRFITQVRFRHQLNAILAGTTPDNHIAPDDFSSFERKHLKDAFKIISELQDVAKLKFVKGA
>NZ_CP046829.1|WP_031847112.1|451443_452154_-|DNA-polymerase-III-subunit-epsilon
MIKRWFKRWETPLSPEQKRQAIHVVDDWPMVLKDYLQRPLVDDSTTLKDLSFVALDFETTGVDAQGDKILSIGVVDLTLDGIDIASSKEWYICHGQFIKPETAQINGLTPQDLAKGLPLDEGMNRLLERITGKVVLAHGCCIEKAFIHAYFSSRYQIEDFPAYFIDTLQIEKQFSYAGKSGAHSSYQLDDLRRYYHLPGYLSHSAASDALACAELFLVQSKKLTALPDVTLRQLMR
>NZ_CP046829.1|WP_005464972.1|450573_451443_+|LysR-family-transcriptional-regulator
MANWEGVSEFVAVAETNSFTGAAAKLKTSVAQISRRVSALEERLAVKLLHRTTRKVSLSEAGQLYYQQCKHLVEGLELAELAVTQMQTEPRGLLRVTAPVTYGEMNLAPLLHQFLEKYPRVDLDLVLTNQKLDLIEQGVDVAIRLGRLQDSSMIAKRLSSRQTYVCASPMYLERFGEPHTLSELGRHQCLVGSVDYWHFKENKRDKSLRVSGRIKCNSGFALVDAAKRGLGLVQLPDYYVQEALDSGELVEVLTDYRDDREGIWALYPQSRNLSPKVRLLIDFLAQELA
>NZ_CP046829.1|WP_025501292.1|449686_450493_+|arylamine-N-acetyltransferase
MNKTDLNAYLTKLGLPSELPADLESLHKIHVAQHRCLPFENFDISLQRGISVEIEDIIQKTVYHSRGGYCFELNGLMLDVLKTLGFEARSLLGRVHVMGTPTGRSHQITLVTLDEQAWIVDVGFGSNTPRAPLPFILNQVIQTDLQTFRFVEDAQFGYFLQVLSTDGTDTWNNLYSFDLEFVFAGDIACGNFFTSTSPHSRFTSARVAAKATESGLVTLLNYTLKYTSEGEQTELELEPGQAYLDALKEYFGIELDAQYGDLRPLPDA
>NZ_CP046829.1|WP_005464962.1|448244_449393_-|S-(hydroxymethyl)glutathione-dehydrogenase/class-III-alcohol-dehydrogenase
MTLEIKPGQTHIKSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDAFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTSVEVGDHVIPLYTAECGECKFCKSGKTNLCQAVRETQGKGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVNKQAPLEEVCLLGCGVTTGMGAVLNTAKVEKGDTVAIFGLGGIGLSAIIGARMAGASRIIGIDINESKFDLAKQLGATDVINPQKFDKPIQEVIVEMTDGGVDYSFECIGNVNVMRQALECCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRSELPEIVNRYMAGEFGLQEFITHTMGLEDVNKAFDLMHEGKSIRTVIHMDK
>NZ_CP046829.1|WP_005464966.1|447343_448183_-|S-formylglutathione-hydrolase
MTIENVSQTKVFGGWHKQYTHDSKALNCTMRFAIFLPPNATKSNPVPALYWLSGLTCTDENFMQKAGAFRMAAELGIAIIAPDTSPRGEGVADDASYDLGQGAGFYLNATQAPWSLHYHMYDYVTQELPAIIEANFPVSDVKSISGHSMGGHGALTIGLKNPTLYRSISAFSPISNPMQCPWGQKAFTAYLGTDIESWKQYDASELLKKEKSPLPILVDQGDADGFLSEQLKPEVLLAAAKQHGSELNLRMQSGYDHSYYFISSFIDNHLNFHAKYLFA
>NZ_CP046829.1|WP_005482833.1|446436_446898_-|oxidoreductase
MKKIVSLSLLLFAPFLSANSITFSSPQQPSVTLKLEELQSLPTTSYTTDLPWIQQSSEFLGVKLSTLLTHVYGSIPEQVDIGSLNNYHSTLSRKDIVRYQPILAYQQDHHYIKVRNKGPYWVIYPLSQYPELDHNEYHAQMVWQVNEMKIKQK
>NZ_CP046829.1|WP_083135602.1|445345_446437_-|GGDEF-domain-containing-protein
MKLSEAYPIKQKNYSTTSKMLLLVFATSLLLANVILLQQTRVLAQSFTDEQKQATWFLFQLSKELSELVSEARRLDENVLKIEGAELQYELAWSRFDLLINSKDVYNFFSRNHIQQYFLQLFNEFKELEPLLVEAKTGDSQAAAQFYRATQTLYLNLVEFVNQNFRLTSQVYETQKDESQRLMKAQYMLFATFVLSILSLTYFFYRESHFHRKLALSDPLTGLGNRNALFVTLRNNTRNRTAFSLCLLDLNGFKNVNDTYGHQAGDTVLCEIAKRLKDMNIDSFSTYRMGGDEFAVVIESSDVDAEEAKKHIHSVFDTPVLNANNVSSLSTSIGVAHYPSDSDNVDFLISIADKRMYKMKFQR
>NZ_CP046829.1|WP_083135601.1|444931_445336_-|hypothetical-protein
MMRKFMQVLLLLAVIAAGVLAWVFIPSHETIGQKTLEQALNDDYSLVGHRIYSTDPDAGNRFGYFVLATGQSIEEQEPFLVTSDQFIRMEQTGDNTFSVTVNGRIYQYHNDLWVPKSDGKLQHFLVSATANYVR
>NZ_CP046829.1|WP_031847111.1|455146_455908_+|2-dehydro-3-deoxy-D-gluconate-5-dehydrogenase-KduD
MILDSFNLEGKVAIVTGCDTGLGQGMALGLAKAGCDIVGVNISEPTETIEKVEAEGRKFVDIRANLMKLDDIPTIVDRAVTELGRIDILVNNAGIIRRNDAIEFSEQDWDDVMNINVKSVFFMSQAVAKQFIAQGEGGKIINIASMLSFQGGIRVPSYTASKSGVMGVTRLMANEWASHGINVNAIAPGYMATNNTTALRADEQRNKEIVDRIPAARWGTPEDLAGPCVFLASKAADYINGYTIAVDGGWLAR
>NZ_CP046829.1|WP_005497706.1|455926_456451_+|YgjV-family-protein
MVDTTILAQALGFISFGLGFSVFYQKNDRHLKILMLIFNLNHLLHFLLLGSMVSALSALLSALRTTTAIFVSSKRVAAVFIVISLVSGFWVAEQWRDLWPIIGTVIGTYSVFCLSGIRMRIGFLLGASCWLTNNILVGSIGGTLLEMTVIVMNLLTIYRLHRQQSESMINQSSY
>NZ_CP046829.1|WP_005467181.1|456458_456779_+|cupin-domain-containing-protein
MFVFNQDIPMEDLGEGISRKVLAHSDNMMSVEVHFEEGAIGAMHSHPHEQLTYVLSGEFEFTIGDEKKIVKTGDTMYKEPNIEHGCVCLKAGVLIDTFTPMRKDFV
>NZ_CP046829.1|WP_031847110.1|456819_457455_+|RpiB/LacA/LacB-family-sugar-phosphate-isomerase
MKIALMMENSQAAKNAMVAGELNSVAGGLGHDVFNVGMTDENDHHLTYIHLGIMASILLNSKAVDFVVTGCGTGQGALMSCNLHPGVVCGYCLEPSDAFLFNQINNGNAISLAFAKGFGWAGELNVRYIFEKAFTGKRGEGYPIERAAPQQANATILNNVKSAVAKDVVEGLRAIDQELVKTAVGSTQFQECFFAHCQVPEIAEYVKSLLD
>NZ_CP046829.1|WP_031847109.1|457532_458444_+|alpha/beta-hydrolase
MHVAPITSLQTWFPEHPVLPLWSEPQIPSHLVQSYQERNPNELLPDRAVFDITHPEIVVFEPEQSNGIGILLMPGGGYQRVSVDKEGADSARVLNQAGFTVFVMTYRMPNEGHEFGAWTPLADAQRAMRLVRQLPLASHLSSIGVLGFSAGGHVAASLATSHALDIYPLQDEADRVSAKPDFCALMYPVISMNTDIAHMGSRAELLANLERESDLLRFSLEKQVTSDMPPCFLLHASDDTAVSVENSVVFWQALRQHEISTEMHLFEQGKHGFGIRDAQGLPVAAWPQLLSAWLQNLTEKARR
>NZ_CP046829.1|WP_005482884.1|458542_459472_+|sugar-kinase
MNPISRVAIIGECMVELKKHDGVLQQGFGGDTLNTAVYLSRLTKQHGVETSYVTGLGHDPFSREMLTAWREEGINTDMVYLSEDKLPGIYAIETAEDGERSFFYWRNDAAAKYWLRERALLSLVKDLCQHQMIYLSGISLAIISDDCRQMLIELLTMCRKEGVKIAFDNNFRPKLWPNIEQARDFYSKILSVTDMAFLTFDDEVMLWGDKHEDEAISRTKNFGVKEIIVKRGADDCFVVTQDQQHTVAALKVDAVVDTTAAGDSFSAGYLAKRILGGDVAESALAGHKVAGTVIQHRGAIIPSQAMPTI
>NZ_CP046829.1|WP_005460834.1|459483_460107_+|bifunctional-4-hydroxy-2-oxoglutarate-aldolase/2-dehydro-3-deoxy-phosphogluconate-aldolase
MKDLNQQLSEIKVVPVIAIKDAGKAVKLAQVLIENGLPCAEVTFRTEDAALAIKNMREAYPEMLIGAGTVLTSAQVDEAIDAGVDFIVSPGFNPTTVKYCQQRNVTIVPGVNNPSLVEQAMEMGLRTLKFFPAEPSGGVAMLKALSAVYPVKFMPTGGVSPSNVKDYLSISSVLACGGTWMVPGDLIDNEQWDELAKLVREVAGIIE
>NZ_CP046829.1|WP_031847108.1|460280_462020_-|transporter
MTLLDSMIVMIYLLFIGIAASLFRRFSTSSNDFLQGGGTMMWWMAGATAFMTQFSAWTFTGAAAKAYEDGISVMFIFWGNALGFFVAAAFFARRYRRLRVETAMEVIRVRFGHTSEQLFTWLSFPLTLIACAIWMNGLASFFSAVFAIEMSTTILAMGVVVTLIAVSGGAWTVSVTNVIQLILLIAITLVIGYTALQRFDSPSEVFAHATPIYGEQIRMPSLFVMWAIAMLLQQTMSNNHTLSCYRFLTTANDKDATKAAFVAGVLFVFAPVLWFMPAWFVAAQNIDLLAIYPALEQSANNAAYLYYIQHYMPQGLLGLVMVALVAATIAPLSSAHNRNAGIVVKSLYQVWFNPNATSRQQLMVGKIATIVSGVLATVTALLLASVESYSLFDMMIVFAAFIQMPINIPSLLALVSLKTPNWSGWATVMVGCAVSLFMMFIFDVQWLSSSPLTPRESKDLSVVATLAVHLLVTGGFFLFTQVFYAKEPPSIQQSRTALAIQLATPISDEELSPINHKQGLYVGSITALAGMLLILAGVVLAGSSQSIFVAIGCIVLLFSLFLLQPTQHSKRAWQKQKTK
>NZ_CP046829.1|WP_005482845.1|462149_462827_+|porin
MKVRYLTSALLLAMTSGLAAAASVDIRHEYVPDRDGDEHRDRIYVSHRFDNQIGFSVEAKWNYKDGHMGNAGHETGVSYRWKATDNFSLTPGINIDASPSGASVFKYNLTGAYKINDEWDVAARIRHGYKNTDDSRYNQLNLYANRKFEWGKLGVEAEYKDIHGGEGGWKDKGHDQLIDFKGEYTKLESGVIPFFAIAAITHKGDGSEFKDEYVPRFRVGLKYNF
>NZ_CP046829.1|WP_031847107.1|462842_465071_+|hypothetical-protein
MKKHTLALCLAAILAPAAHAAEIKVEDLTWKAITFGQSTDMNFGSTILPEKVGVNQLTVNGEAVAAGKLASTFTIESRGGKLANSHEGLTFYYTELPTDVNFTLSADVVLEQLGPETGATPNRQEGAGLMVRDILGAERLVPQPEGHEEFPSASNMVMNLMRSHTRTNDGMTNINASFREGVYQPWGTPGNRLSRVDYVEGVPYGTAETYRMTLTRTNDGFKVSYRNGEKFVEQAVKGANANIVEMQNSDSQYVGFFASRNAKMTVSNVDLQLAAADTVDAPKYAAKQGELVFQIASSPRSATKEYPVQARANYSGEFEVLHNGKVVAKQTVTAGELFSQWLTLDSGANQMEVRFTAIDGPNKETQAHRYSVDVVSLPDPMTLYVAPNGSDKGNGSQAQPLDFATAVELLPAGGTIILKDGDYQGMEIPLTASGSVDKLKHLRAEGDNVRFVSELRHEANYWHYQGIEVAGAQFIVHGSHNTFEKMVTHGAPDTGFVITSPENIGRALWASYNQVIESESYNNMDPSQINADGFAAKMRIGDGNTFIRCLSHHNIDDGWDLFNKVEDGANGAVTILDSISFSNGRTLDVANKGGTIGNGFKLGGEGIPVPHVVKNSLSFNNNMDGFTDNFNPGALVLSDNVSIDNKRFNYLFRKSPYTGEIEQGTFTNNRSYRFHVSSKYDDVINSAKSTGNALIENGTTYTSDGKAVDSKTLAPLKQASVIDTQQAIPGKQEAMQLKQLIH

You can click texts colored in the table to view more detailed information

Click the colored protein region to show detailed information

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

1451850 : 1502830

uncultured_marine_virus(11.11%)

plate,transposase

The bacterium proteins that are colored denote the protein is present at specific phage-related keywords (such as 'capsid', 'head', 'integrase', 'plate', 'tail', 'fiber', 'coat', 'transposase', 'portal', 'terminase', 'protease' or 'lysin' and 'tRNA')

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_001352368.1\|1451850_1453059_+\|transposase	IS4-like element ISVsa5 family transposase	A0A0F7LAS3	uncultured_marine_virus	1.8e-235	100.0
WP_031847506.1\|1453183_1454350_-	EAL domain-containing protein	NA	NA	NA	NA
WP_083135930.1\|1454333_1457999_-	transporter substrate-binding domain-containing protein	A0A1V0SGX0	Hokovirus	1.5e-30	35.8
WP_083135931.1\|1458408_1459860_-	DUF1254 domain-containing protein	NA	NA	NA	NA
WP_025498937.1\|1460050_1461049_+	LysR family transcriptional regulator	NA	NA	NA	NA
WP_005454328.1\|1462385_1463330_+	ribosome biogenesis GTPase YlqF	NA	NA	NA	NA
WP_021450908.1\|1463684_1464866_+	quorum-sensing autoinducer synthase	NA	NA	NA	NA
WP_021450907.1\|1464943_1466992_-	response regulator	Q8QKV7	Ectocarpus_siliculosus_virus	6.1e-10	33.9
WP_031848002.1\|1469332_1470541_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-50	48.7
WP_083135344.1\|1471220_1472354_-	multidrug effflux MFS transporter	NA	NA	NA	NA
WP_031847180.1\|1472493_1473273_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_005463837.1\|1473291_1473813_-	hypothetical protein	A0A1W6JNX6	Morganella_phage	3.5e-39	48.8
WP_031847179.1\|1473868_1474396_-	histidine phosphatase family protein	NA	NA	NA	NA
WP_031847178.1\|1474426_1474951_-	AAA family ATPase	A0A097BYE2	Leuconostoc_phage	5.1e-14	39.2
WP_011106405.1\|1475351_1475741_+	pyruvate dehydrogenase	NA	NA	NA	NA
WP_005488655.1\|1478870_1480004_-	exonuclease SbcCD subunit D	A0A217ER54	Bacillus_phage	1.3e-09	27.2
WP_083135345.1\|1480100_1480943_-	transhydrogenase beta subunit	NA	NA	NA	NA
WP_005499010.1\|1480943_1481234_-	type VI secretion protein	NA	NA	NA	NA
WP_020837938.1\|1481247_1483083_-	type VI secretion system tip protein VgrG	A0A077K8Q4	Ralstonia_phage	1.3e-27	24.6
WP_005375967.1\|1483140_1483620_-	type VI secretion system tube protein Hcp	NA	NA	NA	NA
WP_083135346.1\|1483825_1486393_-	type VI secretion system ATPase TssH	H6X3M6	Enterobacteria_phage	3.1e-88	30.5
WP_083135347.1\|1486403_1487369_-\|plate	type VI secretion system baseplate subunit TssG	NA	NA	NA	NA
WP_031847175.1\|1487365_1489189_-\|plate	type VI secretion system baseplate subunit TssF	NA	NA	NA	NA
WP_015313304.1\|1489185_1489650_-\|plate	type VI secretion system baseplate subunit TssE	NA	NA	NA	NA
WP_031847174.1\|1489658_1490456_-	protein of avirulence locus	NA	NA	NA	NA
WP_075110184.1\|1490466_1491987_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_031847173.1\|1492033_1493527_-	type VI secretion system contractile sheath large subunit	NA	NA	NA	NA
WP_005463809.1\|1493526_1494057_-	type VI secretion system contractile sheath small subunit	NA	NA	NA	NA
WP_065770497.1\|1494072_1495194_-	type VI secretion system protein TssA	NA	NA	NA	NA
WP_005463805.1\|1495190_1495979_-	serine/threonine-protein phosphatase	NA	NA	NA	NA
WP_025557238.1\|1495989_1496685_-	type VI secretion system-associated protein TagF	NA	NA	NA	NA
WP_083135348.1\|1496666_1500185_-	type VI secretion system membrane subunit TssM	NA	NA	NA	NA
WP_083135349.1\|1500200_1501502_-	type VI secretion system protein TssL	NA	NA	NA	NA
WP_083135350.1\|1501504_1502830_-\|plate	type VI secretion system baseplate subunit TssK	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

2. NZ_CP046831

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

337289 : 354685

uncultured_Mediterranean_phage(20.0%)

tRNA

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_005455581.1\|337289_338930_+	CTP synthase	A0A1J0FA14	Only_Syngen_Nebraska_virus	4.2e-155	52.4
WP_005455579.1\|339008_340310_+	phosphopyruvate hydratase	A0A1X9I5Z8	Streptococcus_phage	4.2e-134	59.2
WP_025505278.1\|340935_341217_+	cell division protein FtsB	NA	NA	NA	NA
WP_025442246.1\|341218_341923_+	2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase	A0A2H4UTB4	Bodo_saltans_virus	5.9e-05	23.6
WP_005380896.1\|341940_342417_+	2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase	NA	NA	NA	NA
WP_024702352.1\|342463_343507_+\|tRNA	tRNA pseudouridine(13) synthase TruD	NA	NA	NA	NA
WP_005478553.1\|343506_344283_+	5'/3'-nucleotidase SurE	A0A1B1ITZ2	uncultured_Mediterranean_phage	5.0e-66	52.4
WP_005455562.1\|344282_344909_+	protein-L-isoaspartate(D-aspartate) O-methyltransferase	A0A1B1IU40	uncultured_Mediterranean_phage	1.3e-35	52.1
WP_083135849.1\|344923_345847_+	peptidoglycan DD-metalloendopeptidase family protein	D7RWE0	Brochothrix_phage	4.1e-06	35.2
WP_005478546.1\|346996_349558_-	DNA mismatch repair protein MutS	A0A1V0SC35	Catovirus	1.3e-33	23.7
WP_005455551.1\|349642_350125_+	nicotinamide-nucleotide amidase	B5TK85	Pseudomonas_phage	1.7e-27	48.7
WP_005478550.1\|350325_351369_+	recombinase RecA	A0A2D1GPX2	Mycobacterium_phage	8.1e-112	60.7
WP_025633034.1\|351492_351960_+	recombination regulator RecX	NA	NA	NA	NA
WP_005455546.1\|352102_354685_+\|tRNA	alanine--tRNA ligase	A0A1V0SK38	Klosneuvirus	1.0e-78	37.9

DBSCAN-SWA_2

466694 : 473396

Staphylococcus_phage(50.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083135492.1\|466694_467834_+	glutamate 5-kinase	A0A1X9I5D0	Streptococcus_phage	1.0e-62	41.7
WP_031847473.1\|467851_469102_+	glutamate-5-semialdehyde dehydrogenase	A0A1X9I5D4	Streptococcus_phage	1.6e-98	48.2
WP_005482986.1\|469229_469679_+	transcriptional regulator NrdR	NA	NA	NA	NA
WP_031847251.1\|469686_470811_+	bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase RibD	A0A1V0SE20	Indivirus	4.0e-48	36.0
WP_005483039.1\|470823_471477_+	riboflavin synthase	A0A2H4PQS5	Staphylococcus_phage	1.6e-33	37.5
WP_020840184.1\|471646_472756_+	bifunctional 3,4-dihydroxy-2-butanone-4-phosphate synthase/GTP cyclohydrolase II	A0A2H4PQS2	Staphylococcus_phage	2.0e-63	39.6
WP_005440184.1\|472925_473396_+	6,7-dimethyl-8-ribityllumazine synthase	A0A2H4PQS3	Staphylococcus_phage	1.7e-32	49.3

DBSCAN-SWA_3

1206508 : 1220526

Vibrio_phage(30.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_021453797.1\|1206508_1206697_-	hypothetical protein	F6LQB8	Bdellovibrio_phage	8.8e-09	52.8
WP_021453095.1\|1207021_1207549_-	siphovirus Gp157 family protein	NA	NA	NA	NA
WP_083135781.1\|1207541_1210706_-	hypothetical protein	I3PUZ3	Vibrio_phage	1.5e-23	32.8
WP_127463331.1\|1210718_1210898_-	hypothetical protein	NA	NA	NA	NA
WP_049874960.1\|1211689_1212406_-	helix-turn-helix domain-containing protein	G9L676	Escherichia_phage	1.4e-22	37.2
WP_021453632.1\|1212457_1212709_+	hypothetical protein	A0A1I9KFF6	Aeromonas_phage	2.9e-07	41.9
WP_005495415.1\|1212728_1213193_+	hypothetical protein	K7PJS5	Enterobacterial_phage	3.0e-18	48.0
WP_005495414.1\|1213189_1213408_+	hypothetical protein	NA	NA	NA	NA
WP_021453591.1\|1213473_1214427_+	helix-turn-helix domain-containing protein	A0A1V0E831	Vibrio_phage	2.9e-39	35.3
WP_005495410.1\|1214423_1214804_+	hypothetical protein	NA	NA	NA	NA
WP_005495408.1\|1214796_1215447_+	DUF1367 family protein	K7PKS6	Enterobacteria_phage	7.0e-21	36.5
WP_005495404.1\|1215615_1216017_+	NinG recombination protein/bacteriophage lambda NinG family protein	A0A2I7S3K0	Vibrio_phage	3.7e-20	45.0
WP_005495402.1\|1216053_1216461_+	APSE-2 prophage; Q protein	NA	NA	NA	NA
WP_005483162.1\|1216683_1216887_-	hypothetical protein	NA	NA	NA	NA
WP_005483265.1\|1217793_1218006_+	cold-shock protein	A0A1W6JNX5	Morganella_phage	2.9e-16	61.2
WP_005495398.1\|1218300_1220526_+	ribonuclease R	Q0GXV6	Lactococcus_phage	8.2e-61	31.7

DBSCAN-SWA_4

3119711 : 3165278

Klosneuvirus(12.5%)

transposase,integrase,holin

attL 3123195:3123210|attR 3166829:3166844

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_025535356.1\|3119711_3120224_-\|holin	phage holin family protein	NA	NA	NA	NA
WP_082244986.1\|3120267_3120693_-	hypothetical protein	NA	NA	NA	NA
WP_005466482.1\|3120961_3121393_+	PA2169 family four-helix-bundle protein	NA	NA	NA	NA
WP_005466483.1\|3121509_3121908_+	hypothetical protein	NA	NA	NA	NA
WP_031847830.1\|3122127_3123765_-	hypothetical protein	NA	NA	NA	NA
3123195:3123210	attL	NA	NA	NA	NA
WP_005466989.1\|3123799_3124231_-	hemerythrin domain-containing protein	NA	NA	NA	NA
WP_005466987.1\|3124322_3124520_-	hypothetical protein	NA	NA	NA	NA
WP_005478615.1\|3124528_3124705_-	DUF1328 domain-containing protein	NA	NA	NA	NA
WP_005466985.1\|3124749_3125301_-	BON domain-containing protein	NA	NA	NA	NA
WP_031847831.1\|3125734_3127078_+	sigma-54-dependent Fis family transcriptional regulator	NA	NA	NA	NA
WP_031812712.1\|3127163_3128357_-	NAD(P)/FAD-dependent oxidoreductase	NA	NA	NA	NA
WP_005394407.1\|3128514_3128838_-	universal stress protein UspB	NA	NA	NA	NA
WP_005467599.1\|3128928_3129456_-	non-heme ferritin	NA	NA	NA	NA
WP_005467601.1\|3129683_3130109_+	universal stress protein UspA	NA	NA	NA	NA
WP_005467602.1\|3130173_3131052_+	DMT family transporter	NA	NA	NA	NA
WP_021453983.1\|3131122_3131695_-	hypothetical protein	NA	NA	NA	NA
WP_021448975.1\|3131881_3132661_-	ribosomal RNA small subunit methyltransferase J	NA	NA	NA	NA
WP_025502181.1\|3132750_3135891_-	EAL domain-containing protein	NA	NA	NA	NA
WP_005465258.1\|3136004_3136469_+	transcriptional regulator AsnC	NA	NA	NA	NA
WP_005478727.1\|3136535_3138578_-	oligopeptidase A	A0A1V0SID3	Klosneuvirus	3.1e-62	25.8
WP_005478729.1\|3138977_3139817_+	23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ	NA	NA	NA	NA
WP_083135617.1\|3140064_3141429_+	glutathione-disulfide reductase	NA	NA	NA	NA
WP_122016068.1\|3141504_3142722_+\|integrase	site-specific integrase	NA	NA	NA	NA
WP_083135616.1\|3142718_3144407_+	hypothetical protein	NA	NA	NA	NA
WP_083135615.1\|3144416_3146531_+\|integrase	integrase	A0A2H4J185	uncultured_Caudovirales_phage	5.0e-07	24.5
WP_031847834.1\|3146502_3146955_+	hypothetical protein	NA	NA	NA	NA
WP_031848002.1\|3147023_3148232_-\|transposase	IS256 family transposase	A0A218MNI5	uncultured_virus	3.5e-50	48.7
WP_031847927.1\|3148318_3150679_-	S8 family peptidase	NA	NA	NA	NA
WP_031847928.1\|3150703_3151678_-	AAA family ATPase	Q677Q6	Lymphocystis_disease_virus	4.3e-14	29.3
WP_122016069.1\|3152029_3152554_-	hypothetical protein	NA	NA	NA	NA
WP_083135936.1\|3152656_3152971_+	helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_031847929.1\|3152980_3153961_+	adenosine deaminase	NA	NA	NA	NA
WP_083135935.1\|3153957_3154512_+	non-canonical purine NTP pyrophosphatase	A0A1V0SHD8	Hokovirus	4.1e-22	37.0
WP_083135934.1\|3154511_3155300_+	Sir2 family NAD-dependent protein deacetylase	NA	NA	NA	NA
WP_083135933.1\|3155401_3155962_+	hypothetical protein	NA	NA	NA	NA
WP_139794960.1\|3157004_3157598_+	tetracyline resistance-associated transcriptional repressor TetC	NA	NA	NA	NA
WP_010446567.1\|3157710_3158916_-	tetracycline efflux MFS transporter Tet(B)	A0A2H4UVM2	Bodo_saltans_virus	3.0e-09	24.4
WP_001322387.1\|3158994_3159621_+	tetracycline resistance transcriptional repressor TetR(B)	NA	NA	NA	NA
WP_001284954.1\|3159598_3160285_-	winged helix-turn-helix transcriptional regulator	NA	NA	NA	NA
WP_000460651.1\|3160292_3160679_-	hypothetical protein	NA	NA	NA	NA
WP_000562370.1\|3160671_3160992_-	antibiotic biosynthesis monooxygenase	NA	NA	NA	NA
WP_000599531.1\|3161435_3162641_+	sodium/glutamate symporter	NA	NA	NA	NA
WP_083135829.1\|3162699_3163620_-\|transposase	IS5 family transposase	A0A1V0E8E1	Vibrio_phage	1.9e-173	98.0
WP_001352368.1\|3164069_3165278_-\|transposase	IS4-like element ISVsa5 family transposase	A0A0F7LAS3	uncultured_marine_virus	1.8e-235	100.0
3166829:3166844	attR	NA	NA	NA	NA

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

3. NZ_CP046830

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_ID	Protospacer_location	Mismatch	Identity

MGE targeting detection<

CRISPR_ID	Spacer_Info	Spacer_region	Spacer_length	Hit_phage_ID	Hit_phage_def	Protospacer_location	Mismatch	Identity

Prophage detection

Region

Region Position

Protein_number

Hit_taxonomy

Key_proteins

Att_site

Prophage annotation

DBSCAN-SWA_1

0 : 40607

Vibrio_phage(30.0%)

integrase

attL 16143:16158|attR 45554:45569

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031847581.1\|7060_7477_+	hypothetical protein	NA	NA	NA	NA
WP_139794967.1\|7615_9277_+	hypothetical protein	A0A222YXQ7	Escherichia_phage	3.2e-78	33.2
WP_050548984.1\|9269_10301_+	hypothetical protein	NA	NA	NA	NA
WP_031847584.1\|10420_10759_-	hypothetical protein	NA	NA	NA	NA
WP_031847585.1\|10751_11411_-	hypothetical protein	Q2A085	Sodalis_phage	1.5e-23	34.6
WP_031847586.1\|11901_12774_+	RepB family plasmid replication initiator protein	J9Q7H0	Salmonella_phage	3.3e-50	41.1
WP_083135861.1\|13009_13852_-	Dam family site-specific DNA-(adenine-N6)-methyltransferase	F1BUN1	Cronobacter_phage	4.2e-26	32.1
WP_020195292.1\|13853_14114_-	hypothetical protein	NA	NA	NA	NA
WP_020195293.1\|14131_14494_-	hypothetical protein	NA	NA	NA	NA
WP_012219888.1\|14483_14849_-	DUF4406 domain-containing protein	A0A0U2SAZ1	Escherichia_phage	9.4e-15	40.4
WP_012219889.1\|15054_15336_+	hypothetical protein	NA	NA	NA	NA
WP_020195210.1\|15523_15943_+	hypothetical protein	NA	NA	NA	NA
WP_031847591.1\|15970_16882_+	recombination-associated protein RdgC	A0A2I7RNT5	Vibrio_phage	2.6e-98	58.7
16143:16158	attL	NA	NA	NA	NA
WP_020195212.1\|16872_17661_+	hypothetical protein	NA	NA	NA	NA
WP_031847592.1\|17724_18075_+	hypothetical protein	NA	NA	NA	NA
WP_083135860.1\|18751_19291_+	hypothetical protein	NA	NA	NA	NA
WP_139794966.1\|19303_19840_+	hypothetical protein	R9TNL4	Vibrio_phage	2.8e-15	39.5
WP_031847594.1\|19881_20127_-	hypothetical protein	NA	NA	NA	NA
WP_139045306.1\|20184_20511_-	hypothetical protein	Q6V7U0	Burkholderia_virus	3.8e-07	32.4
WP_050548986.1\|20564_21383_-	3'-5' exoribonuclease	A0A1I9KF44	Aeromonas_phage	7.7e-33	42.9
WP_083135859.1\|21440_22382_-	hypothetical protein	NA	NA	NA	NA
WP_083135858.1\|22431_23622_-	hypothetical protein	NA	NA	NA	NA
WP_012219907.1\|23677_23875_-	hypothetical protein	NA	NA	NA	NA
WP_020195220.1\|23950_24175_-	hypothetical protein	NA	NA	NA	NA
WP_031847600.1\|24346_25525_+\|integrase	site-specific integrase	A0A067ZJC5	Vibrio_phage	1.5e-66	37.0
WP_158083984.1\|25620_26133_+	hypothetical protein	A0A2I7RSZ7	Vibrio_phage	1.7e-06	31.3
WP_031847602.1\|26182_27193_+	nucleoid-associated protein YejK	A0A1V0E8C0	Vibrio_phage	9.0e-124	67.3
WP_031847603.1\|27189_27918_+	hypothetical protein	NA	NA	NA	NA
WP_050548988.1\|27920_28406_+	hypothetical protein	NA	NA	NA	NA
WP_031847604.1\|28408_28891_+	hypothetical protein	NA	NA	NA	NA
WP_031847605.1\|28902_29796_+	hypothetical protein	A0A1X9HVL1	Ruegeria_phage	1.8e-11	40.2
WP_031847606.1\|29792_31544_+	DEAD/DEAH box helicase	A0A1X9HX80	Ruegeria_phage	3.0e-119	42.2
WP_031847607.1\|31556_31778_+	hypothetical protein	NA	NA	NA	NA
WP_050548989.1\|31788_32553_+	hypothetical protein	R9VWB9	Serratia_phage	9.4e-41	42.3
WP_031847609.1\|32549_32861_+	hypothetical protein	A0A2I7QIG7	Vibrio_phage	1.1e-16	42.6
WP_031847610.1\|32857_33307_+	hypothetical protein	NA	NA	NA	NA
WP_031847611.1\|33617_33866_+	hypothetical protein	NA	NA	NA	NA
WP_083135871.1\|33933_34365_+	transglycosylase SLT domain-containing protein	M4R0Y9	Tetraselmis_viridis_virus	2.5e-30	53.7
WP_031847612.1\|34361_34760_+	hypothetical protein	NA	NA	NA	NA
WP_083135856.1\|34752_34956_+	hypothetical protein	NA	NA	NA	NA
WP_031847613.1\|34942_35353_+	hypothetical protein	NA	NA	NA	NA
WP_079452573.1\|35812_36538_+	hypothetical protein	NA	NA	NA	NA
WP_031847615.1\|36527_38246_+	hypothetical protein	Q71T61	Escherichia_phage	3.3e-94	40.1
WP_031847616.1\|38878_39202_+	hypothetical protein	NA	NA	NA	NA
WP_031847617.1\|39268_39955_+	DUF2786 domain-containing protein	A0A2P9JZH4	Alteromonadaceae_phage	1.9e-24	32.1
WP_020195240.1\|40016_40607_+\|integrase	tyrosine-type recombinase/integrase	A0A2H4J6I5	uncultured_Caudovirales_phage	2.1e-24	39.2
45554:45569	attR	NA	NA	NA	NA

DBSCAN-SWA_2

44706 : 46356

Vibrio_phage(100.0%)

integrase

attL 39999:40011|attR 47512:47524

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
39999:40011	attL	NA	NA	NA	NA
WP_031847625.1\|44706_45849_+\|integrase	tyrosine-type recombinase/integrase	A0A2I7R1N2	Vibrio_phage	3.7e-33	30.6
WP_050548992.1\|45942_46356_+	hypothetical protein	A0A2I7RNG1	Vibrio_phage	5.1e-25	45.4
47512:47524	attR	NA	NA	NA	NA

DBSCAN-SWA_3

50061 : 51240

Escherichia_phage(100.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_031847634.1\|50061_51240_+	hypothetical protein	A0A222YXT1	Escherichia_phage	1.4e-38	34.5

DBSCAN-SWA_4

55090 : 65138

Escherichia_phage(75.0%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083135869.1\|55090_56089_+	hypothetical protein	A0A222YXZ0	Escherichia_phage	1.0e-26	27.5
WP_031847564.1\|56883_57093_+	hypothetical protein	NA	NA	NA	NA
WP_031847565.1\|57346_58945_+	hypothetical protein	A0A222YWC7	Escherichia_phage	2.9e-68	29.1
WP_083135868.1\|59014_59518_+	hypothetical protein	NA	NA	NA	NA
WP_083135867.1\|59524_61075_+	hypothetical protein	A0A1B0V7E4	Salmonella_phage	1.0e-62	32.7
WP_012219856.1\|61085_61757_+	hypothetical protein	NA	NA	NA	NA
WP_012219860.1\|61756_62401_+	hypothetical protein	A0A222YY02	Escherichia_phage	5.5e-26	37.1
WP_012219903.1\|62414_62915_+	hypothetical protein	Q71TM5	Escherichia_phage	1.9e-18	34.8
WP_031847567.1\|62911_63469_+	hypothetical protein	Q1MVL0	Enterobacteria_phage	3.5e-21	37.7
WP_031847568.1\|63479_63839_+	hypothetical protein	NA	NA	NA	NA
WP_014980795.1\|63828_64338_+	hypothetical protein	A0A222YY05	Escherichia_phage	2.2e-14	30.2
WP_031847569.1\|64340_65138_+	hypothetical protein	Q71TC9	Escherichia_phage	1.1e-23	32.6

DBSCAN-SWA_5

68764 : 74946

Escherichia_phage(66.67%)

Protein_ID	Protein_Def	Hit_ID	Hit_Def	E-value	Identity
WP_083135865.1\|68764_70189_+	lipopolysaccharide biosynthesis protein BplA	Q71TP2	Escherichia_phage	9.3e-58	30.0
WP_031847571.1\|70300_71728_+	hypothetical protein	NA	NA	NA	NA
WP_031847572.1\|71732_72170_+	hypothetical protein	NA	NA	NA	NA
WP_031847573.1\|72173_72728_+	hypothetical protein	NA	NA	NA	NA
WP_020195279.1\|72838_73441_+	hypothetical protein	O21969	Escherichia_phage	1.2e-09	35.0
WP_083135864.1\|73437_74946_+	hypothetical protein	Q1MVM7	Enterobacteria_phage	1.1e-16	28.0

Anti-CRISPR protein detection

Acr ID	Acr position	Acr size	Homology with known anti	Neighbor HTH/AcRanker	Neighbor Aca	In prophage	Protospacer in prophage

Overview of predicted results

Overview of the results

Cas Category Instructions

Results visualization

1. NZ_CP046829

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Click the colored protein region to show detailed information

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

2. NZ_CP046831

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection

3. NZ_CP046830

Click the left colored region to show detailed information

CRISPR-Cas detection and classification

Self-targeting detection

MGE targeting detection<

Prophage detection

Anti-CRISPR protein detection